F392664

General Info

Members Datasets Scaffolds Average Seq Length
295 220 590 141

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1071070|Ga0209257_10710702
Length 130
Sequence MKKSDPSEKDTAACALIDGRIAELAGWRGEALARVRAWIHEALPDVVEEWKWRVPVWSRDGIVCTGEAYKAAVKLTFPKGASIADPKQLFNSSLEGNVRRAIDIREGELLDEAAFKALVRAAAAANRKGA

Samples

Sample ID Description Type Environment
1 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
214 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.41
Nodule 0
Rhizoplane 5.08
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209257_1071070 3300025304 Bacteria 917
2 JGI25162J39368_1004936 3300002737 Bacteria 2836
3 Ga0055542_1028879 3300003762 Bacteria 726
4 Ga0055540_1017041 3300003792 Bacteria 2042
5 Ga0065715_10252188 3300005293 Bacteria 1146
6 Ga0070658_10010397 3300005327 Bacteria 7461
7 Ga0070658_10778813 3300005327 Bacteria 831
8 Ga0070690_100017743 3300005330 Bacteria 4288
9 Ga0070670_100049673 3300005331 Bacteria 3606
10 Ga0068869_100013491 3300005334 Bacteria 5437
11 Ga0070680_100077198 3300005336 Bacteria 2743
12 Ga0070682_100111535 3300005337 Bacteria 1823
13 Ga0068868_100056166 3300005338 Bacteria 3108
14 Ga0070660_100149634 3300005339 Bacteria 1876
15 Ga0070669_100032280 3300005353 Bacteria 3783
16 Ga0070669_100246783 3300005353 Bacteria 1420
17 Ga0070669_100365846 3300005353 Bacteria 1174
18 Ga0070675_100169953 3300005354 Bacteria 1879
19 Ga0070671_100045219 3300005355 Bacteria 3660
20 Ga0070671_100346112 3300005355 Bacteria 1268
21 Ga0070674_100004253 3300005356 Bacteria 8145
22 Ga0070673_100126562 3300005364 Bacteria 2138
23 Ga0070667_100017382 3300005367 Bacteria 5960
24 Ga0070667_100201641 3300005367 Bacteria 1765
25 Ga0070667_100246892 3300005367 Bacteria 1595
26 Ga0070713_100657389 3300005436 Bacteria 998
27 Ga0070700_100723862 3300005441 Bacteria 793
28 Ga0070678_100001219 3300005456 Bacteria 13605
29 Ga0070662_100142036 3300005457 Bacteria 1862
30 Ga0070681_10007979 3300005458 Bacteria 10359
31 Ga0068867_100016174 3300005459 Bacteria 5299
32 Ga0070685_10116145 3300005466 Bacteria 1656
33 Ga0070699_101764564 3300005518 Bacteria 567
34 Ga0070679_100024930 3300005530 Bacteria 5864
35 Ga0070679_100294670 3300005530 Bacteria 1573
36 Ga0070672_100052759 3300005543 Bacteria 3176
37 Ga0070672_100104657 3300005543 Bacteria 2299
38 Ga0070672_101111055 3300005543 Bacteria 703
39 Ga0070686_100525506 3300005544 Bacteria 922
40 Ga0070695_100918838 3300005545 Bacteria 708
41 Ga0068855_100388868 3300005563 Bacteria 1530
42 Ga0068855_100540521 3300005563 Bacteria 1262
43 Ga0068857_100086057 3300005577 Bacteria 2810
44 Ga0068856_100052927 3300005614 Bacteria 4004
45 Ga0068852_100360595 3300005616 Bacteria 1422
46 Ga0068859_100194175 3300005617 Bacteria 2114
47 Ga0068859_100493105 3300005617 Bacteria 1320
48 Ga0068859_101045578 3300005617 Bacteria 897
49 Ga0068864_100044711 3300005618 Bacteria 3797
50 Ga0068864_100080740 3300005618 Bacteria 2850
51 Ga0068866_10043201 3300005718 Bacteria 2248
52 Ga0068861_100068323 3300005719 Bacteria 2746
53 Ga0068870_10173766 3300005840 Bacteria 1288
54 Ga0068863_100017918 3300005841 Bacteria 6778
55 Ga0068863_100159147 3300005841 Bacteria 2163
