F393258

General Info

Members Datasets Scaffolds Average Seq Length
296 186 592 258

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10039594|Ga0265331_100395943
Length 288
Sequence MQLALPTKRSGAHPDGPWTVCAVRCRREFHDCLLQCLSVFVLLVLLPSAAPAQTTPVQYAQADIAFGSQIFKTQCTACHGANGDSVPGVNFRAGQFRVPVSSDFDLRTIITTGVAGTAMPSFNFDTAELTEIIAYLRNMSTFDARGVTMGDAERGQALFEGKGNCASCHRVNGKGPRVAPDLSDVGATRTADLLEKTLLDPTASMLPVNRSVRAVTKDGKVITGRRLNEDTYTVQLIDEHENLVALDKADLREYTVVKTSSMPPYKDTFSSQEIADVLAYLFSLKGSK

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.34
Rhizosphere 99.66
Stem 0
Stem Tuber 0
Unclassified 13.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10039594 3300031250 Bacteria 2298
2 MBSR1b_contig_1383066 2162886012 Bacteria 958
3 JGI24749J21850_1006557 3300002076 Bacteria 1621
4 JGI24751J29686_10033832 3300002459 Bacteria 1059
5 Ga0065714_10124007 3300005288 Bacteria 1316
6 Ga0065715_10013073 3300005293 Bacteria 2856
7 Ga0065715_10153459 3300005293 Bacteria 1703
8 Ga0065707_10340344 3300005295 Unclassified 934
9 Ga0070676_10014081 3300005328 Bacteria 4389
10 Ga0070676_10019578 3300005328 Bacteria 3768
11 Ga0070690_100044487 3300005330 Bacteria 2818
12 Ga0070670_100001593 3300005331 Bacteria 18314
13 Ga0070670_100051869 3300005331 Unclassified 3522
14 Ga0070677_10006108 3300005333 Bacteria 3997
15 Ga0068869_100016277 3300005334 Bacteria 5010
16 Ga0070666_10010224 3300005335 Bacteria 5862
17 Ga0070666_10062520 3300005335 Bacteria 2523
18 Ga0070666_10137924 3300005335 Bacteria 1698
19 Ga0070682_100041610 3300005337 Bacteria 2833
20 Ga0068868_100071483 3300005338 Bacteria 2767
21 Ga0070689_100019175 3300005340 Bacteria 5055
22 Ga0070689_100055576 3300005340 Bacteria 3068
23 Ga0070687_100002959 3300005343 Bacteria 6519
24 Ga0070661_100014169 3300005344 Bacteria 5615
25 Ga0070661_100121381 3300005344 Bacteria 1958
26 Ga0070668_100230450 3300005347 Bacteria 1531
27 Ga0070668_100482282 3300005347 Bacteria 1071
28 Ga0070669_100154942 3300005353 Bacteria 1776
29 Ga0070669_100300187 3300005353 Bacteria 1291
30 Ga0070669_100507371 3300005353 Bacteria 1001
31 Ga0070671_100150974 3300005355 Bacteria 1962
32 Ga0070674_100171045 3300005356 Bacteria 1656
33 Ga0070673_100036973 3300005364 Bacteria 3716
34 Ga0070673_100137742 3300005364 Bacteria 2056
35 Ga0070688_100016975 3300005365 Bacteria 4171
36 Ga0070688_100025056 3300005365 Unclassified 3528
37 Ga0070659_100086917 3300005366 Bacteria 2503
38 Ga0070667_100069580 3300005367 Bacteria 2995
39 Ga0070709_10127815 3300005434 Unclassified 1731
40 Ga0070709_10220919 3300005434 Bacteria 1351
41 Ga0070714_100275741 3300005435 Bacteria 1561
42 Ga0070713_100040974 3300005436 Bacteria 3770
43 Ga0070713_100076010 3300005436 Bacteria 2850
44 Ga0070701_10228971 3300005438 Bacteria 1112
45 Ga0070711_100090676 3300005439 Bacteria 2202
46 Ga0070700_100390075 3300005441 Unclassified 1044
47 Ga0070708_100074387 3300005445 Bacteria 3064
48 Ga0070678_100165602 3300005456 Bacteria 1795
49 Ga0070678_100392688 3300005456 Bacteria 1203
50 Ga0070662_100008869 3300005457 Bacteria 6555
51 Ga0068867_100037565 3300005459 Bacteria 3520
52 Ga0068867_100079054 3300005459 Bacteria 2475
