F392998

General Info

Members Datasets Scaffolds Average Seq Length
296 192 592 126

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10014153|Ga0070658_100141534
Length 120
Sequence MKPIGRKRWAIAEGYIPPQSTGTTRQLRSHETACLLNASDQDAHVEITIFYADREPGGPHKITVPARRTHHQRYCDLGVPADTDYSSVIESDVPIVVQHTRLDSRQAELALLSTIAYAED

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.41
Metatranscriptomes 19.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.73
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 27.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10014153 3300005327 Bacteria 6402
2 rootL2_10197678 3300003322 Bacteria 1666
3 Ga0058863_10022310 3300004799 Bacteria 3452
4 Ga0058861_11625088 3300004800 Bacteria 951
5 Ga0058862_10274823 3300004803 Bacteria 3336
6 Ga0070683_100697833 3300005329 Unclassified 972
7 Ga0070683_101846604 3300005329 Bacteria 581
8 Ga0068869_100330620 3300005334 Bacteria 1238
9 Ga0070680_101339896 3300005336 Bacteria 620
10 Ga0070680_101482530 3300005336 Unclassified 588
11 Ga0070687_100719141 3300005343 Bacteria 699
12 Ga0070673_100347133 3300005364 Unclassified 1316
13 Ga0070659_100798289 3300005366 Bacteria 821
14 Ga0070709_10028800 3300005434 Bacteria 3315
15 Ga0070709_10064718 3300005434 Bacteria 2339
16 Ga0070709_10252355 3300005434 Bacteria 1271
17 Ga0070709_10315779 3300005434 Bacteria 1145
18 Ga0070709_11445586 3300005434 Bacteria 557
19 Ga0070714_100000027 3300005435 Bacteria 141750
20 Ga0070714_100032971 3300005435 Bacteria 4327
21 Ga0070714_100171283 3300005435 Bacteria 1970
22 Ga0070714_100198529 3300005435 Bacteria 1834
23 Ga0070714_100344914 3300005435 Bacteria 1397
24 Ga0070714_100546823 3300005435 Unclassified 1108
25 Ga0070714_100829663 3300005435 Bacteria 896
26 Ga0070713_100009620 3300005436 Bacteria 6937
27 Ga0070713_100027378 3300005436 Bacteria 4487
28 Ga0070713_100163483 3300005436 Bacteria 1989
29 Ga0070713_100191641 3300005436 Bacteria 1842
30 Ga0070713_100202993 3300005436 Unclassified 1791
31 Ga0070713_100302862 3300005436 Bacteria 1472
32 Ga0070713_100461379 3300005436 Unclassified 1194
33 Ga0070713_100533417 3300005436 Bacteria 1110
34 Ga0070713_100929657 3300005436 Bacteria 837
35 Ga0070713_101816219 3300005436 Unclassified 592
36 Ga0070710_10123025 3300005437 Unclassified 1572
37 Ga0070681_10103940 3300005458 Bacteria 2783
38 Ga0070681_10266637 3300005458 Bacteria 1624
39 Ga0070681_10487758 3300005458 Unclassified 1145
40 Ga0070681_10869769 3300005458 Bacteria 819
41 Ga0070679_100572048 3300005530 Bacteria 1073
42 Ga0070679_101075810 3300005530 Bacteria 749
43 Ga0070679_101374747 3300005530 Bacteria 652
44 Ga0070679_101786802 3300005530 Bacteria 563
45 Ga0070697_100237958 3300005536 Bacteria 1554
46 Ga0068853_100000674 3300005539 Bacteria 23526
47 Ga0068853_100663267 3300005539 Bacteria 993
48 Ga0070693_101086590 3300005547 Bacteria 609