56 Ga0068858_100422146 3300005842 Bacteria 1282
57 Ga0068858_101427608 3300005842 Bacteria 682
58 Ga0068860_100280270 3300005843 Bacteria 1629
59 Ga0068860_100532462 3300005843 Bacteria 1175
60 Ga0070717_10073236 3300006028 Bacteria 2862
61 Ga0070717_10458195 3300006028 Bacteria 1150
62 Ga0097621_100167115 3300006237 Bacteria 1894
63 Ga0097621_100284457 3300006237 Bacteria 1456
64 Ga0068871_100179980 3300006358 Bacteria 1816
65 Ga0075428_100017874 3300006844 Bacteria 7834
66 Ga0075434_100509940 3300006871 Bacteria 1223
67 Ga0075429_100092069 3300006880 Bacteria 2645
68 Ga0068865_100185252 3300006881 Bacteria 1606
69 Ga0068865_100292943 3300006881 Bacteria 1300
70 Ga0097620_100194158 3300006931 Bacteria 2114
71 Ga0097620_100493096 3300006931 Bacteria 1320
72 Ga0097620_101045602 3300006931 Bacteria 897
73 Ga0075435_100004714 3300007076 Bacteria 9408
74 Ga0105240_10486146 3300009093 Bacteria 1375
75 Ga0105240_10511844 3300009093 Bacteria 1333
76 Ga0111539_10355859 3300009094 Bacteria 1704
77 Ga0105243_10038371 3300009148 Bacteria 3730
78 Ga0105241_10257602 3300009174 Bacteria 1482
79 Ga0105241_12383763 3300009174 Bacteria 528
80 Ga0105248_10217964 3300009177 Bacteria 2149
81 Ga0105248_10225734 3300009177 Bacteria 2108
82 Ga0105248_11321678 3300009177 Bacteria 815
83 Ga0105249_10238585 3300009553 Bacteria 1796
84 Ga0105249_10499135 3300009553 Bacteria 1262
85 Ga0105239_12845611 3300010375 Bacteria 565
86 Ga0157369_10198241 3300013105 Bacteria 2107
87 Ga0157374_10009760 3300013296 Bacteria 8242
88 Ga0157378_10061964 3300013297 Bacteria 3340
89 Ga0157378_10725719 3300013297 Bacteria 1015
90 Ga0163162_10202664 3300013306 Bacteria 2113
91 Ga0157375_10071300 3300013308 Bacteria 3487
92 Ga0157375_10546352 3300013308 Bacteria 1320
93 Ga0163163_10395884 3300014325 Bacteria 1439
94 Ga0157380_10317314 3300014326 Bacteria 1443
95 Ga0182008_10000560 3300014497 Bacteria 27570
96 Ga0157379_10150772 3300014968 Bacteria 2097
97 Ga0157379_11472991 3300014968 Bacteria 661
98 Ga0157376_10264491 3300014969 Bacteria 1613
99 Ga0163161_10708125 3300017792 Bacteria 839
100 Ga0213875_10057935 3300021388 Bacteria 1814
101 Ga0209674_100516 3300025226 Bacteria 15692
102 Ga0207427_105015 3300025231 Bacteria 1992
103 Ga0209437_101173 3300025233 Bacteria 7768
104 Ga0209148_1001648 3300025254 Bacteria 10144
105 Ga0207673_1006134 3300025290 Bacteria 1481
106 Ga0209051_1000904 3300025303 Bacteria 29543
107 Ga0207682_10094129 3300025893 Bacteria 1303
108 Ga0207642_10082861 3300025899 Bacteria 1562
109 Ga0207645_10006969 3300025907 Bacteria 8048
110 Ga0207643_10028322 3300025908 Bacteria 3110
111 Ga0207705_10181061 3300025909 Bacteria 1590
112 Ga0207707_10130451 3300025912 Bacteria 2198
113 Ga0207695_10018524 3300025913 Bacteria 8048
114 Ga0207695_10284844 3300025913 Bacteria 1546
115 Ga0207693_10001149 3300025915 Bacteria 23647
116 Ga0207660_10195763 3300025917 Bacteria 1576
117 Ga0207657_10005317 3300025919 Bacteria 13494
118 Ga0207652_10040685 3300025921 Bacteria 3948
119 Ga0207681_10034049 3300025923 Bacteria 3346
120 Ga0207681_10126975 3300025923 Bacteria 1880
121 Ga0207681_10213977 3300025923 Bacteria 1487
122 Ga0207681_10275131 3300025923 Bacteria 1323
