F392793

General Info

Members Datasets Scaffolds Average Seq Length
295 202 590 75

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0898883|Ga0466967_0898883_381_635
Length 84
Sequence MPEPTDPLRDLTARLLGPAEPEVGCDECFERLDEFVDRELAGEAPAWAPRMRAHLDGCPACREDHESLRALVLADAPGRGDRPV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 4.07
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 9.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0898883 3300045976 Bacteria 881
2 Ga0070676_11533379 3300005328 Bacteria 514
3 Ga0070690_100107564 3300005330 Bacteria 1856
4 Ga0070670_100035246 3300005331 Bacteria 4309
5 Ga0068869_100132700 3300005334 Bacteria 1916
6 Ga0070666_10289375 3300005335 Bacteria 1165
7 Ga0070682_100182418 3300005337 Unclassified 1467
8 Ga0068868_100311989 3300005338 Bacteria 1338
9 Ga0070689_100258261 3300005340 Unclassified 1439
10 Ga0070687_100291801 3300005343 Bacteria 1031
11 Ga0070692_10080322 3300005345 Bacteria 1755
12 Ga0070692_10945244 3300005345 Bacteria 599
13 Ga0070668_101004036 3300005347 Bacteria 750
14 Ga0070674_101629699 3300005356 Unclassified 582
15 Ga0070673_101774422 3300005364 Bacteria 584
16 Ga0070688_100000185 3300005365 Bacteria 32960
17 Ga0070659_101006548 3300005366 Bacteria 732
18 Ga0070667_100363921 3300005367 Bacteria 1311
19 Ga0070714_100342775 3300005435 Unclassified 1402
20 Ga0070710_10456471 3300005437 Unclassified 867
21 Ga0070711_100245900 3300005439 Bacteria 1401
22 Ga0070705_100108150 3300005440 Bacteria 1771
23 Ga0070705_101654209 3300005440 Bacteria 540
24 Ga0070700_101077203 3300005441 Bacteria 665
25 Ga0070694_101134928 3300005444 Bacteria 653
26 Ga0070708_101785645 3300005445 Unclassified 571
27 Ga0070663_100193744 3300005455 Bacteria 1583
28 Ga0070678_100002457 3300005456 Bacteria 10158
29 Ga0068867_101025725 3300005459 Unclassified 749
30 Ga0070685_10000030 3300005466 Bacteria 87995
31 Ga0070697_100096189 3300005536 Unclassified 2457
32 Ga0068853_101135592 3300005539 Bacteria 754
33 Ga0070686_100041679 3300005544 Bacteria 2871
34 Ga0070695_100224541 3300005545 Bacteria 1355
35 Ga0070695_100840682 3300005545 Bacteria 738
36 Ga0070696_100719688 3300005546 Bacteria 815
37 Ga0070693_100429741 3300005547 Bacteria 922
38 Ga0068854_100709767 3300005578 Bacteria 869
39 Ga0068856_100001087 3300005614 Bacteria 28662
40 Ga0068856_100028336 3300005614 Bacteria 5469
41 Ga0068856_100729369 3300005614 Bacteria 1011
42 Ga0070702_100016755 3300005615 Bacteria 3767
43 Ga0070702_101870274 3300005615 Bacteria 503
44 Ga0068852_100000131 3300005616 Bacteria 50602
45 Ga0068852_101094472 3300005616 Unclassified 817
46 Ga0068859_101180162 3300005617 Unclassified 843
47 Ga0068859_101332161 3300005617 Unclassified 791
48 Ga0068860_100029375 3300005843 Bacteria 5287
49 Ga0081455_11027631 3300005937 Bacteria 510
50 Ga0081538_10005364 3300005981 Bacteria 11521
