F392857

General Info

Members Datasets Scaffolds Average Seq Length
295 201 586 262

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000100|Ga0496121_0000100_100796_101716
Length 295
Sequence VPEHAAIAHRDGGMTKHCFSNACIRRIIVRHLRHSMQRETAMNTPTQITVNPVTGARIRVFWQPGCSSCLRTKEFLTKHGIAFESIDVHNDPAGRDALYELGVRSVPVVAIGKRYTFCQSINDVIRFLDLKTDPNPPLPPAELVRKLAHVLEANARYTRQFGDEYFRVPFRNRNRTPAGLTFHVFRVAEMGIEATQQIDLLFESFDDQPPADWTREDIARWGDSVPDRSLSYDVPTYYGRRSMHEVMERTAWHAAQHTRQVALMLEREDVKAERPLTREDLAGLPVPDEVWDDNK

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
201 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 3.39
Rhizosphere 92.54
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0000100 3300048924 Bacteria 198641
2 Ga0065707_10288534 3300005295 Bacteria 1030
3 Ga0065707_10292579 3300005295 Bacteria 1022
4 Ga0070676_10018372 3300005328 Bacteria 3875
5 Ga0070670_100006092 3300005331 Bacteria 10197
6 Ga0070670_100129216 3300005331 Bacteria 2181
7 Ga0070677_10082120 3300005333 Bacteria 1381
8 Ga0068869_100000658 3300005334 Bacteria 19543
9 Ga0068868_100214876 3300005338 Unclassified 1608
10 Ga0070692_10224793 3300005345 Bacteria 1111
11 Ga0070668_100002124 3300005347 Bacteria 14493
12 Ga0070669_100008375 3300005353 Bacteria 7377
13 Ga0070671_100188295 3300005355 Bacteria 1749
14 Ga0070673_100006374 3300005364 Bacteria 7667
15 Ga0070667_100002060 3300005367 Bacteria 17795
16 Ga0070700_100379882 3300005441 Unclassified 1056
17 Ga0070694_100009745 3300005444 Bacteria 5899
18 Ga0070663_100326698 3300005455 Unclassified 1235
19 Ga0070678_100461667 3300005456 Bacteria 1114
20 Ga0070681_10158821 3300005458 Bacteria 2185
21 Ga0068867_100052447 3300005459 Bacteria 3010
22 Ga0068867_100131264 3300005459 Bacteria 1947
23 Ga0070698_100124818 3300005471 Bacteria 2531
24 Ga0070672_100052266 3300005543 Bacteria 3190
25 Ga0070695_100164915 3300005545 Bacteria 1558
26 Ga0070696_100092072 3300005546 Bacteria 2160
27 Ga0070693_100049057 3300005547 Bacteria 2406
28 Ga0070704_100042563 3300005549 Bacteria 3143
29 Ga0070664_100099953 3300005564 Bacteria 2521
30 Ga0068857_100000776 3300005577 Bacteria 23790
31 Ga0068852_100292573 3300005616 Bacteria 1574
32 Ga0068859_100004491 3300005617 Bacteria 14231
33 Ga0068864_100000531 3300005618 Bacteria 32744
34 Ga0068864_100035161 3300005618 Bacteria 4265
35 Ga0068864_100307769 3300005618 Bacteria 1485
36 Ga0068861_100001360 3300005719 Bacteria 15379
37 Ga0068870_10008402 3300005840 Bacteria 4643
38 Ga0068863_100001999 3300005841 Bacteria 20229
39 Ga0068863_100003851 3300005841 Bacteria 14840
40 Ga0068863_100176782 3300005841 Unclassified 2049
41 Ga0068858_100002689 3300005842 Bacteria 17899
42 Ga0068858_100373909 3300005842 Unclassified 1367
43 Ga0068860_100008563 3300005843 Bacteria 10195
44 Ga0068860_100086131 3300005843 Bacteria 2990
45 Ga0068862_100003479 3300005844 Bacteria 13533