49 Ga0068855_100343600 3300005563 Bacteria 1645
50 Ga0068854_100076119 3300005578 Bacteria 2465
51 Ga0068856_100015706 3300005614 Bacteria 7320
52 Ga0068852_100224637 3300005616 Bacteria 1787
53 Ga0068852_102421740 3300005616 Bacteria 545
54 Ga0068852_102613041 3300005616 Unclassified 524
55 Ga0081540_1001068 3300005983 Bacteria 24364
56 Ga0070717_10075170 3300006028 Bacteria 2825
57 Ga0070717_10740428 3300006028 Bacteria 894
58 Ga0070717_10782408 3300006028 Unclassified 868
59 Ga0070717_11783835 3300006028 Bacteria 556
60 Ga0070717_12043506 3300006028 Bacteria 516
61 Ga0070715_10233599 3300006163 Unclassified 952
62 Ga0070716_100017128 3300006173 Bacteria 3752
63 Ga0070712_100004652 3300006175 Bacteria 8486
64 Ga0075436_100389624 3300006914 Unclassified 1008
65 Ga0075435_100194855 3300007076 Bacteria 1716
66 Ga0105240_10000442 3300009093 Bacteria 76687
67 Ga0105240_10077847 3300009093 Bacteria 4085
68 Ga0105245_12366642 3300009098 Bacteria 585
69 Ga0105237_10225269 3300009545 Bacteria 1875
70 Ga0105238_10636957 3300009551 Bacteria 1075
71 Ga0105239_10998236 3300010375 Bacteria 962
72 Ga0154010_192220 3300013062 Unclassified 738
73 Ga0157373_10037914 3300013100 Bacteria 3453
74 Ga0157371_10980980 3300013102 Unclassified 644
75 Ga0157370_10210712 3300013104 Bacteria 1801
76 Ga0157369_10022906 3300013105 Bacteria 6964
77 Ga0157369_10320133 3300013105 Bacteria 1612
78 Ga0157369_10844119 3300013105 Bacteria 940
79 Ga0157372_10257198 3300013307 Unclassified 2027
80 Ga0157372_10273831 3300013307 Bacteria 1962
81 Ga0157372_10316380 3300013307 Bacteria 1817
82 Ga0157372_10890548 3300013307 Bacteria 1033
83 Ga0157372_10930104 3300013307 Bacteria 1008
84 Ga0157372_11668777 3300013307 Bacteria 733
85 Ga0157375_10073156 3300013308 Unclassified 3446
86 Ga0197907_10615248 3300020069 Bacteria 940
87 Ga0197907_11304725 3300020069 Bacteria 1052
88 Ga0206356_10489422 3300020070 Unclassified 765
89 Ga0206356_11002249 3300020070 Bacteria 1380
90 Ga0206349_1605838 3300020075 Unclassified 787
91 Ga0206349_1787974 3300020075 Bacteria 4311
92 Ga0206355_1463233 3300020076 Bacteria 1300
93 Ga0206355_1580084 3300020076 Bacteria 739
94 Ga0206351_10089479 3300020077 Unclassified 1015
95 Ga0206351_10570292 3300020077 Bacteria 1812
96 Ga0206352_10631625 3300020078 Unclassified 1100
97 Ga0206350_10585403 3300020080 Bacteria 700
98 Ga0206350_10762047 3300020080 Bacteria 724
99 Ga0206354_10954675 3300020081 Unclassified 743
100 Ga0206354_11359548 3300020081 Bacteria 874
101 Ga0206353_10988767 3300020082 Bacteria 1805
102 Ga0206353_11393440 3300020082 Bacteria 1246
103 Ga0154015_1046934 3300020610 Bacteria 1861
104 Ga0224712_10017840 3300022467 Bacteria 2361
105 Ga0224712_10127188 3300022467 Bacteria 1109
106 Ga0224712_10425403 3300022467 Unclassified 635
107 Ga0207692_10009549 3300025898 Bacteria 4057
108 Ga0207685_10008076 3300025905 Bacteria 2975