51 Ga0081539_10316398 3300005985 Bacteria 665
52 Ga0075363_100262659 3300006048 Bacteria 996
53 Ga0075432_10108607 3300006058 Bacteria 1032
54 Ga0075432_10377771 3300006058 Bacteria 607
55 Ga0070715_10005293 3300006163 Bacteria 4292
56 Ga0070712_100742977 3300006175 Unclassified 839
57 Ga0070712_101338378 3300006175 Bacteria 624
58 Ga0097621_100050029 3300006237 Bacteria 3397
59 Ga0068871_100058392 3300006358 Bacteria 3141
60 Ga0075428_100218204 3300006844 Bacteria 2060
61 Ga0075428_100348106 3300006844 Bacteria 1591
62 Ga0075430_101569582 3300006846 Bacteria 540
63 Ga0075431_101173520 3300006847 Bacteria 731
64 Ga0075431_101410723 3300006847 Bacteria 656
65 Ga0075434_101088086 3300006871 Bacteria 813
66 Ga0075429_100438828 3300006880 Bacteria 1144
67 Ga0068865_100000033 3300006881 Bacteria 84342
68 Ga0097620_101332438 3300006931 Unclassified 791
69 Ga0111539_10656337 3300009094 Bacteria 1221
70 Ga0105245_11881837 3300009098 Bacteria 651
71 Ga0114129_10130927 3300009147 Bacteria 3445
72 Ga0114129_10659189 3300009147 Bacteria 1350
73 Ga0114129_11998460 3300009147 Bacteria 701
74 Ga0105243_10012448 3300009148 Bacteria 6430
75 Ga0105243_10159309 3300009148 Bacteria 1945
76 Ga0105241_10004216 3300009174 Bacteria 10619
77 Ga0105242_10004820 3300009176 Bacteria 10442
78 Ga0105248_10000466 3300009177 Bacteria 46063
79 Ga0105248_10020031 3300009177 Bacteria 7407
80 Ga0105237_10002739 3300009545 Bacteria 21501
81 Ga0105239_11827242 3300010375 Bacteria 704
82 Ga0105246_10974605 3300011119 Bacteria 766
83 Ga0105246_12365106 3300011119 Bacteria 520
84 Ga0157335_1014610 3300012492 Bacteria 682
85 Ga0157373_10323917 3300013100 Bacteria 1096
86 Ga0157371_10002867 3300013102 Bacteria 16120
87 Ga0157369_10000128 3300013105 Bacteria 108576
88 Ga0157374_10821883 3300013296 Unclassified 945
89 Ga0157378_10032098 3300013297 Bacteria 4639
90 Ga0157375_10005942 3300013308 Bacteria 10638
91 Ga0157380_10717105 3300014326 Bacteria 1007
92 Ga0182008_10752955 3300014497 Bacteria 561
93 Ga0157379_10007397 3300014968 Bacteria 9504
94 Ga0157376_10003319 3300014969 Bacteria 11073
95 Ga0224712_10020299 3300022467 Bacteria 2253
96 Ga0207685_10013131 3300025905 Bacteria 2553
97 Ga0207654_10052587 3300025911 Bacteria 2348
98 Ga0207671_10001250 3300025914 Bacteria 29955
99 Ga0207693_10490765 3300025915 Bacteria 959
100 Ga0207650_10041009 3300025925 Bacteria 3390
101 Ga0207664_10335992 3300025929 Unclassified 1335
102 Ga0207644_11713934 3300025931 Bacteria 526
103 Ga0207706_11073429 3300025933 Unclassified 674
104 Ga0207686_10995079 3300025934 Bacteria 680
105 Ga0207709_10468866 3300025935 Bacteria 977
106 Ga0207670_10380636 3300025936 Unclassified 1124
107 Ga0207669_10359969 3300025937 Unclassified 1127
108 Ga0207669_10770271 3300025937 Bacteria 796
109 Ga0207704_10000029 3300025938 Bacteria 120526