123 Ga0207681_10473335 3300025923 Bacteria 1022
124 Ga0207650_10035086 3300025925 Bacteria 3640
125 Ga0207650_10080965 3300025925 Bacteria 2462
126 Ga0207659_10131536 3300025926 Bacteria 1932
127 Ga0207644_10035034 3300025931 Bacteria 3515
128 Ga0207706_10007468 3300025933 Bacteria 10109
129 Ga0207709_10630710 3300025935 Bacteria 851
130 Ga0207670_10021158 3300025936 Bacteria 4008
131 Ga0207669_10442191 3300025937 Bacteria 1028
132 Ga0207704_10238910 3300025938 Bacteria 1356
133 Ga0207704_10663050 3300025938 Bacteria 860
134 Ga0207691_10004136 3300025940 Bacteria 14097
135 Ga0207691_10734979 3300025940 Bacteria 831
136 Ga0207691_10763567 3300025940 Bacteria 813
137 Ga0207711_10061239 3300025941 Bacteria 3245
138 Ga0207689_10015406 3300025942 Bacteria 6473
139 Ga0207689_11150657 3300025942 Bacteria 654
140 Ga0207661_10783724 3300025944 Bacteria 878
141 Ga0207667_10048309 3300025949 Bacteria 4500
142 Ga0207651_10097177 3300025960 Bacteria 2174
143 Ga0207668_10299706 3300025972 Bacteria 1326
144 Ga0207658_10009355 3300025986 Bacteria 6647
145 Ga0207658_10583017 3300025986 Bacteria 1003
146 Ga0207703_10219187 3300026035 Bacteria 1700
147 Ga0207639_10542732 3300026041 Bacteria 1067
148 Ga0207678_10437359 3300026067 Bacteria 1136
149 Ga0207708_10508304 3300026075 Bacteria 1011
150 Ga0207702_10041343 3300026078 Bacteria 3866
151 Ga0207702_10255514 3300026078 Bacteria 1647
152 Ga0207641_10009482 3300026088 Bacteria 8023
153 Ga0207641_10735227 3300026088 Bacteria 973
154 Ga0207648_10007658 3300026089 Bacteria 10570
155 Ga0207676_10013145 3300026095 Bacteria 5942
156 Ga0207674_10475543 3300026116 Bacteria 1208
157 Ga0207675_100034241 3300026118 Bacteria 4735
158 Ga0207675_100051094 3300026118 Bacteria 3857
159 Ga0207683_10002334 3300026121 Bacteria 16635
160 Ga0207698_10031176 3300026142 Bacteria 3845
161 Ga0268265_10787149 3300028380 Bacteria 926
162 Ga0268264_10364564 3300028381 Bacteria 1379
163 Ga0268264_10530389 3300028381 Bacteria 1152
164 Ga0265326_10006632 3300028558 Bacteria 3582
165 Ga0265334_10000123 3300028573 Bacteria 50146
166 Ga0265318_10007079 3300028577 Bacteria 5105
167 Ga0307515_10653494 3300028794 Bacteria 664
168 Ga0265338_10011414 3300028800 Bacteria 10260
169 Ga0265338_10833738 3300028800 Bacteria 630
170 Ga0265762_1014968 3300030760 Bacteria 1403
171 Ga0265330_10002410 3300031235 Bacteria 10206
172 Ga0265330_10042034 3300031235 Bacteria 2026
173 Ga0265330_10175515 3300031235 Bacteria 908
174 Ga0265332_10068498 3300031238 Bacteria 1512
175 Ga0265320_10014497 3300031240 Bacteria 4483
176 Ga0265325_10003650 3300031241 Bacteria 9978
177 Ga0265325_10142338 3300031241 Bacteria 1139
178 Ga0265329_10002082 3300031242 Bacteria 9311
179 Ga0265340_10040039 3300031247 Bacteria 2309
180 Ga0265340_10072603 3300031247 Bacteria 1629
181 Ga0265339_10028757 3300031249 Bacteria 3158
182 Ga0265339_10045264 3300031249 Bacteria 2422
183 Ga0265339_10076071 3300031249 Bacteria 1781
184 Ga0265339_10247866 3300031249 Bacteria 863
185 Ga0265331_10012854 3300031250 Bacteria 4517
186 Ga0265327_10031355 3300031251 Bacteria 2987
187 Ga0265316_10009520 3300031344 Bacteria 8943
188 Ga0265316_10011354 3300031344 Bacteria 8042