53 Ga0070685_10002800 3300005466 Bacteria 8910
54 Ga0070685_10029632 3300005466 Bacteria 3042
55 Ga0070707_100430500 3300005468 Bacteria 1280
56 Ga0070697_100365293 3300005536 Bacteria 1248
57 Ga0070672_100003162 3300005543 Bacteria 10645
58 Ga0070686_100031663 3300005544 Bacteria 3236
59 Ga0070686_100093839 3300005544 Bacteria 2013
60 Ga0070696_100046237 3300005546 Bacteria 3017
61 Ga0070664_100013773 3300005564 Bacteria 6592
62 Ga0070664_100077027 3300005564 Unclassified 2867
63 Ga0070664_100169567 3300005564 Bacteria 1936
64 Ga0068852_100309960 3300005616 Bacteria 1530
65 Ga0068859_100284353 3300005617 Bacteria 1747
66 Ga0068859_100359221 3300005617 Bacteria 1552
67 Ga0068864_100281809 3300005618 Bacteria 1551
68 Ga0068866_10170563 3300005718 Bacteria 1277
69 Ga0068861_100027279 3300005719 Bacteria 4158
70 Ga0068870_10067533 3300005840 Bacteria 1940
71 Ga0068863_100013792 3300005841 Bacteria 7788
72 Ga0068858_100027848 3300005842 Bacteria 5250
73 Ga0068862_100178260 3300005844 Bacteria 1906
74 Ga0081455_10044544 3300005937 Bacteria 3869
75 Ga0081540_1044950 3300005983 Bacteria 2248
76 Ga0075432_10027715 3300006058 Unclassified 1951
77 Ga0097621_100073108 3300006237 Bacteria 2838
78 Ga0075428_100008864 3300006844 Bacteria 11157
79 Ga0075428_100015035 3300006844 Bacteria 8598
80 Ga0075428_100210962 3300006844 Unclassified 2098
81 Ga0075428_100297101 3300006844 Bacteria 1737
82 Ga0075430_100002057 3300006846 Bacteria 16584
83 Ga0075430_100039832 3300006846 Bacteria 3977
84 Ga0075430_100517140 3300006846 Unclassified 985
85 Ga0075431_100006699 3300006847 Bacteria 11439
86 Ga0075431_100203264 3300006847 Bacteria 2026
87 Ga0075433_10001059 3300006852 Bacteria 19724
88 Ga0075433_10024011 3300006852 Bacteria 5140
89 Ga0075434_100001970 3300006871 Bacteria 17816
90 Ga0075434_100144899 3300006871 Bacteria 2395
91 Ga0075429_100002929 3300006880 Bacteria 14474
92 Ga0075429_100088912 3300006880 Bacteria 2692
93 Ga0075429_100128537 3300006880 Unclassified 2216
94 Ga0075429_100244132 3300006880 Bacteria 1573
95 Ga0068865_100423892 3300006881 Bacteria 1095
96 Ga0068865_100426211 3300006881 Unclassified 1092
97 Ga0097620_100284363 3300006931 Bacteria 1747
98 Ga0097620_100359199 3300006931 Bacteria 1552
99 Ga0075435_100003014 3300007076 Bacteria 11340
100 Ga0099794_10061641 3300007265 Bacteria 1823
101 Ga0099795_10048020 3300007788 Bacteria 1544
102 Ga0105240_10007927 3300009093 Bacteria 15317
103 Ga0111539_10001544 3300009094 Bacteria 30675
104 Ga0111539_10051054 3300009094 Bacteria 4926
105 Ga0111539_10061119 3300009094 Bacteria 4463
106 Ga0111539_10114556 3300009094 Bacteria 3162
107 Ga0105245_10107370 3300009098 Bacteria 2592
108 Ga0114129_10000618 3300009147 Bacteria 44064
109 Ga0114129_10101244 3300009147 Bacteria 3986
110 Ga0114129_10130845 3300009147 Bacteria 3447
111 Ga0114129_10244111 3300009147 Unclassified 2413
112 Ga0105243_10356248 3300009148 Bacteria 1345
113 Ga0105248_10084330 3300009177 Bacteria 3574
114 Ga0105249_10013504 3300009553 Bacteria 7212
115 Ga0105249_10397992 3300009553 Bacteria 1407
116 Ga0099796_10106470 3300010159 Bacteria 1062
117 Ga0157374_10124953 3300013296 Bacteria 2486