110 Ga0207704_11063688 3300025938 Bacteria 686
111 Ga0207704_11543972 3300025938 Bacteria 570
112 Ga0207711_10000085 3300025941 Bacteria 99467
113 Ga0207711_10163411 3300025941 Bacteria 2017
114 Ga0207689_10075820 3300025942 Bacteria 2764
115 Ga0207640_10385822 3300025981 Bacteria 1136
116 Ga0207658_10025269 3300025986 Bacteria 4159
117 Ga0207639_10287742 3300026041 Bacteria 1448
118 Ga0207678_10300188 3300026067 Bacteria 1380
119 Ga0207708_10368538 3300026075 Bacteria 1182
120 Ga0207702_10000316 3300026078 Bacteria 55327
121 Ga0207702_10019944 3300026078 Bacteria 5555
122 Ga0207674_11128423 3300026116 Bacteria 753
123 Ga0207683_10000039 3300026121 Bacteria 99697
124 Ga0207698_10000009 3300026142 Bacteria 281300
125 Ga0207698_10827614 3300026142 Bacteria 929
126 Ga0207698_11163297 3300026142 Bacteria 785
127 Ga0209970_1072470 3300027614 Bacteria 641
128 Ga0209983_1139986 3300027665 Bacteria 554
129 Ga0207428_11038990 3300027907 Unclassified 574
130 Ga0207428_11066120 3300027907 Bacteria 566
131 Ga0268266_11589770 3300028379 Unclassified 629
132 Ga0268265_12005277 3300028380 Bacteria 586
133 Ga0268264_10007411 3300028381 Bacteria 9159
134 Ga0307410_11164228 3300031852 Unclassified 671
135 Ga0307410_11789465 3300031852 Bacteria 545
136 Ga0307406_10362994 3300031901 Unclassified 1136
137 Ga0307407_10034097 3300031903 Bacteria 2784
138 Ga0307407_11084570 3300031903 Bacteria 622
139 Ga0307409_100038705 3300031995 Bacteria 3530
140 Ga0307409_100674978 3300031995 Bacteria 1030
141 Ga0307409_100735461 3300031995 Bacteria 989
142 Ga0307416_100036506 3300032002 Unclassified 3770
143 Ga0307416_100127452 3300032002 Bacteria 2283
144 Ga0307411_10072793 3300032005 Bacteria 2335
145 Ga0307415_100088189 3300032126 Bacteria 2238
146 Ga0307415_100146213 3300032126 Bacteria 1813
147 Ga0307415_101844117 3300032126 Bacteria 586
148 Ga0373960_0018525 3300035121 Bacteria 1817
149 Ga0373946_0633403 3300035171 Bacteria 556
150 Ga0373947_0136094 3300035725 Bacteria 1572
151 Ga0373925_0261550 3300037068 Bacteria 1390
152 Ga0395899_0064946 3300037312 Bacteria 2682
153 Ga0395900_0069854 3300037418 Bacteria 3610
154 Ga0395900_0876859 3300037418 Bacteria 822
155 Ga0395898_0028726 3300037466 Bacteria 5573
156 Ga0395898_0054180 3300037466 Bacteria 3915
157 Ga0395898_0726440 3300037466 Bacteria 935
158 Ga0395898_1355441 3300037466 Bacteria 640
159 Ga0395905_0029399 3300037471 Bacteria 5177
160 Ga0395901_0057650 3300038443 Bacteria 4039
161 Ga0395901_0869885 3300038443 Bacteria 885
162 Ga0395901_1411275 3300038443 Bacteria 654
163 Ga0439464_0106060 3300042439 Bacteria 857
164 Ga0466961_0015969 3300044693 Bacteria 4820
165 Ga0466963_0135717 3300044694 Bacteria 1702
166 Ga0466957_0050484 3300044842 Bacteria 2531
167 Ga0466960_0783553 3300044901 Bacteria 576
168 Ga0466959_0021024 3300045049 Bacteria 4812