109 Ga0207699_10190308 3300025906 Bacteria 1384
110 Ga0207699_10200924 3300025906 Bacteria 1350
111 Ga0207699_10350606 3300025906 Bacteria 1042
112 Ga0207699_10616121 3300025906 Bacteria 791
113 Ga0207705_10014442 3300025909 Bacteria 5684
114 Ga0207707_10140121 3300025912 Bacteria 2115
115 Ga0207707_10174257 3300025912 Bacteria 1879
116 Ga0207695_10061335 3300025913 Bacteria 3886
117 Ga0207695_10525349 3300025913 Bacteria 1065
118 Ga0207671_10621484 3300025914 Bacteria 861
119 Ga0207693_10033715 3300025915 Bacteria 4040
120 Ga0207663_10017291 3300025916 Bacteria 4014
121 Ga0207662_10502239 3300025918 Bacteria 835
122 Ga0207657_10879262 3300025919 Unclassified 691
123 Ga0207652_10545585 3300025921 Unclassified 1042
124 Ga0207652_11402879 3300025921 Bacteria 602
125 Ga0207687_10212157 3300025927 Bacteria 1520
126 Ga0207700_10001681 3300025928 Bacteria 12560
127 Ga0207700_10065230 3300025928 Unclassified 2777
128 Ga0207700_10265450 3300025928 Bacteria 1471
129 Ga0207700_10575231 3300025928 Bacteria 1001
130 Ga0207700_10766200 3300025928 Bacteria 863
131 Ga0207700_11049466 3300025928 Bacteria 729
132 Ga0207664_10000098 3300025929 Bacteria 80444
133 Ga0207664_10029637 3300025929 Bacteria 4170
134 Ga0207664_10238708 3300025929 Bacteria 1582
135 Ga0207664_10422720 3300025929 Bacteria 1187
136 Ga0207690_11554795 3300025932 Bacteria 553
137 Ga0207665_10046422 3300025939 Bacteria 2910
138 Ga0207689_10779624 3300025942 Unclassified 807
139 Ga0207661_11253438 3300025944 Bacteria 682
140 Ga0207667_10474855 3300025949 Bacteria 1270
141 Ga0207651_10305680 3300025960 Unclassified 1324
142 Ga0207640_10259031 3300025981 Bacteria 1354
143 Ga0207639_10026176 3300026041 Bacteria 4238
144 Ga0207639_10380392 3300026041 Bacteria 1267
145 Ga0207702_10015575 3300026078 Bacteria 6294
146 Ga0207702_11063673 3300026078 Unclassified 803
147 Ga0207698_10303913 3300026142 Bacteria 1486
148 Ga0207698_11395616 3300026142 Bacteria 715
149 Ga0268265_11971369 3300028380 Bacteria 591
150 Ga0265770_1044697 3300030878 Bacteria 785
151 Ga0265320_10149810 3300031240 Bacteria 1054
152 Ga0265342_10304770 3300031712 Bacteria 838
153 Ga0307407_10482111 3300031903 Bacteria 906
154 Ga0307416_101516125 3300032002 Bacteria 776
155 Ga0307414_10069256 3300032004 Bacteria 2536
156 Ga0373926_0038260 3300035083 Bacteria 1708
157 Ga0373923_0031220 3300035111 Bacteria 2146
158 Ga0373923_0466077 3300035111 Unclassified 614
159 Ga0373936_0089391 3300035113 Bacteria 1290
160 Ga0373945_0001215 3300035116 Bacteria 7848
161 Ga0373945_0138974 3300035116 Bacteria 978
162 Ga0373953_0006123 3300035117 Bacteria 3947
163 Ga0373954_0015094 3300035118 Bacteria 3451
164 Ga0373956_0201968 3300035119 Bacteria 942
165 Ga0373943_0000669 3300035170 Bacteria 14898
166 Ga0373946_0006588 3300035171 Bacteria 4215
167 Ga0373955_0522374 3300035172 Unclassified 725