118 Ga0163163_10029102 3300014325 Bacteria 5312
119 Ga0163163_10090762 3300014325 Bacteria 3069
120 Ga0163163_10224336 3300014325 Bacteria 1928
121 Ga0157380_10034658 3300014326 Bacteria 3894
122 Ga0157380_10042370 3300014326 Bacteria 3559
123 Ga0157380_10190727 3300014326 Bacteria 1809
124 Ga0157377_10026197 3300014745 Bacteria 3118
125 Ga0157377_10087633 3300014745 Bacteria 1832
126 Ga0157377_10163598 3300014745 Bacteria 1386
127 Ga0157379_10010446 3300014968 Bacteria 8093
128 Ga0163161_10174830 3300017792 Bacteria 1644
129 Ga0207697_10001182 3300025315 Bacteria 14335
130 Ga0207682_10000925 3300025893 Bacteria 13606
131 Ga0207682_10003463 3300025893 Bacteria 6843
132 Ga0207688_10003828 3300025901 Bacteria 8210
133 Ga0207680_10027267 3300025903 Bacteria 3178
134 Ga0207680_10169848 3300025903 Bacteria 1468
135 Ga0207699_10033946 3300025906 Bacteria 2888
136 Ga0207699_10196699 3300025906 Bacteria 1364
137 Ga0207645_10009302 3300025907 Bacteria 6804
138 Ga0207645_10012481 3300025907 Bacteria 5761
139 Ga0207643_10005319 3300025908 Bacteria 6887
140 Ga0207643_10040894 3300025908 Bacteria 2611
141 Ga0207660_10378584 3300025917 Bacteria 1137
142 Ga0207662_10001869 3300025918 Bacteria 10359
143 Ga0207662_10054010 3300025918 Bacteria 2394
144 Ga0207649_10083713 3300025920 Bacteria 2071
145 Ga0207649_10170285 3300025920 Bacteria 1516
146 Ga0207646_10200251 3300025922 Bacteria 1804
147 Ga0207681_10090282 3300025923 Bacteria 2186
148 Ga0207681_10099314 3300025923 Bacteria 2096
149 Ga0207650_10008849 3300025925 Bacteria 6879
150 Ga0207650_10041568 3300025925 Bacteria 3369
151 Ga0207659_10051154 3300025926 Bacteria 2937
152 Ga0207687_10066399 3300025927 Bacteria 2564
153 Ga0207700_10043540 3300025928 Bacteria 3298
154 Ga0207644_10124078 3300025931 Bacteria 1969
155 Ga0207690_10327687 3300025932 Unclassified 1205
156 Ga0207706_10017509 3300025933 Bacteria 6459
157 Ga0207706_10019806 3300025933 Bacteria 6049
158 Ga0207706_10287839 3300025933 Bacteria 1432
159 Ga0207670_10007865 3300025936 Bacteria 5984
160 Ga0207670_10134913 3300025936 Bacteria 1813
161 Ga0207669_10003758 3300025937 Bacteria 6591
162 Ga0207669_10247315 3300025937 Bacteria 1326
163 Ga0207704_10026916 3300025938 Bacteria 3162
164 Ga0207691_10005392 3300025940 Bacteria 12349
165 Ga0207691_10010414 3300025940 Bacteria 8922
166 Ga0207711_10274103 3300025941 Bacteria 1553
167 Ga0207711_10278136 3300025941 Bacteria 1541
168 Ga0207689_10013969 3300025942 Bacteria 6838
169 Ga0207679_10026771 3300025945 Bacteria 3980
170 Ga0207679_10051687 3300025945 Unclassified 3009
171 Ga0207679_10233199 3300025945 Bacteria 1555
172 Ga0207651_10026314 3300025960 Bacteria 3631
173 Ga0207651_10035091 3300025960 Bacteria 3256
174 Ga0207712_10045388 3300025961 Bacteria 3043
175 Ga0207668_10244298 3300025972 Bacteria 1454
176 Ga0207658_10060905 3300025986 Bacteria 2818
177 Ga0207677_10027694 3300026023 Bacteria 3574
178 Ga0207708_10152359 3300026075 Bacteria 1821
179 Ga0207641_10014953 3300026088 Bacteria 6362
180 Ga0207648_10017342 3300026089 Bacteria 6556
181 Ga0207648_10165989 3300026089 Bacteria 1951
182 Ga0207676_10023835 3300026095 Bacteria 4522