169 Ga0495603_0034879 3300046455 Bacteria 3024
170 Ga0495629_0123827 3300046459 Bacteria 1801
171 Ga0495641_0341927 3300046461 Bacteria 676
172 Ga0495580_0403522 3300046472 Unclassified 921
173 Ga0495582_0516607 3300046473 Bacteria 690
174 Ga0495664_0275288 3300046477 Unclassified 1017
175 Ga0495584_0481408 3300046491 Bacteria 632
176 Ga0495584_0518816 3300046491 Bacteria 607
177 Ga0495594_0394663 3300046499 Bacteria 787
178 Ga0495594_0748090 3300046499 Bacteria 552
179 Ga0495596_0016041 3300046500 Bacteria 3118
180 Ga0495596_0199211 3300046500 Bacteria 778
181 Ga0495620_0407192 3300046515 Bacteria 515
182 Ga0495630_1201708 3300046517 Bacteria 573
183 Ga0495632_0288957 3300046519 Bacteria 729
184 Ga0495663_0143434 3300046525 Bacteria 812
185 Ga0495609_0372235 3300046538 Bacteria 574
186 Ga0495588_0164341 3300046674 Unclassified 1174
187 Ga0495647_0183446 3300046681 Bacteria 911
188 Ga0495658_0002335 3300046683 Bacteria 9581
189 Ga0495670_0411866 3300046691 Unclassified 731
190 Ga0495589_0540089 3300046794 Bacteria 532
191 Ga0495676_0499397 3300047321 Bacteria 798
192 Ga0495593_0074125 3300047673 Bacteria 1765
193 Ga0495593_0114419 3300047673 Bacteria 1376
194 Ga0496101_0004608 3300048904 Bacteria 8707
195 Ga0496101_1405615 3300048904 Unclassified 544
196 Ga0496102_0069314 3300048905 Bacteria 3237
197 Ga0496102_1035949 3300048905 Bacteria 741
198 Ga0496103_0007146 3300048906 Bacteria 6662
199 Ga0496104_0001559 3300048907 Bacteria 19737
200 Ga0496105_0003650 3300048908 Bacteria 11439
201 Ga0496106_0013955 3300048909 Bacteria 5941
202 Ga0496107_0009278 3300048910 Bacteria 6821
203 Ga0496110_1644458 3300048913 Unclassified 552
204 Ga0496114_0248387 3300048917 Bacteria 1565
205 Ga0496115_0085423 3300048918 Bacteria 2574
206 Ga0501031_0115903 3300049568 Bacteria 1750
207 Ga0501032_0719020 3300049569 Bacteria 632
208 Ga0501033_0071839 3300049570 Bacteria 2542
209 Ga0501033_0389396 3300049570 Bacteria 973
210 Ga0501034_0017858 3300049571 Bacteria 7276
211 Ga0501036_0042441 3300049572 Bacteria 3851
212 Ga0501036_0548849 3300049572 Bacteria 960
213 Ga0501039_0000367 3300049575 Bacteria 32271
214 Ga0501039_0659730 3300049575 Bacteria 819
215 Ga0501040_0005072 3300049576 Bacteria 8508
216 Ga0501040_0018080 3300049576 Bacteria 4682
217 Ga0501040_0064298 3300049576 Bacteria 2526
218 Ga0501040_0087389 3300049576 Bacteria 2165
219 Ga0501041_0144843 3300049577 Bacteria 1482
220 Ga0501042_0000793 3300049578 Bacteria 17322
221 Ga0501042_0192667 3300049578 Bacteria 1470
222 Ga0501042_0398780 3300049578 Bacteria 996
223 Ga0501042_0610784 3300049578 Bacteria 793
224 Ga0501042_0962587 3300049578 Bacteria 622
225 Ga0501043_0004579 3300049579 Bacteria 11218
226 Ga0501043_0434237 3300049579 Bacteria 989
227 Ga0501046_0001452 3300049580 Bacteria 22782
228 Ga0501046_0060111 3300049580 Bacteria 2975