168 Ga0373924_0004419 3300035410 Unclassified 4909
169 Ga0373924_0041656 3300035410 Bacteria 1882
170 Ga0373935_0001776 3300035692 Bacteria 12128
171 Ga0373927_0003864 3300035695 Bacteria 10621
172 Ga0373933_0003016 3300035724 Bacteria 9394
173 Ga0373933_0153590 3300035724 Unclassified 1459
174 Ga0373933_0566266 3300035724 Bacteria 746
175 Ga0373947_0018472 3300035725 Bacteria 4013
176 Ga0373947_0350824 3300035725 Bacteria 990
177 Ga0373937_0005357 3300036401 Bacteria 10972
178 Ga0373937_0216010 3300036401 Bacteria 1805
179 Ga0373925_0002387 3300037068 Bacteria 15061
180 Ga0373925_0037966 3300037068 Bacteria 3558
181 Ga0395899_0064614 3300037312 Bacteria 2690
182 Ga0395900_0181799 3300037418 Bacteria 2136
183 Ga0395898_0066531 3300037466 Bacteria 3491
184 Ga0395898_1414775 3300037466 Bacteria 623
185 Ga0395901_0082615 3300038443 Bacteria 3356
186 Ga0395901_0159520 3300038443 Bacteria 2369
187 Ga0436361_0069878 3300039447 Bacteria 929
188 Ga0436363_0309168 3300039450 Bacteria 2549
189 Ga0436362_0838267 3300039453 Bacteria 679
190 Ga0451807_1441021 3300041486 Bacteria 662
191 Ga0466966_0768420 3300044684 Bacteria 581
192 Ga0466966_0964977 3300044684 Bacteria 514
193 Ga0466963_0000107 3300044694 Bacteria 30205
194 Ga0466964_0118388 3300044706 Unclassified 1191
195 Ga0466957_0000297 3300044842 Bacteria 24249
196 Ga0466957_0811118 3300044842 Unclassified 665
197 Ga0466957_0934855 3300044842 Unclassified 621
198 Ga0466958_0406029 3300045836 Bacteria 880
199 Ga0466958_0703452 3300045836 Unclassified 658
200 Ga0466967_0003138 3300045976 Bacteria 10639
201 Ga0466967_0199570 3300045976 Bacteria 1894
202 Ga0466967_0660898 3300045976 Bacteria 1034
203 Ga0466967_0818192 3300045976 Unclassified 925
204 Ga0495603_0269382 3300046455 Bacteria 980
205 Ga0495590_0118468 3300046457 Bacteria 948
206 Ga0495629_0208036 3300046459 Bacteria 1352
207 Ga0495641_0010237 3300046461 Bacteria 5458
208 Ga0495651_0231005 3300046462 Bacteria 1274
209 Ga0495653_0093107 3300046463 Bacteria 2199
210 Ga0495580_0000164 3300046472 Bacteria 49081
211 Ga0495582_0007961 3300046473 Bacteria 5856
212 Ga0495664_0446833 3300046477 Unclassified 774
213 Ga0495630_0006322 3300046517 Bacteria 8415
214 Ga0495630_0343954 3300046517 Unclassified 1141
215 Ga0495665_0057056 3300046531 Bacteria 2061
216 Ga0495665_0283478 3300046531 Unclassified 850
217 Ga0495635_0090342 3300046663 Bacteria 2095
218 Ga0495623_0339098 3300046679 Unclassified 821
219 Ga0495613_0418620 3300046689 Unclassified 912
220 Ga0495624_0064287 3300046690 Bacteria 2293
221 Ga0495624_0211732 3300046690 Unclassified 1176
222 Ga0495600_0790376 3300046809 Unclassified 566
223 Ga0495674_0011759 3300047319 Bacteria 8255
224 Ga0495674_0147678 3300047319 Unclassified 1973
225 Ga0495674_0928920 3300047319 Unclassified 670
226 Ga0495684_0096607 3300047471 Unclassified 2236
227 Ga0495684_0432519 3300047471 Unclassified 918