46 Ga0070716_100031445 3300006173 Unclassified 2886
47 Ga0068865_100164098 3300006881 Bacteria 1697
48 Ga0075436_100091932 3300006914 Bacteria 2109
49 Ga0075436_100444987 3300006914 Unclassified 943
50 Ga0097620_100004491 3300006931 Bacteria 14231
51 Ga0075435_100171806 3300007076 Bacteria 1829
52 Ga0099795_10035760 3300007788 Bacteria 1738
53 Ga0105251_10219340 3300009011 Bacteria 856
54 Ga0105240_10246143 3300009093 Bacteria 2070
55 Ga0111539_10396520 3300009094 Bacteria 1607
56 Ga0105245_10295165 3300009098 Bacteria 1589
57 Ga0105247_10009983 3300009101 Bacteria 5749
58 Ga0105242_10019501 3300009176 Bacteria 5315
59 Ga0105242_10022191 3300009176 Bacteria 4989
60 Ga0105248_10008061 3300009177 Bacteria 11564
61 Ga0105248_10053303 3300009177 Bacteria 4539
62 Ga0105237_10246313 3300009545 Bacteria 1789
63 Ga0105237_10258968 3300009545 Bacteria 1742
64 Ga0105249_10081324 3300009553 Unclassified 3011
65 Ga0099796_10009522 3300010159 Bacteria 2633
66 Ga0105239_10330051 3300010375 Bacteria 1721
67 Ga0163162_10098202 3300013306 Bacteria 3018
68 Ga0163162_10190793 3300013306 Bacteria 2177
69 Ga0163162_10366177 3300013306 Bacteria 1574
70 Ga0157372_10110986 3300013307 Bacteria 3141
71 Ga0157375_10003143 3300013308 Bacteria 14338
72 Ga0163163_10003121 3300014325 Bacteria 14040
73 Ga0157380_10139697 3300014326 Bacteria 2079
74 Ga0157379_10005572 3300014968 Bacteria 10822
75 Ga0157379_10193910 3300014968 Unclassified 1836
76 Ga0183361_10007 3300016635 Bacteria 339575
77 Ga0163161_10096799 3300017792 Bacteria 2191
78 Ga0209759_1012709 3300025256 Bacteria 2317
79 Ga0209025_1002880 3300025294 Bacteria 17253
80 Ga0207682_10120847 3300025893 Bacteria 1162
81 Ga0207710_10008572 3300025900 Bacteria 4310
82 Ga0207699_10130850 3300025906 Bacteria 1637
83 Ga0207645_10011596 3300025907 Bacteria 6011
84 Ga0207643_10020562 3300025908 Bacteria 3623
85 Ga0207654_10199150 3300025911 Unclassified 1317
86 Ga0207671_10363670 3300025914 Unclassified 1148
87 Ga0207681_10012319 3300025923 Bacteria 5275
88 Ga0207694_10324708 3300025924 Bacteria 1271
89 Ga0207650_10004314 3300025925 Bacteria 9708
90 Ga0207644_10214270 3300025931 Bacteria 1524
91 Ga0207704_10070821 3300025938 Unclassified 2210
92 Ga0207665_10002588 3300025939 Bacteria 12160
93 Ga0207691_10015468 3300025940 Bacteria 7254
94 Ga0207691_10078689 3300025940 Bacteria 2968
95 Ga0207711_10014602 3300025941 Bacteria 6527
96 Ga0207711_10018465 3300025941 Bacteria 5797
97 Ga0207689_10000065 3300025942 Bacteria 84074
98 Ga0207679_10116449 3300025945 Unclassified 2119
99 Ga0207667_10126658 3300025949 Bacteria 2630
100 Ga0207651_10078057 3300025960 Bacteria 2373
101 Ga0207712_10146821 3300025961 Unclassified 1817
102 Ga0207668_10006065 3300025972 Bacteria 7127
103 Ga0207658_10014673 3300025986 Bacteria 5367