183 Ga0207674_10802682 3300026116 Unclassified 908
184 Ga0207675_100003565 3300026118 Bacteria 15159
185 Ga0207675_100080057 3300026118 Bacteria 3062
186 Ga0207683_10003458 3300026121 Bacteria 13777
187 Ga0207683_10133929 3300026121 Bacteria 2230
188 Ga0207698_10019929 3300026142 Bacteria 4605
189 Ga0209179_1002431 3300027512 Bacteria 2518
190 Ga0209588_1021625 3300027671 Bacteria 2022
191 Ga0209974_10024761 3300027876 Bacteria 1985
192 Ga0207428_10002190 3300027907 Bacteria 19642
193 Ga0207428_10135546 3300027907 Bacteria 1882
194 Ga0265338_10028651 3300028800 Bacteria 5548
195 Ga0265338_10230520 3300028800 Unclassified 1378
196 Ga0265760_10030260 3300031090 Unclassified 1594
197 Ga0265325_10000905 3300031241 Bacteria 21387
198 Ga0265325_10185245 3300031241 Bacteria 967
199 Ga0265316_10026626 3300031344 Unclassified 4805
200 Ga0265316_10038228 3300031344 Unclassified 3868
201 Ga0373923_0001877 3300035111 Bacteria 6259
202 Ga0373955_0171832 3300035172 Bacteria 1283
203 Ga0373961_0043784 3300035241 Unclassified 1303
204 Ga0373947_0002233 3300035725 Bacteria 11713
205 Ga0373937_0087032 3300036401 Bacteria 2891
206 Ga0439433_0007796 3300041999 Bacteria 2314
207 Ga0453683_0403426 3300044673 Unclassified 881
208 Ga0451576_0333904 3300045051 Bacteria 1586
209 Ga0495592_0003633 3300046454 Bacteria 11104
210 Ga0495603_0098460 3300046455 Unclassified 1708
211 Ga0495651_0000107 3300046462 Bacteria 61202
212 Ga0495651_0001744 3300046462 Bacteria 16767
213 Ga0495651_0009643 3300046462 Bacteria 7422
214 Ga0495653_0004997 3300046463 Bacteria 10762
215 Ga0495653_0009775 3300046463 Bacteria 7841
216 Ga0495580_0010119 3300046472 Bacteria 7367
217 Ga0495664_0018253 3300046477 Bacteria 4016
218 Ga0495594_0017167 3300046499 Unclassified 3820
219 Ga0495608_0007221 3300046511 Bacteria 7857
220 Ga0495608_0044618 3300046511 Bacteria 2958
221 Ga0495608_0045873 3300046511 Unclassified 2910
222 Ga0495618_0009053 3300046514 Bacteria 6009
223 Ga0495628_0000788 3300046516 Bacteria 29223
224 Ga0495628_0055109 3300046516 Unclassified 3132
225 Ga0495630_0016027 3300046517 Bacteria 5477
226 Ga0495630_0133888 3300046517 Unclassified 1883
227 Ga0495630_0147891 3300046517 Bacteria 1787
228 Ga0495643_0002279 3300046522 Bacteria 15509
229 Ga0495666_0011653 3300046526 Unclassified 4384
230 Ga0495652_0001768 3300046529 Bacteria 23177
231 Ga0495652_0298324 3300046529 Bacteria 1173
232 Ga0495665_0002054 3300046531 Bacteria 10889
233 Ga0495586_0003979 3300046535 Bacteria 7927
234 Ga0495586_0213308 3300046535 Bacteria 1096
235 Ga0495587_0001525 3300046536 Bacteria 15405
236 Ga0495587_0125138 3300046536 Bacteria 1471
237 Ga0495598_0041611 3300046537 Bacteria 1345
238 Ga0495645_0039225 3300046543 Unclassified 3455
239 Ga0495645_0048453 3300046543 Unclassified 3094
240 Ga0495633_0057774 3300046558 Unclassified 1822
241 Ga0495633_0308221 3300046558 Bacteria 719
242 Ga0495667_0001298 3300046559 Bacteria 16375
243 Ga0495667_0001432 3300046559 Bacteria 15715
244 Ga0495667_0060343 3300046559 Unclassified 2488
245 Ga0495667_0062145 3300046559 Unclassified 2448
246 Ga0495656_0024091 3300046615 Bacteria 2400
247 Ga0495635_0027759 3300046663 Unclassified 3937