228 Ga0495593_0570738 3300047673 Unclassified 568
229 Ga0495602_0423921 3300048088 Bacteria 944
230 Ga0495602_0535528 3300048088 Unclassified 814
231 Ga0496101_0163774 3300048904 Bacteria 1707
232 Ga0496104_0918709 3300048907 Bacteria 780
233 Ga0496105_0008590 3300048908 Bacteria 7936
234 Ga0496106_0557728 3300048909 Bacteria 919
235 Ga0496108_0371950 3300048911 Bacteria 1248
236 Ga0496109_0267579 3300048912 Bacteria 1610
237 Ga0496109_0394193 3300048912 Bacteria 1308
238 Ga0496109_0980459 3300048912 Bacteria 783
239 Ga0496111_0483546 3300048914 Bacteria 912
240 Ga0496112_0237381 3300048915 Bacteria 1777
241 Ga0496112_1428556 3300048915 Bacteria 606
242 Ga0496114_0211070 3300048917 Bacteria 1703
243 Ga0496115_0991301 3300048918 Bacteria 643
244 Ga0501031_0000168 3300049568 Bacteria 37163
245 Ga0501032_0034092 3300049569 Bacteria 3486
246 Ga0501033_0197493 3300049570 Bacteria 1438
247 Ga0501036_0859367 3300049572 Unclassified 746
248 Ga0501036_0930369 3300049572 Unclassified 713
249 Ga0501037_0003095 3300049573 Bacteria 12059
250 Ga0501039_0000371 3300049575 Bacteria 32180
251 Ga0501040_0019977 3300049576 Bacteria 4460
252 Ga0501041_0146473 3300049577 Unclassified 1473
253 Ga0501042_0135697 3300049578 Unclassified 1774
254 Ga0501043_0773836 3300049579 Bacteria 696
255 Ga0501043_1269053 3300049579 Unclassified 515
256 Ga0501046_0005948 3300049580 Bacteria 10863
257 Ga0501047_0113350 3300049581 Bacteria 2594
258 Ga0501079_0255762 3300049741 Unclassified 1369
259 Ga0501080_0094759 3300049742 Bacteria 2772
260 Ga0501083_0173528 3300049744 Bacteria 1409
261 Ga0501035_0063386 3300049822 Bacteria 3288
262 nmdc:mga0rr50_921262_c1 3300050513 Bacteria 745
263 Ga0495612_0268425 3300053078 Unclassified 761
264 Ga0495619_0523368 3300053085 Unclassified 815
265 Ga0587066_032173 3300059490 Bacteria 942
266 Ga0587073_0001338 3300059492 Bacteria 2826
267 Ga0587073_0162236 3300059492 Bacteria 642
268 Ga0587077_002553 3300059493 Bacteria 2177
269 Ga0587080_002265 3300059503 Unclassified 2241
270 Ga0587082_004518 3300059504 Unclassified 1751
271 Ga0587083_0002912 3300059505 Unclassified 2199
272 Ga0587083_0190692 3300059505 Bacteria 579
273 Ga0587088_001993 3300059508 Bacteria 2238
274 Ga0587088_005121 3300059508 Unclassified 1706
275 Ga0587089_004065 3300059509 Unclassified 1598
276 Ga0587091_027564 3300059511 Bacteria 1043
277 Ga0587091_163972 3300059511 Bacteria 573
278 Ga0587094_012827 3300059513 Unclassified 1124
279 Ga0587098_006955 3300059604 Unclassified 1164
280 Ga0587106_008529 3300059605 Unclassified 1278
281 Ga0587131_009640 3300059609 Unclassified 677
282 Ga0587109_163604 3300059624 Unclassified 558
283 Ga0587115_009919 3300059626 Unclassified 1177
284 Ga0587128_004794 3300059630 Unclassified 1590
285 Ga0587128_105888 3300059630 Unclassified 595
286 Ga0587067_016054 3300059640 Unclassified 1224