229 Ga0501048_0042260 3300049582 Bacteria 3264
230 Ga0501048_0194469 3300049582 Bacteria 1438
231 Ga0501068_0397768 3300049584 Bacteria 888
232 Ga0501068_1073045 3300049584 Bacteria 532
233 Ga0501069_0011702 3300049585 Bacteria 4651
234 Ga0501070_0017074 3300049586 Bacteria 6091
235 Ga0501070_0090066 3300049586 Bacteria 2539
236 Ga0501070_0556018 3300049586 Bacteria 918
237 Ga0501070_0630690 3300049586 Bacteria 852
238 Ga0501070_0746025 3300049586 Bacteria 772
239 Ga0501071_0093714 3300049587 Bacteria 2208
240 Ga0501071_0375446 3300049587 Bacteria 1084
241 Ga0501072_0022982 3300049588 Bacteria 4841
242 Ga0501072_0087990 3300049588 Bacteria 2465
243 Ga0501073_0005662 3300049589 Bacteria 9343
244 Ga0501073_0058224 3300049589 Bacteria 2701
245 Ga0501073_0488081 3300049589 Bacteria 852
246 Ga0501074_0034701 3300049590 Bacteria 3656
247 Ga0501074_0071198 3300049590 Bacteria 2500
248 Ga0501074_0363969 3300049590 Bacteria 1026
249 Ga0501074_0980467 3300049590 Bacteria 594
250 Ga0501075_0001394 3300049591 Bacteria 15720
251 Ga0501075_0082795 3300049591 Bacteria 2430
252 Ga0501075_0318488 3300049591 Bacteria 1185
253 Ga0501075_0365903 3300049591 Bacteria 1099
254 Ga0501076_0001301 3300049592 Bacteria 16668
255 Ga0501076_0033345 3300049592 Bacteria 4020
256 Ga0501077_0002463 3300049593 Bacteria 11091
257 Ga0501077_0396240 3300049593 Bacteria 882
258 Ga0501079_0314739 3300049741 Bacteria 1225
259 Ga0501079_0526564 3300049741 Bacteria 929
260 Ga0501080_0002689 3300049742 Bacteria 15571
261 Ga0501080_0002838 3300049742 Bacteria 15225
262 Ga0501081_0053712 3300049743 Bacteria 2782
263 Ga0501081_0326975 3300049743 Bacteria 1128
264 Ga0501081_0793912 3300049743 Bacteria 712
265 Ga0501083_0002451 3300049744 Bacteria 12699
266 Ga0501083_0770212 3300049744 Bacteria 626
267 Ga0501035_0004349 3300049822 Bacteria 13447
268 Ga0501035_0680616 3300049822 Bacteria 831
269 Ga0501045_0001941 3300049824 Bacteria 13964
270 Ga0501045_0077853 3300049824 Bacteria 2444
271 Ga0501045_0094665 3300049824 Bacteria 2209
272 nmdc:mga03n38_266105_c1 3300050490 Bacteria 910
273 nmdc:mga05p37_1169353_c1 3300050507 Bacteria 798
274 nmdc:mga05p37_47897_c1 3300050507 Bacteria 5256
275 nmdc:mga05p37_867447_c1 3300050507 Bacteria 978
276 nmdc:mga09592_479097_c1 3300050508 Bacteria 1072
277 nmdc:mga0qj67_460460_c1 3300050509 Bacteria 1024
278 nmdc:mga06r32_1749647_c1 3300050510 Bacteria 558
279 nmdc:mga06r32_47683_c1 3300050510 Bacteria 4093
280 nmdc:mga08y16_1329386_c1 3300050511 Bacteria 684
281 nmdc:mga08y16_1920980_c1 3300050511 Bacteria 542
282 nmdc:mga08y16_873761_c1 3300050511 Bacteria 887
283 nmdc:mga0n895_174182_c1 3300050512 Bacteria 2183
284 nmdc:mga0a205_450118_c1 3300050515 Bacteria 1147
285 nmdc:mga0a205_854289_c1 3300050515 Bacteria 757
286 Ga0495601_0000098 3300053077 Bacteria 48076
287 Ga0495601_0974019 3300053077 Bacteria 534