248 Ga0495657_0003328 3300046675 Bacteria 13167
249 Ga0495657_0043372 3300046675 Bacteria 3067
250 Ga0495623_0005277 3300046679 Bacteria 8472
251 Ga0495646_0001169 3300046680 Bacteria 15331
252 Ga0495613_0299677 3300046689 Unclassified 1113
253 Ga0495600_0039714 3300046809 Bacteria 3065
254 Ga0495604_0001158 3300047317 Bacteria 21805
255 Ga0495674_0011537 3300047319 Bacteria 8336
256 Ga0495674_0012184 3300047319 Bacteria 8103
257 Ga0495674_0022597 3300047319 Bacteria 5799
258 Ga0495674_0076360 3300047319 Unclassified 2882
259 Ga0495680_0001758 3300047322 Bacteria 22952
260 Ga0495680_0003832 3300047322 Bacteria 14603
261 Ga0495675_0000140 3300047444 Bacteria 50267
262 Ga0495675_0009652 3300047444 Bacteria 6011
263 Ga0495675_0042430 3300047444 Bacteria 2898
264 Ga0495675_0085385 3300047444 Unclassified 1985
265 Ga0495684_0001938 3300047471 Bacteria 16586
266 Ga0495684_0010625 3300047471 Bacteria 7116
267 Ga0495593_0032715 3300047673 Unclassified 2833
268 Ga0495602_0052171 3300048088 Bacteria 3635
269 Ga0495614_0057477 3300048089 Bacteria 1670
270 Ga0496111_0267590 3300048914 Bacteria 1268
271 Ga0501298_046592 3300049521 Bacteria 890
272 Ga0501042_0496949 3300049578 Bacteria 886
273 Ga0501243_024475 3300049675 Bacteria 1009
274 Ga0501249_013712 3300049679 Bacteria 1724
275 nmdc:mga05p37_16745_c1 3300050507 Bacteria 8836
276 nmdc:mga05p37_20939_c1 3300050507 Bacteria 7915
277 nmdc:mga09592_208560_c1 3300050508 Unclassified 1693
278 nmdc:mga09592_5161_c1 3300050508 Bacteria 10610
279 nmdc:mga09592_55988_c1 3300050508 Bacteria 3332
280 nmdc:mga0qj67_1428_c1 3300050509 Bacteria 16719
281 nmdc:mga06r32_1108_c1 3300050510 Bacteria 24156
282 nmdc:mga06r32_202756_c1 3300050510 Bacteria 1971
283 nmdc:mga08y16_105158_c1 3300050511 Bacteria 2939
284 nmdc:mga08y16_13313_c1 3300050511 Bacteria 8651
285 nmdc:mga08y16_388889_c1 3300050511 Bacteria 1429
286 nmdc:mga08y16_407176_c1 3300050511 Bacteria 1391
287 nmdc:mga0n895_236800_c1 3300050512 Bacteria 1852
288 nmdc:mga0n895_2905_c2 3300050512 Bacteria 6989
289 nmdc:mga0n895_48635_c1 3300050512 Bacteria 4152
290 nmdc:mga0rr50_4771_c1 3300050513 Bacteria 8000
291 nmdc:mga0rr50_709099_c1 3300050513 Unclassified 859
292 nmdc:mga0a205_12272_c1 3300050515 Bacteria 7926
293 nmdc:mga0a205_147983_c1 3300050515 Bacteria 2248
294 nmdc:mga0a205_176_c1 3300050515 Bacteria 43310
295 nmdc:mga0a205_92_c1 3300050515 Bacteria 50403
296 Ga0495619_0238102 3300053085 Bacteria 1261
297 Ga0265331_10039594
298 MBSR1b_contig_1383066
299 JGI24749J21850_1006557
300 JGI24751J29686_10033832
301 Ga0065714_10124007
302 Ga0065715_10013073
303 Ga0065715_10153459
304 Ga0065707_10340344
305 Ga0070676_10014081
306 Ga0070676_10019578
307 Ga0070690_100044487
308 Ga0070670_100001593
309 Ga0070670_100051869
310 Ga0070677_10006108
311 Ga0068869_100016277
312 Ga0070666_10010224
313 Ga0070666_10062520
314 Ga0070666_10137924
315 Ga0070682_100041610
316 Ga0068868_100071483
317 Ga0070689_100019175
318 Ga0070689_100055576
319 Ga0070687_100002959
320 Ga0070661_100014169
321 Ga0070661_100121381
322 Ga0070668_100230450
323 Ga0070668_100482282
324 Ga0070669_100154942