287 Ga0587069_025802 3300059642 Unclassified 916
288 Ga0587075_000369 3300059644 Bacteria 3413
289 Ga0587075_101525 3300059644 Unclassified 575
290 Ga0587076_001993 3300059645 Bacteria 2210
291 Ga0587078_013463 3300059646 Unclassified 969
292 Ga0587079_006694 3300059647 Unclassified 1692
293 Ga0587107_005406 3300059652 Unclassified 1350
294 Ga0587114_001651 3300059655 Unclassified 1924
295 Ga0587119_039607 3300059658 Unclassified 672
296 Ga0587071_002414 3300060344 Bacteria 2528
297 Ga0070658_10014153
298 rootL2_10197678
299 Ga0058863_10022310
300 Ga0058861_11625088
301 Ga0058862_10274823
302 Ga0070683_100697833
303 Ga0070683_101846604
304 Ga0068869_100330620
305 Ga0070680_101339896
306 Ga0070680_101482530
307 Ga0070687_100719141
308 Ga0070673_100347133
309 Ga0070659_100798289
310 Ga0070709_10028800
311 Ga0070709_10064718
312 Ga0070709_10252355
313 Ga0070709_10315779
314 Ga0070709_11445586
315 Ga0070714_100000027
316 Ga0070714_100032971
317 Ga0070714_100171283
318 Ga0070714_100198529
319 Ga0070714_100344914
320 Ga0070714_100546823
321 Ga0070714_100829663
322 Ga0070713_100009620
323 Ga0070713_100027378
324 Ga0070713_100163483
325 Ga0070713_100191641
326 Ga0070713_100202993
327 Ga0070713_100302862
328 Ga0070713_100461379
329 Ga0070713_100533417
330 Ga0070713_100929657
331 Ga0070713_101816219
332 Ga0070710_10123025
333 Ga0070681_10103940
334 Ga0070681_10266637
335 Ga0070681_10487758
336 Ga0070681_10869769
337 Ga0070679_100572048
338 Ga0070679_101075810
339 Ga0070679_101374747
340 Ga0070679_101786802
341 Ga0070697_100237958
342 Ga0068853_100000674
343 Ga0068853_100663267
344 Ga0070693_101086590
345 Ga0068855_100343600
346 Ga0068854_100076119
347 Ga0068856_100015706
348 Ga0068852_100224637
349 Ga0068852_102421740
350 Ga0068852_102613041
351 Ga0081540_1001068
352 Ga0070717_10075170
353 Ga0070717_10740428
354 Ga0070717_10782408
355 Ga0070717_11783835
356 Ga0070717_12043506
357 Ga0070715_10233599
358 Ga0070716_100017128
359 Ga0070712_100004652
360 Ga0075436_100389624
361 Ga0075435_100194855
362 Ga0105240_10000442
363 Ga0105240_10077847
364 Ga0105245_12366642
365 Ga0105237_10225269
366 Ga0105238_10636957
367 Ga0105239_10998236
368 Ga0154010_192220
369 Ga0157373_10037914
370 Ga0157371_10980980
371 Ga0157370_10210712
372 Ga0157369_10022906
373 Ga0157369_10320133
374 Ga0157369_10844119
375 Ga0157372_10257198
376 Ga0157372_10273831
377 Ga0157372_10316380
378 Ga0157372_10890548
379 Ga0157372_10930104
380 Ga0157372_11668777
381 Ga0157375_10073156
382 Ga0197907_10615248
383 Ga0197907_11304725
384 Ga0206356_10489422
385 Ga0206356_11002249
386 Ga0206349_1605838
387 Ga0206349_1787974
388 Ga0206355_1463233
389 Ga0206355_1580084
390 Ga0206351_10089479
391 Ga0206351_10570292
392 Ga0206352_10631625
393 Ga0206350_10585403
394 Ga0206350_10762047
395 Ga0206354_10954675
396 Ga0206354_11359548
397 Ga0206353_10988767
398 Ga0206353_11393440