104 Ga0207703_10000794 3300026035 Bacteria 31109
105 Ga0207703_10111218 3300026035 Bacteria 2338
106 Ga0207708_10443684 3300026075 Unclassified 1080
107 Ga0207641_10005734 3300026088 Bacteria 10548
108 Ga0207641_10074386 3300026088 Unclassified 2930
109 Ga0207641_10276801 3300026088 Unclassified 1577
110 Ga0207648_10058277 3300026089 Bacteria 3368
111 Ga0207676_10001071 3300026095 Bacteria 20802
112 Ga0207676_10029324 3300026095 Bacteria 4118
113 Ga0207674_10104511 3300026116 Bacteria 2810
114 Ga0207675_100003166 3300026118 Bacteria 16155
115 Ga0207683_10431370 3300026121 Bacteria 1214
116 Ga0207698_10117226 3300026142 Bacteria 2246
117 Ga0268265_10003518 3300028380 Bacteria 11213
118 Ga0268264_10000535 3300028381 Bacteria 48055
119 Ga0268264_10079373 3300028381 Bacteria 2799
120 Ga0268264_10101674 3300028381 Unclassified 2499
121 Ga0307515_10094611 3300028794 Bacteria 3688
122 Ga0265338_10000489 3300028800 Bacteria 70654
123 Ga0265338_10002191 3300028800 Bacteria 29919
124 Ga0265325_10007734 3300031241 Bacteria 6404
125 Ga0265327_10000108 3300031251 Bacteria 183209
126 Ga0265313_10000027 3300031595 Bacteria 133281
127 Ga0265313_10000589 3300031595 Bacteria 37761
128 Ga0265313_10025320 3300031595 Plasmid 3147
129 Ga0316575_10015360 3300031665 Bacteria 2884
130 Ga0316579_10010078 3300031691 Bacteria 3986
131 Ga0316583_10001383 3300032133 Bacteria 8052
132 Ga0373934_0000209 3300035086 Bacteria 21432
133 Ga0373954_0000661 3300035118 Bacteria 13196
134 Ga0373954_0003288 3300035118 Bacteria 6827
135 Ga0373954_0022797 3300035118 Bacteria 2842
136 Ga0373956_0000006 3300035119 Bacteria 65782
137 Ga0373956_0006477 3300035119 Bacteria 4693
138 Ga0373956_0012616 3300035119 Bacteria 3506
139 Ga0373957_0065243 3300035120 Bacteria 1416
140 Ga0373957_0205049 3300035120 Bacteria 822
141 Ga0373955_0004676 3300035172 Bacteria 6077
142 Ga0373955_0023132 3300035172 Bacteria 3161
143 Ga0373955_0064206 3300035172 Bacteria 2034
144 Ga0373961_0040634 3300035241 Unclassified 1341
145 Ga0373931_0044483 3300035691 Bacteria 2342
146 Ga0373935_0451721 3300035692 Unclassified 928
147 Ga0373933_0000217 3300035724 Bacteria 37933
148 Ga0373947_0141974 3300035725 Bacteria 1541
149 Ga0373937_0000205 3300036401 Bacteria 57080
150 Ga0373937_0023994 3300036401 Bacteria 5499
151 Ga0373937_0028546 3300036401 Bacteria 5050
152 Ga0373937_0279661 3300036401 Bacteria 1576
153 Ga0373925_0558685 3300037068 Unclassified 941
154 Ga0395900_0276312 3300037418 Bacteria 1673
155 Ga0395898_0096381 3300037466 Bacteria 2842
156 Ga0395905_0360475 3300037471 Bacteria 1346
157 Ga0395901_0016762 3300038443 Bacteria 7466
158 Ga0450902_003349 3300042137 Bacteria 2338
159 Ga0451576_0158654 3300045051 Bacteria 2360
160 Ga0451576_0435254 3300045051 Bacteria 1376
161 Ga0495592_0016060 3300046454 Bacteria 5682
162 Ga0495592_0026682 3300046454 Bacteria 4378