288 Ga0495655_0176824 3300053083 Bacteria 686
289 Ga0501084_0016903 3300054114 Bacteria 6064
290 Ga0501084_0461302 3300054114 Bacteria 1074
291 Ga0501082_0000977 3300060353 Bacteria 25229
292 Ga0501082_0042778 3300060353 Bacteria 3905
293 Ga0501082_0072100 3300060353 Bacteria 2975
294 Ga0530510_0122144 3300061734 Bacteria 1912
295 Ga0530510_1022141 3300061734 Bacteria 633
296 Ga0466967_0898883
297 Ga0070676_11533379
298 Ga0070690_100107564
299 Ga0070670_100035246
300 Ga0068869_100132700
301 Ga0070666_10289375
302 Ga0070682_100182418
303 Ga0068868_100311989
304 Ga0070689_100258261
305 Ga0070687_100291801
306 Ga0070692_10080322
307 Ga0070692_10945244
308 Ga0070668_101004036
309 Ga0070674_101629699
310 Ga0070673_101774422
311 Ga0070688_100000185
312 Ga0070659_101006548
313 Ga0070667_100363921
314 Ga0070714_100342775
315 Ga0070710_10456471
316 Ga0070711_100245900
317 Ga0070705_100108150
318 Ga0070705_101654209
319 Ga0070700_101077203
320 Ga0070694_101134928
321 Ga0070708_101785645
322 Ga0070663_100193744
323 Ga0070678_100002457
324 Ga0068867_101025725
325 Ga0070685_10000030
326 Ga0070697_100096189
327 Ga0068853_101135592
328 Ga0070686_100041679
329 Ga0070695_100224541
330 Ga0070695_100840682
331 Ga0070696_100719688
332 Ga0070693_100429741
333 Ga0068854_100709767
334 Ga0068856_100001087
335 Ga0068856_100028336
336 Ga0068856_100729369
337 Ga0070702_100016755
338 Ga0070702_101870274
339 Ga0068852_100000131
340 Ga0068852_101094472
341 Ga0068859_101180162
342 Ga0068859_101332161
343 Ga0068860_100029375
344 Ga0081455_11027631
345 Ga0081538_10005364
346 Ga0081539_10316398
347 Ga0075363_100262659
348 Ga0075432_10108607
349 Ga0075432_10377771
350 Ga0070715_10005293
351 Ga0070712_100742977
352 Ga0070712_101338378
353 Ga0097621_100050029
354 Ga0068871_100058392
355 Ga0075428_100218204
356 Ga0075428_100348106
357 Ga0075430_101569582
358 Ga0075431_101173520
359 Ga0075431_101410723
360 Ga0075434_101088086
361 Ga0075429_100438828
362 Ga0068865_100000033
363 Ga0097620_101332438
364 Ga0111539_10656337
365 Ga0105245_11881837
366 Ga0114129_10130927
367 Ga0114129_10659189
368 Ga0114129_11998460
369 Ga0105243_10012448
370 Ga0105243_10159309
371 Ga0105241_10004216
372 Ga0105242_10004820
373 Ga0105248_10000466
374 Ga0105248_10020031
375 Ga0105237_10002739
376 Ga0105239_11827242
377 Ga0105246_10974605
378 Ga0105246_12365106
379 Ga0157335_1014610
380 Ga0157373_10323917
381 Ga0157371_10002867
382 Ga0157369_10000128
383 Ga0157374_10821883
384 Ga0157378_10032098
385 Ga0157375_10005942
386 Ga0157380_10717105
387 Ga0182008_10752955
388 Ga0157379_10007397
389 Ga0157376_10003319
390 Ga0224712_10020299
391 Ga0207685_10013131
392 Ga0207654_10052587
393 Ga0207671_10001250
394 Ga0207693_10490765
395 Ga0207650_10041009
396 Ga0207664_10335992
397 Ga0207644_11713934
398 Ga0207706_11073429
399 Ga0207686_10995079