189 Ga0265316_10052220 3300031344 Bacteria 3207
190 Ga0265316_10439657 3300031344 Bacteria 936
191 Ga0265313_10003956 3300031595 Bacteria 11647
192 Ga0265313_10018229 3300031595 Bacteria 3950
193 Ga0265314_10005870 3300031711 Bacteria 10989
194 Ga0265314_10078129 3300031711 Bacteria 2193
195 Ga0265314_10196281 3300031711 Bacteria 1197
196 Ga0265342_10007582 3300031712 Bacteria 7924
197 Ga0307415_100193728 3300032126 Bacteria 1606
198 Ga0373933_0245759 3300035724 Bacteria 1152
199 Ga0436364_0256011 3300037853 Bacteria 3536
200 Ga0436361_0056219 3300039447 Bacteria 673
201 Ga0451841_0661234 3300041498 Bacteria 708
202 Ga0453683_0508650 3300044673 Bacteria 782
203 Ga0466966_0010607 3300044684 Bacteria 6126
204 Ga0466966_0029395 3300044684 Bacteria 3575
205 Ga0466961_0001276 3300044693 Bacteria 15503
206 Ga0466964_0000048 3300044706 Bacteria 25333
207 Ga0453684_0016153 3300044712 Bacteria 11708
208 Ga0453684_0328119 3300044712 Bacteria 1731
209 Ga0466971_0001113 3300044719 Bacteria 11156
210 Ga0466968_0061324 3300044735 Bacteria 1622
211 Ga0466970_0000695 3300044765 Bacteria 16475
212 Ga0466957_0123348 3300044842 Bacteria 1653
213 Ga0466959_0006813 3300045049 Bacteria 7960
214 Ga0466959_0325951 3300045049 Bacteria 1049
215 Ga0451576_0411486 3300045051 Bacteria 1418
216 Ga0466958_0034712 3300045836 Bacteria 3011
217 Ga0495650_0022742 3300046471 Bacteria 3001
218 Ga0495582_0611340 3300046473 Bacteria 631
219 Ga0495606_0006903 3300046507 Bacteria 10334
220 Ga0495606_0059800 3300046507 Bacteria 2443
221 Ga0495618_0160497 3300046514 Bacteria 1433
222 Ga0495630_0337197 3300046517 Bacteria 1153
223 Ga0495630_0486475 3300046517 Bacteria 946
224 Ga0495652_0582022 3300046529 Bacteria 766
225 Ga0495645_0142839 3300046543 Bacteria 1669
226 Ga0495645_0424589 3300046543 Bacteria 843
227 Ga0495667_0128029 3300046559 Bacteria 1638
228 Ga0495656_0057780 3300046615 Bacteria 1681
229 Ga0495634_0532971 3300046642 Bacteria 686
230 Ga0495599_0064349 3300046678 Bacteria 2291
231 Ga0495647_0080854 3300046681 Bacteria 1318
232 Ga0495658_0286919 3300046683 Bacteria 1039
233 Ga0495613_0388644 3300046689 Bacteria 953
234 Ga0495674_0088281 3300047319 Bacteria 2652
235 Ga0495675_0035641 3300047444 Bacteria 3177
236 Ga0495684_0115603 3300047471 Bacteria 2023
237 Ga0495686_0224344 3300047472 Bacteria 1067
238 Ga0496101_0692361 3300048904 Bacteria 805
239 Ga0496103_0141460 3300048906 Bacteria 1539
240 Ga0496106_0111216 3300048909 Bacteria 2133
241 Ga0496107_0301302 3300048910 Bacteria 1193
242 Ga0496108_0062429 3300048911 Bacteria 3137
243 Ga0496108_0462147 3300048911 Bacteria 1109
244 Ga0496109_0139882 3300048912 Bacteria 2263
245 Ga0496109_0211778 3300048912 Bacteria 1823
246 Ga0496110_0008001 3300048913 Bacteria 8472
247 Ga0496110_0054104 3300048913 Bacteria 3530
248 Ga0496111_0088436 3300048914 Bacteria 2269
249 Ga0496111_0349133 3300048914 Bacteria 1095
250 Ga0496112_0074515 3300048915 Bacteria 3356
251 Ga0496113_0033866 3300048916 Bacteria 3723
252 Ga0496113_0145437 3300048916 Bacteria 1867
253 Ga0496121_0001314 3300048924 Bacteria 42592
254 Ga0496123_0184475 3300048926 Bacteria 1086
255 Ga0496124_0000273 3300048927 Bacteria 99505