163 Ga0495592_0112187 3300046454 Bacteria 1928
164 Ga0495592_0209844 3300046454 Bacteria 1308
165 Ga0495629_0002537 3300046459 Bacteria 14001
166 Ga0495629_0053159 3300046459 Bacteria 2834
167 Ga0495638_0004294 3300046460 Bacteria 10814
168 Ga0495641_0015838 3300046461 Bacteria 3998
169 Ga0495651_0004810 3300046462 Bacteria 10338
170 Ga0495651_0014637 3300046462 Bacteria 6065
171 Ga0495651_0159284 3300046462 Bacteria 1619
172 Ga0495653_0008547 3300046463 Bacteria 8396
173 Ga0495653_0065059 3300046463 Bacteria 2745
174 Ga0495653_0104454 3300046463 Bacteria 2047
175 Ga0495650_0004564 3300046471 Bacteria 9439
176 Ga0495650_0018754 3300046471 Bacteria 3429
177 Ga0495580_0011651 3300046472 Bacteria 6799
178 Ga0495580_0119211 3300046472 Bacteria 1832
179 Ga0495582_0018009 3300046473 Bacteria 3863
180 Ga0495664_0015312 3300046477 Bacteria 4357
181 Ga0495664_0050443 3300046477 Bacteria 2471
182 Ga0495584_0064699 3300046491 Bacteria 1839
183 Ga0495585_0017582 3300046492 Bacteria 4131
184 Ga0495585_0276520 3300046492 Bacteria 831
185 Ga0495606_0127878 3300046507 Bacteria 1513
186 Ga0495608_0095426 3300046511 Bacteria 1921
187 Ga0495628_0000814 3300046516 Bacteria 28844
188 Ga0495628_0003437 3300046516 Bacteria 14182
189 Ga0495628_0014096 3300046516 Bacteria 6709
190 Ga0495628_0032391 3300046516 Bacteria 4219
191 Ga0495630_0002063 3300046517 Bacteria 13963
192 Ga0495630_0021152 3300046517 Bacteria 4802
193 Ga0495630_0025946 3300046517 Bacteria 4336
194 Ga0495631_0181428 3300046518 Bacteria 902
195 Ga0495642_0001220 3300046528 Bacteria 11824
196 Ga0495652_0003644 3300046529 Bacteria 15082
197 Ga0495652_0005279 3300046529 Bacteria 12184
198 Ga0495652_0086329 3300046529 Bacteria 2577
199 Ga0495652_0089700 3300046529 Bacteria 2517
200 Ga0495665_0000089 3300046531 Bacteria 41241
201 Ga0495640_0005312 3300046533 Bacteria 10234
202 Ga0495586_0047319 3300046535 Bacteria 2321
203 Ga0495586_0101816 3300046535 Bacteria 1594
204 Ga0495586_0123089 3300046535 Bacteria 1449
205 Ga0495586_0271744 3300046535 Bacteria 969
206 Ga0495586_0322131 3300046535 Unclassified 886
207 Ga0495587_0043596 3300046536 Bacteria 2671
208 Ga0495587_0126489 3300046536 Bacteria 1462
209 Ga0495645_0000371 3300046543 Bacteria 31266
210 Ga0495645_0010959 3300046543 Bacteria 6365
211 Ga0495645_0014369 3300046543 Bacteria 5617
212 Ga0495645_0023661 3300046543 Bacteria 4450
213 Ga0495622_0000369 3300046557 Bacteria 31409
214 Ga0495667_0038746 3300046559 Bacteria 3173
215 Ga0495667_0080052 3300046559 Bacteria 2123
216 Ga0495634_0010049 3300046642 Bacteria 6944
217 Ga0495635_0037382 3300046663 Bacteria 3361
218 Ga0495635_0255792 3300046663 Bacteria 1180
219 Ga0495588_0009736 3300046674 Bacteria 4455
220 Ga0495657_0021356 3300046675 Bacteria 4645
221 Ga0495599_0007378 3300046678 Bacteria 6666
222 Ga0495599_0048633 3300046678 Bacteria 2658