325 Ga0070669_100300187
326 Ga0070669_100507371
327 Ga0070671_100150974
328 Ga0070674_100171045
329 Ga0070673_100036973
330 Ga0070673_100137742
331 Ga0070688_100016975
332 Ga0070688_100025056
333 Ga0070659_100086917
334 Ga0070667_100069580
335 Ga0070709_10127815
336 Ga0070709_10220919
337 Ga0070714_100275741
338 Ga0070713_100040974
339 Ga0070713_100076010
340 Ga0070701_10228971
341 Ga0070711_100090676
342 Ga0070700_100390075
343 Ga0070708_100074387
344 Ga0070678_100165602
345 Ga0070678_100392688
346 Ga0070662_100008869
347 Ga0068867_100037565
348 Ga0068867_100079054
349 Ga0070685_10002800
350 Ga0070685_10029632
351 Ga0070707_100430500
352 Ga0070697_100365293
353 Ga0070672_100003162
354 Ga0070686_100031663
355 Ga0070686_100093839
356 Ga0070696_100046237
357 Ga0070664_100013773
358 Ga0070664_100077027
359 Ga0070664_100169567
360 Ga0068852_100309960
361 Ga0068859_100284353
362 Ga0068859_100359221
363 Ga0068864_100281809
364 Ga0068866_10170563
365 Ga0068861_100027279
366 Ga0068870_10067533
367 Ga0068863_100013792
368 Ga0068858_100027848
369 Ga0068862_100178260
370 Ga0081455_10044544
371 Ga0081540_1044950
372 Ga0075432_10027715
373 Ga0097621_100073108
374 Ga0075428_100008864
375 Ga0075428_100015035
376 Ga0075428_100210962
377 Ga0075428_100297101
378 Ga0075430_100002057
379 Ga0075430_100039832
380 Ga0075430_100517140
381 Ga0075431_100006699
382 Ga0075431_100203264
383 Ga0075433_10001059
384 Ga0075433_10024011
385 Ga0075434_100001970
386 Ga0075434_100144899
387 Ga0075429_100002929
388 Ga0075429_100088912
389 Ga0075429_100128537
390 Ga0075429_100244132
391 Ga0068865_100423892
392 Ga0068865_100426211
393 Ga0097620_100284363
394 Ga0097620_100359199
395 Ga0075435_100003014
396 Ga0099794_10061641
397 Ga0099795_10048020
398 Ga0105240_10007927
399 Ga0111539_10001544
400 Ga0111539_10051054
401 Ga0111539_10061119
402 Ga0111539_10114556
403 Ga0105245_10107370
404 Ga0114129_10000618
405 Ga0114129_10101244
406 Ga0114129_10130845
407 Ga0114129_10244111
408 Ga0105243_10356248
409 Ga0105248_10084330
410 Ga0105249_10013504
411 Ga0105249_10397992
412 Ga0099796_10106470
413 Ga0157374_10124953
414 Ga0163163_10029102
415 Ga0163163_10090762
416 Ga0163163_10224336
417 Ga0157380_10034658
418 Ga0157380_10042370
419 Ga0157380_10190727
420 Ga0157377_10026197
421 Ga0157377_10087633
422 Ga0157377_10163598
423 Ga0157379_10010446
424 Ga0163161_10174830
425 Ga0207697_10001182
426 Ga0207682_10000925
427 Ga0207682_10003463
428 Ga0207688_10003828
429 Ga0207680_10027267
430 Ga0207680_10169848
431 Ga0207699_10033946
432 Ga0207699_10196699
433 Ga0207645_10009302
434 Ga0207645_10012481
435 Ga0207643_10005319
436 Ga0207643_10040894
437 Ga0207660_10378584
438 Ga0207662_10001869
439 Ga0207662_10054010
440 Ga0207649_10083713
441 Ga0207649_10170285
442 Ga0207646_10200251
443 Ga0207681_10090282
444 Ga0207681_10099314
445 Ga0207650_10008849
446 Ga0207650_10041568
447 Ga0207659_10051154
448 Ga0207687_10066399
449 Ga0207700_10043540
450 Ga0207644_10124078
451 Ga0207690_10327687
452 Ga0207706_10017509
453 Ga0207706_10019806
454 Ga0207706_10287839
455 Ga0207670_10007865
456 Ga0207670_10134913
457 Ga0207669_10003758
458 Ga0207669_10247315