256 Ga0496125_0012030 3300048928 Bacteria 8615
257 Ga0496125_0029775 3300048928 Bacteria 4899
258 Ga0501033_0041192 3300049570 Bacteria 3447
259 Ga0501036_0051191 3300049572 Bacteria 3497
260 Ga0501036_1306733 3300049572 Bacteria 589
261 Ga0501040_0009587 3300049576 Bacteria 6315
262 Ga0501041_0007200 3300049577 Bacteria 6530
263 Ga0501046_0096687 3300049580 Bacteria 2269
264 Ga0501047_0414585 3300049581 Bacteria 1179
265 Ga0501067_0321690 3300049583 Bacteria 861
266 Ga0501068_0020887 3300049584 Bacteria 3821
267 Ga0501069_0106481 3300049585 Bacteria 1594
268 Ga0501071_0028175 3300049587 Bacteria 3957
269 Ga0501072_0443445 3300049588 Bacteria 1028
270 Ga0501072_0535769 3300049588 Bacteria 925
271 Ga0501075_0038188 3300049591 Bacteria 3589
272 Ga0501075_0618421 3300049591 Bacteria 826
273 Ga0501076_0026437 3300049592 Bacteria 4497
274 Ga0501076_1160765 3300049592 Bacteria 636
275 Ga0501077_0000746 3300049593 Bacteria 19704
276 Ga0501260_048474 3300049689 Bacteria 531
277 Ga0501079_0007674 3300049741 Bacteria 8165
278 Ga0501081_0004231 3300049743 Bacteria 9194
279 Ga0501035_0321634 3300049822 Unclassified 1300
280 Ga0501035_0362230 3300049822 Bacteria 1212
281 nmdc:mga08y16_153464_c1 3300050511 Bacteria 2393
282 nmdc:mga0n895_5200_c1 3300050512 Bacteria 10830
283 nmdc:mga0rr50_527808_c1 3300050513 Bacteria 1005
284 Ga0495601_0159427 3300053077 Bacteria 1474
285 Ga0495595_0014004 3300053084 Bacteria 3395
286 Ga0495619_0242284 3300053085 Bacteria 1249
287 Ga0500566_0004184 3300053094 Bacteria 8602
288 Ga0500650_0173331 3300053098 Bacteria 991
289 Ga0500591_226120 3300053115 Bacteria 611
290 Ga0500603_002463 3300053150 Bacteria 4050
291 Ga0501084_0225707 3300054114 Unclassified 1580
292 Ga0501082_0010830 3300060353 Bacteria 7853
293 Ga0466962_0001743 3300061719 Bacteria 10228
294 Ga0530510_0001488 3300061734 Bacteria 15738
295 2595447348 2593339238 Bacteria 4182970
296 Ga0209257_1071070
297 JGI25162J39368_1004936
298 Ga0055542_1028879
299 Ga0055540_1017041
300 Ga0065715_10252188
301 Ga0070658_10010397
302 Ga0070658_10778813
303 Ga0070690_100017743
304 Ga0070670_100049673
305 Ga0068869_100013491
306 Ga0070680_100077198
307 Ga0070682_100111535
308 Ga0068868_100056166
309 Ga0070660_100149634
310 Ga0070669_100032280
311 Ga0070669_100246783
312 Ga0070669_100365846
313 Ga0070675_100169953
314 Ga0070671_100045219
315 Ga0070671_100346112
316 Ga0070674_100004253
317 Ga0070673_100126562
318 Ga0070667_100017382
319 Ga0070667_100201641
320 Ga0070667_100246892
321 Ga0070713_100657389
322 Ga0070700_100723862
323 Ga0070678_100001219
324 Ga0070662_100142036
325 Ga0070681_10007979
326 Ga0068867_100016174
327 Ga0070685_10116145
328 Ga0070699_101764564
329 Ga0070679_100024930
330 Ga0070679_100294670
331 Ga0070672_100052759
332 Ga0070672_100104657
333 Ga0070672_101111055
334 Ga0070686_100525506
335 Ga0070695_100918838
336 Ga0068855_100388868
337 Ga0068855_100540521
338 Ga0068857_100086057
339 Ga0068856_100052927
340 Ga0068852_100360595
341 Ga0068859_100194175
342 Ga0068859_100493105
343 Ga0068859_101045578
344 Ga0068864_100044711
345 Ga0068864_100080740
346 Ga0068866_10043201
347 Ga0068861_100068323
348 Ga0068870_10173766
349 Ga0068863_100017918
350 Ga0068863_100159147