400 Ga0207709_10468866
401 Ga0207670_10380636
402 Ga0207669_10359969
403 Ga0207669_10770271
404 Ga0207704_10000029
405 Ga0207704_11063688
406 Ga0207704_11543972
407 Ga0207711_10000085
408 Ga0207711_10163411
409 Ga0207689_10075820
410 Ga0207640_10385822
411 Ga0207658_10025269
412 Ga0207639_10287742
413 Ga0207678_10300188
414 Ga0207708_10368538
415 Ga0207702_10000316
416 Ga0207702_10019944
417 Ga0207674_11128423
418 Ga0207683_10000039
419 Ga0207698_10000009
420 Ga0207698_10827614
421 Ga0207698_11163297
422 Ga0209970_1072470
423 Ga0209983_1139986
424 Ga0207428_11038990
425 Ga0207428_11066120
426 Ga0268266_11589770
427 Ga0268265_12005277
428 Ga0268264_10007411
429 Ga0307410_11164228
430 Ga0307410_11789465
431 Ga0307406_10362994
432 Ga0307407_10034097
433 Ga0307407_11084570
434 Ga0307409_100038705
435 Ga0307409_100674978
436 Ga0307409_100735461
437 Ga0307416_100036506
438 Ga0307416_100127452
439 Ga0307411_10072793
440 Ga0307415_100088189
441 Ga0307415_100146213
442 Ga0307415_101844117
443 Ga0373960_0018525
444 Ga0373946_0633403
445 Ga0373947_0136094
446 Ga0373925_0261550
447 Ga0395899_0064946
448 Ga0395900_0069854
449 Ga0395900_0876859
450 Ga0395898_0028726
451 Ga0395898_0054180
452 Ga0395898_0726440
453 Ga0395898_1355441
454 Ga0395905_0029399
455 Ga0395901_0057650
456 Ga0395901_0869885
457 Ga0395901_1411275
458 Ga0439464_0106060
459 Ga0466961_0015969
460 Ga0466963_0135717
461 Ga0466957_0050484
462 Ga0466960_0783553
463 Ga0466959_0021024
464 Ga0495603_0034879
465 Ga0495629_0123827
466 Ga0495641_0341927
467 Ga0495580_0403522
468 Ga0495582_0516607
469 Ga0495664_0275288
470 Ga0495584_0481408
471 Ga0495584_0518816
472 Ga0495594_0394663
473 Ga0495594_0748090
474 Ga0495596_0016041
475 Ga0495596_0199211
476 Ga0495620_0407192
477 Ga0495630_1201708
478 Ga0495632_0288957
479 Ga0495663_0143434
480 Ga0495609_0372235
481 Ga0495588_0164341
482 Ga0495647_0183446
483 Ga0495658_0002335
484 Ga0495670_0411866
485 Ga0495589_0540089
486 Ga0495676_0499397
487 Ga0495593_0074125
488 Ga0495593_0114419
489 Ga0496101_0004608
490 Ga0496101_1405615
491 Ga0496102_0069314
492 Ga0496102_1035949
493 Ga0496103_0007146
494 Ga0496104_0001559
495 Ga0496105_0003650
496 Ga0496106_0013955
497 Ga0496107_0009278
498 Ga0496110_1644458
499 Ga0496114_0248387
500 Ga0496115_0085423
501 Ga0501031_0115903
502 Ga0501032_0719020
503 Ga0501033_0071839
504 Ga0501033_0389396
505 Ga0501034_0017858
506 Ga0501036_0042441
507 Ga0501036_0548849
508 Ga0501039_0000367
509 Ga0501039_0659730
510 Ga0501040_0005072
511 Ga0501040_0018080
512 Ga0501040_0064298
513 Ga0501040_0087389
514 Ga0501041_0144843
515 Ga0501042_0000793
516 Ga0501042_0192667
517 Ga0501042_0398780
518 Ga0501042_0610784
519 Ga0501042_0962587
520 Ga0501043_0004579
521 Ga0501043_0434237
522 Ga0501046_0001452
523 Ga0501046_0060111
524 Ga0501048_0042260
525 Ga0501048_0194469