223 Ga0495599_0049541 3300046678 Bacteria 2633
224 Ga0495599_0050034 3300046678 Bacteria 2619
225 Ga0495599_0061209 3300046678 Bacteria 2353
226 Ga0495623_0000693 3300046679 Bacteria 22389
227 Ga0495646_0002189 3300046680 Bacteria 11902
228 Ga0495646_0019982 3300046680 Bacteria 4235
229 Ga0495646_0021071 3300046680 Bacteria 4120
230 Ga0495647_0021664 3300046681 Bacteria 2315
231 Ga0495669_0067927 3300046684 Bacteria 1621
232 Ga0495624_0032547 3300046690 Bacteria 3380
233 Ga0495624_0123598 3300046690 Bacteria 1589
234 Ga0495671_0094692 3300046692 Bacteria 1461
235 Ga0495589_0001707 3300046794 Bacteria 12524
236 Ga0495589_0009472 3300046794 Bacteria 5066
237 Ga0495589_0060951 3300046794 Bacteria 1852
238 Ga0495600_0024978 3300046809 Bacteria 3848
239 Ga0495600_0099729 3300046809 Bacteria 1893
240 Ga0495660_0092928 3300046810 Bacteria 1565
241 Ga0495581_0143034 3300047315 Bacteria 1396
242 Ga0495604_0034887 3300047317 Bacteria 3975
243 Ga0495636_0025833 3300047318 Bacteria 2386
244 Ga0495674_0002659 3300047319 Bacteria 17388
245 Ga0495674_0010344 3300047319 Bacteria 8832
246 Ga0495674_0424052 3300047319 Bacteria 1071
247 Ga0495680_0003605 3300047322 Bacteria 15155
248 Ga0495680_0102514 3300047322 Bacteria 2130
249 Ga0495680_0201857 3300047322 Bacteria 1426
250 Ga0495675_0035073 3300047444 Bacteria 3205
251 Ga0495684_0040034 3300047471 Bacteria 3593
252 Ga0495686_0000110 3300047472 Bacteria 169827
253 Ga0495686_0109398 3300047472 Bacteria 1659
254 Ga0495593_0000639 3300047673 Bacteria 20100
255 Ga0495602_0003352 3300048088 Bacteria 16543
256 Ga0495602_0004661 3300048088 Bacteria 14315
257 Ga0495614_0028015 3300048089 Bacteria 2429
258 Ga0496102_0210703 3300048905 Unclassified 1832
259 Ga0496104_0516557 3300048907 Bacteria 1106
260 Ga0496104_0545933 3300048907 Unclassified 1070
261 Ga0496105_0038600 3300048908 Bacteria 3935
262 Ga0496105_0095561 3300048908 Bacteria 2455
263 Ga0496106_0062471 3300048909 Bacteria 2828
264 Ga0496107_0277681 3300048910 Unclassified 1247
265 Ga0496109_0248387 3300048912 Unclassified 1675
266 Ga0496114_0062388 3300048917 Bacteria 3119
267 Ga0496114_0534300 3300048917 Unclassified 1037
268 Ga0496121_0000821 3300048924 Bacteria 56639
269 Ga0496121_0017189 3300048924 Bacteria 7408
270 Ga0496125_0002820 3300048928 Bacteria 21935
271 Ga0496126_0001298 3300048929 Bacteria 39783
272 Ga0501039_0134632 3300049575 Bacteria 1940
273 Ga0501041_0082585 3300049577 Bacteria 1980
274 Ga0501047_0015180 3300049581 Bacteria 7333
275 Ga0501069_0016216 3300049585 Bacteria 3998
276 Ga0501071_0000860 3300049587 Bacteria 16338
277 Ga0501073_0046769 3300049589 Bacteria 3042
278 Ga0501075_0141837 3300049591 Bacteria 1831
279 Ga0501079_0248813 3300049741 Bacteria 1389
280 Ga0501080_0000881 3300049742 Bacteria 24572
281 Ga0501080_0084820 3300049742 Bacteria 2943