459 Ga0207704_10026916
460 Ga0207691_10005392
461 Ga0207691_10010414
462 Ga0207711_10274103
463 Ga0207711_10278136
464 Ga0207689_10013969
465 Ga0207679_10026771
466 Ga0207679_10051687
467 Ga0207679_10233199
468 Ga0207651_10026314
469 Ga0207651_10035091
470 Ga0207712_10045388
471 Ga0207668_10244298
472 Ga0207658_10060905
473 Ga0207677_10027694
474 Ga0207708_10152359
475 Ga0207641_10014953
476 Ga0207648_10017342
477 Ga0207648_10165989
478 Ga0207676_10023835
479 Ga0207674_10802682
480 Ga0207675_100003565
481 Ga0207675_100080057
482 Ga0207683_10003458
483 Ga0207683_10133929
484 Ga0207698_10019929
485 Ga0209179_1002431
486 Ga0209588_1021625
487 Ga0209974_10024761
488 Ga0207428_10002190
489 Ga0207428_10135546
490 Ga0265338_10028651
491 Ga0265338_10230520
492 Ga0265760_10030260
493 Ga0265325_10000905
494 Ga0265325_10185245
495 Ga0265316_10026626
496 Ga0265316_10038228
497 Ga0373923_0001877
498 Ga0373955_0171832
499 Ga0373961_0043784
500 Ga0373947_0002233
501 Ga0373937_0087032
502 Ga0439433_0007796
503 Ga0453683_0403426
504 Ga0451576_0333904
505 Ga0495592_0003633
506 Ga0495603_0098460
507 Ga0495651_0000107
508 Ga0495651_0001744
509 Ga0495651_0009643
510 Ga0495653_0004997
511 Ga0495653_0009775
512 Ga0495580_0010119
513 Ga0495664_0018253
514 Ga0495594_0017167
515 Ga0495608_0007221
516 Ga0495608_0044618
517 Ga0495608_0045873
518 Ga0495618_0009053
519 Ga0495628_0000788
520 Ga0495628_0055109
521 Ga0495630_0016027
522 Ga0495630_0133888
523 Ga0495630_0147891
524 Ga0495643_0002279
525 Ga0495666_0011653
526 Ga0495652_0001768
527 Ga0495652_0298324
528 Ga0495665_0002054
529 Ga0495586_0003979
530 Ga0495586_0213308
531 Ga0495587_0001525
532 Ga0495587_0125138
533 Ga0495598_0041611
534 Ga0495645_0039225
535 Ga0495645_0048453
536 Ga0495633_0057774
537 Ga0495633_0308221
538 Ga0495667_0001298
539 Ga0495667_0001432
540 Ga0495667_0060343
541 Ga0495667_0062145
542 Ga0495656_0024091
543 Ga0495635_0027759
544 Ga0495657_0003328
545 Ga0495657_0043372
546 Ga0495623_0005277
547 Ga0495646_0001169
548 Ga0495613_0299677
549 Ga0495600_0039714
550 Ga0495604_0001158
551 Ga0495674_0011537
552 Ga0495674_0012184
553 Ga0495674_0022597
554 Ga0495674_0076360
555 Ga0495680_0001758
556 Ga0495680_0003832
557 Ga0495675_0000140
558 Ga0495675_0009652
559 Ga0495675_0042430
560 Ga0495675_0085385
561 Ga0495684_0001938
562 Ga0495684_0010625
563 Ga0495593_0032715
564 Ga0495602_0052171
565 Ga0495614_0057477
566 Ga0496111_0267590
567 Ga0501298_046592
568 Ga0501042_0496949
569 Ga0501243_024475
570 Ga0501249_013712
571 nmdc:mga05p37_16745_c1
572 nmdc:mga05p37_20939_c1
573 nmdc:mga09592_208560_c1
574 nmdc:mga09592_5161_c1
575 nmdc:mga09592_55988_c1
576 nmdc:mga0qj67_1428_c1
577 nmdc:mga06r32_1108_c1
578 nmdc:mga06r32_202756_c1
579 nmdc:mga08y16_105158_c1
580 nmdc:mga08y16_13313_c1
581 nmdc:mga08y16_388889_c1
582 nmdc:mga08y16_407176_c1
583 nmdc:mga0n895_236800_c1
584 nmdc:mga0n895_2905_c2
585 nmdc:mga0n895_48635_c1
586 nmdc:mga0rr50_4771_c1
587 nmdc:mga0rr50_709099_c1
588 nmdc:mga0a205_12272_c1
589 nmdc:mga0a205_147983_c1
590 nmdc:mga0a205_176_c1
591 nmdc:mga0a205_92_c1
592 Ga0495619_0238102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