399 Ga0154015_1046934
400 Ga0224712_10017840
401 Ga0224712_10127188
402 Ga0224712_10425403
403 Ga0207692_10009549
404 Ga0207685_10008076
405 Ga0207699_10190308
406 Ga0207699_10200924
407 Ga0207699_10350606
408 Ga0207699_10616121
409 Ga0207705_10014442
410 Ga0207707_10140121
411 Ga0207707_10174257
412 Ga0207695_10061335
413 Ga0207695_10525349
414 Ga0207671_10621484
415 Ga0207693_10033715
416 Ga0207663_10017291
417 Ga0207662_10502239
418 Ga0207657_10879262
419 Ga0207652_10545585
420 Ga0207652_11402879
421 Ga0207687_10212157
422 Ga0207700_10001681
423 Ga0207700_10065230
424 Ga0207700_10265450
425 Ga0207700_10575231
426 Ga0207700_10766200
427 Ga0207700_11049466
428 Ga0207664_10000098
429 Ga0207664_10029637
430 Ga0207664_10238708
431 Ga0207664_10422720
432 Ga0207690_11554795
433 Ga0207665_10046422
434 Ga0207689_10779624
435 Ga0207661_11253438
436 Ga0207667_10474855
437 Ga0207651_10305680
438 Ga0207640_10259031
439 Ga0207639_10026176
440 Ga0207639_10380392
441 Ga0207702_10015575
442 Ga0207702_11063673
443 Ga0207698_10303913
444 Ga0207698_11395616
445 Ga0268265_11971369
446 Ga0265770_1044697
447 Ga0265320_10149810
448 Ga0265342_10304770
449 Ga0307407_10482111
450 Ga0307416_101516125
451 Ga0307414_10069256
452 Ga0373926_0038260
453 Ga0373923_0031220
454 Ga0373923_0466077
455 Ga0373936_0089391
456 Ga0373945_0001215
457 Ga0373945_0138974
458 Ga0373953_0006123
459 Ga0373954_0015094
460 Ga0373956_0201968
461 Ga0373943_0000669
462 Ga0373946_0006588
463 Ga0373955_0522374
464 Ga0373924_0004419
465 Ga0373924_0041656
466 Ga0373935_0001776
467 Ga0373927_0003864
468 Ga0373933_0003016
469 Ga0373933_0153590
470 Ga0373933_0566266
471 Ga0373947_0018472
472 Ga0373947_0350824
473 Ga0373937_0005357
474 Ga0373937_0216010
475 Ga0373925_0002387
476 Ga0373925_0037966
477 Ga0395899_0064614
478 Ga0395900_0181799
479 Ga0395898_0066531
480 Ga0395898_1414775
481 Ga0395901_0082615
482 Ga0395901_0159520
483 Ga0436361_0069878
484 Ga0436363_0309168
485 Ga0436362_0838267
486 Ga0451807_1441021
487 Ga0466966_0768420
488 Ga0466966_0964977
489 Ga0466963_0000107
490 Ga0466964_0118388
491 Ga0466957_0000297
492 Ga0466957_0811118
493 Ga0466957_0934855
494 Ga0466958_0406029
495 Ga0466958_0703452
496 Ga0466967_0003138
497 Ga0466967_0199570
498 Ga0466967_0660898
499 Ga0466967_0818192
500 Ga0495603_0269382
501 Ga0495590_0118468
502 Ga0495629_0208036
503 Ga0495641_0010237
504 Ga0495651_0231005
505 Ga0495653_0093107
506 Ga0495580_0000164
507 Ga0495582_0007961
508 Ga0495664_0446833
509 Ga0495630_0006322
510 Ga0495630_0343954
511 Ga0495665_0057056
512 Ga0495665_0283478
513 Ga0495635_0090342
514 Ga0495623_0339098
515 Ga0495613_0418620
516 Ga0495624_0064287
517 Ga0495624_0211732
518 Ga0495600_0790376
519 Ga0495674_0011759
520 Ga0495674_0147678
521 Ga0495674_0928920
522 Ga0495684_0096607
523 Ga0495684_0432519
524 Ga0495593_0570738
525 Ga0495602_0423921