282 nmdc:mga06r32_735451_c1 3300050510 Unclassified 950
283 nmdc:mga08x19_219035_c1 3300050514 Bacteria 1307
284 nmdc:mga08x19_81899_c1 3300050514 Bacteria 2120
285 Ga0495601_0000765 3300053077 Bacteria 17303
286 Ga0495601_0010014 3300053077 Bacteria 5623
287 Ga0495619_0070486 3300053085 Bacteria 2337
288 Ga0500618_002756 3300053125 Bacteria 6391
289 Ga0500586_059118 3300053145 Bacteria 1332
290 Ga0500616_0073080 3300053153 Bacteria 1742
291 Ga0530510_0128466 3300061734 Bacteria 1864
292 2792840862 2791355137 Bacteria 9654227
293 2894774032 2894772417 Bacteria 5305674
294 Ga0496121_0000100
295 Ga0065707_10288534
296 Ga0065707_10292579
297 Ga0070676_10018372
298 Ga0070670_100006092
299 Ga0070670_100129216
300 Ga0070677_10082120
301 Ga0068869_100000658
302 Ga0068868_100214876
303 Ga0070692_10224793
304 Ga0070668_100002124
305 Ga0070669_100008375
306 Ga0070671_100188295
307 Ga0070673_100006374
308 Ga0070667_100002060
309 Ga0070700_100379882
310 Ga0070694_100009745
311 Ga0070663_100326698
312 Ga0070678_100461667
313 Ga0070681_10158821
314 Ga0068867_100052447
315 Ga0068867_100131264
316 Ga0070698_100124818
317 Ga0070672_100052266
318 Ga0070695_100164915
319 Ga0070696_100092072
320 Ga0070693_100049057
321 Ga0070704_100042563
322 Ga0070664_100099953
323 Ga0068857_100000776
324 Ga0068852_100292573
325 Ga0068859_100004491
326 Ga0068864_100000531
327 Ga0068864_100035161
328 Ga0068864_100307769
329 Ga0068861_100001360
330 Ga0068870_10008402
331 Ga0068863_100001999
332 Ga0068863_100003851
333 Ga0068863_100176782
334 Ga0068858_100002689
335 Ga0068858_100373909
336 Ga0068860_100008563
337 Ga0068860_100086131
338 Ga0068862_100003479
339 Ga0070716_100031445
340 Ga0068865_100164098
341 Ga0075436_100091932
342 Ga0075436_100444987
343 Ga0097620_100004491
344 Ga0075435_100171806
345 Ga0099795_10035760
346 Ga0105251_10219340
347 Ga0105240_10246143
348 Ga0111539_10396520
349 Ga0105245_10295165
350 Ga0105247_10009983
351 Ga0105242_10019501
352 Ga0105242_10022191
353 Ga0105248_10008061
354 Ga0105248_10053303
355 Ga0105237_10246313
356 Ga0105237_10258968
357 Ga0105249_10081324
358 Ga0099796_10009522
359 Ga0105239_10330051
360 Ga0163162_10098202
361 Ga0163162_10190793
362 Ga0163162_10366177
363 Ga0157372_10110986
364 Ga0157375_10003143
365 Ga0163163_10003121
366 Ga0157380_10139697
367 Ga0157379_10005572
368 Ga0157379_10193910
369 Ga0183361_10007
370 Ga0163161_10096799
371 Ga0209759_1012709
372 Ga0209025_1002880
373 Ga0207682_10120847
374 Ga0207710_10008572
375 Ga0207699_10130850
376 Ga0207645_10011596
377 Ga0207643_10020562
378 Ga0207654_10199150
379 Ga0207671_10363670
380 Ga0207681_10012319
381 Ga0207694_10324708
382 Ga0207650_10004314
383 Ga0207644_10214270
384 Ga0207704_10070821
385 Ga0207665_10002588
386 Ga0207691_10015468
387 Ga0207691_10078689
388 Ga0207711_10014602
389 Ga0207711_10018465
390 Ga0207689_10000065