152

232

0.84

PF00034

Cytochrom_C

Cytochrome c

64

140

0.83

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

62

136

0.73

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

150

281

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.9258 183 226
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8618 180 226
6gwk-assembly2.cif.gz_G the crystal structure of hfq from caulobacter crescentus 0.8608 182 228
3vu3-assembly1.cif.gz_F crystal structure of the hfq and catalase hpii complex 0.8606 181 229
7og8-assembly1.cif.gz_A wild-type hfq protein from neisseria meningitidis 0.8564 182 231
ID Description Score Start End Superfamily
af_E7FFI1_644_814_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8985 197 217 3.40.1110.10
4x9dF00 Mainly Beta;Roll;SH3 type barrels.; 0.893 179 226 2.30.30.100
af_A4HX97_33_135_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8821 181 208 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.8761 181 227 2.30.30.100
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8627 177 228 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A3D4CYE3-F1-model_v4 Cytochrome c domain-containing protein 0.9548 122 257 GO:0009055
GO:0020037
GO:0046872
AF-A0A357TIY4-F1-model_v4 Cytochrome c domain-containing protein 0.952 122 256 GO:0009055
GO:0020037
GO:0046872
AF-A0A359M4X3-F1-model_v4 Heme-binding protein 0.9502 122 259 GO:0009055
GO:0020037
GO:0046872
AF-A0A353F2Q4-F1-model_v4 Cytochrome c domain-containing protein 0.9459 122 257 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D5JZA4-F1-model_v4 Cytochrome c domain-containing protein 0.9381 122 256 GO:0009055
GO:0020037
GO:0046872

Map