526 Ga0501068_0397768
527 Ga0501068_1073045
528 Ga0501069_0011702
529 Ga0501070_0017074
530 Ga0501070_0090066
531 Ga0501070_0556018
532 Ga0501070_0630690
533 Ga0501070_0746025
534 Ga0501071_0093714
535 Ga0501071_0375446
536 Ga0501072_0022982
537 Ga0501072_0087990
538 Ga0501073_0005662
539 Ga0501073_0058224
540 Ga0501073_0488081
541 Ga0501074_0034701
542 Ga0501074_0071198
543 Ga0501074_0363969
544 Ga0501074_0980467
545 Ga0501075_0001394
546 Ga0501075_0082795
547 Ga0501075_0318488
548 Ga0501075_0365903
549 Ga0501076_0001301
550 Ga0501076_0033345
551 Ga0501077_0002463
552 Ga0501077_0396240
553 Ga0501079_0314739
554 Ga0501079_0526564
555 Ga0501080_0002689
556 Ga0501080_0002838
557 Ga0501081_0053712
558 Ga0501081_0326975
559 Ga0501081_0793912
560 Ga0501083_0002451
561 Ga0501083_0770212
562 Ga0501035_0004349
563 Ga0501035_0680616
564 Ga0501045_0001941
565 Ga0501045_0077853
566 Ga0501045_0094665
567 nmdc:mga03n38_266105_c1
568 nmdc:mga05p37_1169353_c1
569 nmdc:mga05p37_47897_c1
570 nmdc:mga05p37_867447_c1
571 nmdc:mga09592_479097_c1
572 nmdc:mga0qj67_460460_c1
573 nmdc:mga06r32_1749647_c1
574 nmdc:mga06r32_47683_c1
575 nmdc:mga08y16_1329386_c1
576 nmdc:mga08y16_1920980_c1
577 nmdc:mga08y16_873761_c1
578 nmdc:mga0n895_174182_c1
579 nmdc:mga0a205_450118_c1
580 nmdc:mga0a205_854289_c1
581 Ga0495601_0000098
582 Ga0495601_0974019
583 Ga0495655_0176824
584 Ga0501084_0016903
585 Ga0501084_0461302
586 Ga0501082_0000977
587 Ga0501082_0042778
588 Ga0501082_0072100
589 Ga0530510_0122144
590 Ga0530510_1022141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z2s-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.6298 30 76
2z2s-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.6277 30 76
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.6149 27 75
5eur-assembly1.cif.gz_A hypothetical protein sf216 from shigella flexneri 5a m90t 0.4857 8 80
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.4774 27 75
ID Description Score Start End Superfamily
2z2sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6359 30 72 1.10.10.1320
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6292 30 75 1.10.10.1320
af_Q13439_2169_2224_1.10.220.60 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;GRIP domain 0.4454 25 73 1.10.220.60
4mbqE00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4413 21 68 1.20.58.2200
4mbqE00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4256 21 68 1.20.58.2200
ID Description Score Start End GO Terms
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9351 20 72
AF-A0A1F8NGJ4-F1-model_v4 Zinc-finger domain-containing protein 0.9195 19 74
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.9069 17 70
AF-A0A7W1YN45-F1-model_v4 Zinc-finger domain-containing protein 0.9046 23 77
AF-A0A7J9YXC1-F1-model_v4 Zf-HC2 domain-containing protein 0.8999 12 73

Map