391 Ga0207679_10116449
392 Ga0207667_10126658
393 Ga0207651_10078057
394 Ga0207712_10146821
395 Ga0207668_10006065
396 Ga0207658_10014673
397 Ga0207703_10000794
398 Ga0207703_10111218
399 Ga0207708_10443684
400 Ga0207641_10005734
401 Ga0207641_10074386
402 Ga0207641_10276801
403 Ga0207648_10058277
404 Ga0207676_10001071
405 Ga0207676_10029324
406 Ga0207674_10104511
407 Ga0207675_100003166
408 Ga0207683_10431370
409 Ga0207698_10117226
410 Ga0268265_10003518
411 Ga0268264_10000535
412 Ga0268264_10079373
413 Ga0268264_10101674
414 Ga0307515_10094611
415 Ga0265338_10000489
416 Ga0265338_10002191
417 Ga0265325_10007734
418 Ga0265327_10000108
419 Ga0265313_10000027
420 Ga0265313_10000589
421 Ga0265313_10025320
422 Ga0316575_10015360
423 Ga0316579_10010078
424 Ga0316583_10001383
425 Ga0373934_0000209
426 Ga0373954_0000661
427 Ga0373954_0003288
428 Ga0373954_0022797
429 Ga0373956_0000006
430 Ga0373956_0006477
431 Ga0373956_0012616
432 Ga0373957_0065243
433 Ga0373957_0205049
434 Ga0373955_0004676
435 Ga0373955_0023132
436 Ga0373955_0064206
437 Ga0373961_0040634
438 Ga0373931_0044483
439 Ga0373935_0451721
440 Ga0373933_0000217
441 Ga0373947_0141974
442 Ga0373937_0000205
443 Ga0373937_0023994
444 Ga0373937_0028546
445 Ga0373937_0279661
446 Ga0373925_0558685
447 Ga0395900_0276312
448 Ga0395898_0096381
449 Ga0395905_0360475
450 Ga0395901_0016762
451 Ga0450902_003349
452 Ga0451576_0158654
453 Ga0451576_0435254
454 Ga0495592_0016060
455 Ga0495592_0026682
456 Ga0495592_0112187
457 Ga0495592_0209844
458 Ga0495629_0002537
459 Ga0495629_0053159
460 Ga0495638_0004294
461 Ga0495641_0015838
462 Ga0495651_0004810
463 Ga0495651_0014637
464 Ga0495651_0159284
465 Ga0495653_0008547
466 Ga0495653_0065059
467 Ga0495653_0104454
468 Ga0495650_0004564
469 Ga0495650_0018754
470 Ga0495580_0011651
471 Ga0495580_0119211
472 Ga0495582_0018009
473 Ga0495664_0015312
474 Ga0495664_0050443
475 Ga0495584_0064699
476 Ga0495585_0017582
477 Ga0495585_0276520
478 Ga0495606_0127878
479 Ga0495608_0095426
480 Ga0495628_0000814
481 Ga0495628_0003437
482 Ga0495628_0014096
483 Ga0495628_0032391
484 Ga0495630_0002063
485 Ga0495630_0021152
486 Ga0495630_0025946
487 Ga0495631_0181428
488 Ga0495642_0001220
489 Ga0495652_0003644
490 Ga0495652_0005279
491 Ga0495652_0086329
492 Ga0495652_0089700
493 Ga0495665_0000089
494 Ga0495640_0005312
495 Ga0495586_0047319
496 Ga0495586_0101816
497 Ga0495586_0123089
498 Ga0495586_0271744
499 Ga0495586_0322131
500 Ga0495587_0043596
501 Ga0495587_0126489
502 Ga0495645_0000371
503 Ga0495645_0010959
504 Ga0495645_0014369
505 Ga0495645_0023661
506 Ga0495622_0000369
507 Ga0495667_0038746
508 Ga0495667_0080052
509 Ga0495634_0010049
510 Ga0495635_0037382
511 Ga0495635_0255792
512 Ga0495588_0009736
513 Ga0495657_0021356
514 Ga0495599_0007378
515 Ga0495599_0048633
516 Ga0495599_0049541