526 Ga0495602_0535528
527 Ga0496101_0163774
528 Ga0496104_0918709
529 Ga0496105_0008590
530 Ga0496106_0557728
531 Ga0496108_0371950
532 Ga0496109_0267579
533 Ga0496109_0394193
534 Ga0496109_0980459
535 Ga0496111_0483546
536 Ga0496112_0237381
537 Ga0496112_1428556
538 Ga0496114_0211070
539 Ga0496115_0991301
540 Ga0501031_0000168
541 Ga0501032_0034092
542 Ga0501033_0197493
543 Ga0501036_0859367
544 Ga0501036_0930369
545 Ga0501037_0003095
546 Ga0501039_0000371
547 Ga0501040_0019977
548 Ga0501041_0146473
549 Ga0501042_0135697
550 Ga0501043_0773836
551 Ga0501043_1269053
552 Ga0501046_0005948
553 Ga0501047_0113350
554 Ga0501079_0255762
555 Ga0501080_0094759
556 Ga0501083_0173528
557 Ga0501035_0063386
558 nmdc:mga0rr50_921262_c1
559 Ga0495612_0268425
560 Ga0495619_0523368
561 Ga0587066_032173
562 Ga0587073_0001338
563 Ga0587073_0162236
564 Ga0587077_002553
565 Ga0587080_002265
566 Ga0587082_004518
567 Ga0587083_0002912
568 Ga0587083_0190692
569 Ga0587088_001993
570 Ga0587088_005121
571 Ga0587089_004065
572 Ga0587091_027564
573 Ga0587091_163972
574 Ga0587094_012827
575 Ga0587098_006955
576 Ga0587106_008529
577 Ga0587131_009640
578 Ga0587109_163604
579 Ga0587115_009919
580 Ga0587128_004794
581 Ga0587128_105888
582 Ga0587067_016054
583 Ga0587069_025802
584 Ga0587075_000369
585 Ga0587075_101525
586 Ga0587076_001993
587 Ga0587078_013463
588 Ga0587079_006694
589 Ga0587107_005406
590 Ga0587114_001651
591 Ga0587119_039607
592 Ga0587071_002414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07100

ASRT

Anabaena sensory rhodopsin transducer

4

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ii8-assembly2.cif.gz_E anabaena sensory rhodopsin transducer 0.9905 2 102
2ii8-assembly2.cif.gz_C anabaena sensory rhodopsin transducer 0.9871 2 102
2ii9-assembly1.cif.gz_C anabaena sensory rhodopsin transducer 0.976 2 102
2ii9-assembly1.cif.gz_D anabaena sensory rhodopsin transducer 0.9651 2 102
2ii8-assembly2.cif.gz_E anabaena sensory rhodopsin transducer 0.9482 2 102
ID Description Score Start End Superfamily
2ii8A00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.9412 2 102 2.60.290.11
1nc7C00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.9201 3 121 2.60.290.11
2ii8A00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.903 2 102 2.60.290.11
2ii7C00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.9012 2 110 2.60.290.11
1nc7C00 Mainly Beta;Sandwich;Hypothetical Protein Tm1070; Chain: A;TM1070-like 0.8808 3 121 2.60.290.11
ID Description Score Start End GO Terms
AF-A0A238USE5-F1-model_v4 Sensory rhodopsin transducer 0.984 3 121
AF-A0A7V8ZQC8-F1-model_v4 Sensory rhodopsin transducer 0.9833 34 121
AF-A0A3D8L020-F1-model_v4 Sensory rhodopsin transducer 0.9766 3 121
AF-A0A838SLP3-F1-model_v4 Sensory rhodopsin transducer 0.9747 3 100
AF-A0A7H8K5S8-F1-model_v4 Sensory rhodopsin transducer 0.9746 2 121

Map