517 Ga0495599_0050034
518 Ga0495599_0061209
519 Ga0495623_0000693
520 Ga0495646_0002189
521 Ga0495646_0019982
522 Ga0495646_0021071
523 Ga0495647_0021664
524 Ga0495669_0067927
525 Ga0495624_0032547
526 Ga0495624_0123598
527 Ga0495671_0094692
528 Ga0495589_0001707
529 Ga0495589_0009472
530 Ga0495589_0060951
531 Ga0495600_0024978
532 Ga0495600_0099729
533 Ga0495660_0092928
534 Ga0495581_0143034
535 Ga0495604_0034887
536 Ga0495636_0025833
537 Ga0495674_0002659
538 Ga0495674_0010344
539 Ga0495674_0424052
540 Ga0495680_0003605
541 Ga0495680_0102514
542 Ga0495680_0201857
543 Ga0495675_0035073
544 Ga0495684_0040034
545 Ga0495686_0000110
546 Ga0495686_0109398
547 Ga0495593_0000639
548 Ga0495602_0003352
549 Ga0495602_0004661
550 Ga0495614_0028015
551 Ga0496102_0210703
552 Ga0496104_0516557
553 Ga0496104_0545933
554 Ga0496105_0038600
555 Ga0496105_0095561
556 Ga0496106_0062471
557 Ga0496107_0277681
558 Ga0496109_0248387
559 Ga0496114_0062388
560 Ga0496114_0534300
561 Ga0496121_0000821
562 Ga0496121_0017189
563 Ga0496125_0002820
564 Ga0496126_0001298
565 Ga0501039_0134632
566 Ga0501041_0082585
567 Ga0501047_0015180
568 Ga0501069_0016216
569 Ga0501071_0000860
570 Ga0501073_0046769
571 Ga0501075_0141837
572 Ga0501079_0248813
573 Ga0501080_0000881
574 Ga0501080_0084820
575 nmdc:mga06r32_735451_c1
576 nmdc:mga08x19_219035_c1
577 nmdc:mga08x19_81899_c1
578 Ga0495601_0000765
579 Ga0495601_0010014
580 Ga0495619_0070486
581 Ga0500618_002756
582 Ga0500586_059118
583 Ga0500616_0073080
584 Ga0530510_0128466
585 2792840862
586 2894774032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

58

116

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zit-assembly1.cif.gz_A crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.9195 7 78
3zit-assembly1.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.9186 7 81
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.9178 7 76
7c13-assembly1.cif.gz_C-2 beta1 domain-swapped structure of monothiol cgrx1(c16s) 0.8972 7 67
3zit-assembly1.cif.gz_A crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.8851 7 78
ID Description Score Start End Superfamily
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9178 7 76 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8714 7 76 3.40.30.10
af_Q2FZH4_1_76_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8524 6 81 3.40.30.10
af_Q2FZH4_1_76_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8325 6 81 3.40.30.10
4fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8119 8 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7C7NC86-F1-model_v4 NrdH-redoxin 0.9646 6 255
AF-A0A158HIE1-F1-model_v4 Glutaredoxin 0.9631 3 255
AF-A0A537D6U3-F1-model_v4 NrdH-redoxin 0.9628 4 255 GO:0009055
GO:0045454
AF-A0A7X2KF48-F1-model_v4 NrdH-redoxin 0.9622 21 255
AF-A0A7Z9IUG9-F1-model_v4 DinB family protein 0.962 32 256

Map