351 Ga0068858_100422146
352 Ga0068858_101427608
353 Ga0068860_100280270
354 Ga0068860_100532462
355 Ga0070717_10073236
356 Ga0070717_10458195
357 Ga0097621_100167115
358 Ga0097621_100284457
359 Ga0068871_100179980
360 Ga0075428_100017874
361 Ga0075434_100509940
362 Ga0075429_100092069
363 Ga0068865_100185252
364 Ga0068865_100292943
365 Ga0097620_100194158
366 Ga0097620_100493096
367 Ga0097620_101045602
368 Ga0075435_100004714
369 Ga0105240_10486146
370 Ga0105240_10511844
371 Ga0111539_10355859
372 Ga0105243_10038371
373 Ga0105241_10257602
374 Ga0105241_12383763
375 Ga0105248_10217964
376 Ga0105248_10225734
377 Ga0105248_11321678
378 Ga0105249_10238585
379 Ga0105249_10499135
380 Ga0105239_12845611
381 Ga0157369_10198241
382 Ga0157374_10009760
383 Ga0157378_10061964
384 Ga0157378_10725719
385 Ga0163162_10202664
386 Ga0157375_10071300
387 Ga0157375_10546352
388 Ga0163163_10395884
389 Ga0157380_10317314
390 Ga0182008_10000560
391 Ga0157379_10150772
392 Ga0157379_11472991
393 Ga0157376_10264491
394 Ga0163161_10708125
395 Ga0213875_10057935
396 Ga0209674_100516
397 Ga0207427_105015
398 Ga0209437_101173
399 Ga0209148_1001648
400 Ga0207673_1006134
401 Ga0209051_1000904
402 Ga0207682_10094129
403 Ga0207642_10082861
404 Ga0207645_10006969
405 Ga0207643_10028322
406 Ga0207705_10181061
407 Ga0207707_10130451
408 Ga0207695_10018524
409 Ga0207695_10284844
410 Ga0207693_10001149
411 Ga0207660_10195763
412 Ga0207657_10005317
413 Ga0207652_10040685
414 Ga0207681_10034049
415 Ga0207681_10126975
416 Ga0207681_10213977
417 Ga0207681_10275131
418 Ga0207681_10473335
419 Ga0207650_10035086
420 Ga0207650_10080965
421 Ga0207659_10131536
422 Ga0207644_10035034
423 Ga0207706_10007468
424 Ga0207709_10630710
425 Ga0207670_10021158
426 Ga0207669_10442191
427 Ga0207704_10238910
428 Ga0207704_10663050
429 Ga0207691_10004136
430 Ga0207691_10734979
431 Ga0207691_10763567
432 Ga0207711_10061239
433 Ga0207689_10015406
434 Ga0207689_11150657
435 Ga0207661_10783724
436 Ga0207667_10048309
437 Ga0207651_10097177
438 Ga0207668_10299706
439 Ga0207658_10009355
440 Ga0207658_10583017
441 Ga0207703_10219187
442 Ga0207639_10542732
443 Ga0207678_10437359
444 Ga0207708_10508304
445 Ga0207702_10041343
446 Ga0207702_10255514
447 Ga0207641_10009482
448 Ga0207641_10735227
449 Ga0207648_10007658
450 Ga0207676_10013145
451 Ga0207674_10475543
452 Ga0207675_100034241
453 Ga0207675_100051094
454 Ga0207683_10002334
455 Ga0207698_10031176
456 Ga0268265_10787149
457 Ga0268264_10364564
458 Ga0268264_10530389
459 Ga0265326_10006632
460 Ga0265334_10000123
461 Ga0265318_10007079
462 Ga0307515_10653494
463 Ga0265338_10011414
464 Ga0265338_10833738
465 Ga0265762_1014968
466 Ga0265330_10002410
467 Ga0265330_10042034
468 Ga0265330_10175515
469 Ga0265332_10068498
470 Ga0265320_10014497
471 Ga0265325_10003650
472 Ga0265325_10142338
473 Ga0265329_10002082
474 Ga0265340_10040039
475 Ga0265340_10072603
476 Ga0265339_10028757
477 Ga0265339_10045264
478 Ga0265339_10076071
479 Ga0265339_10247866
480 Ga0265331_10012854
481 Ga0265327_10031355
482 Ga0265316_10009520
483 Ga0265316_10011354
484 Ga0265316_10052220
485 Ga0265316_10439657
486 Ga0265313_10003956
487 Ga0265313_10018229
488 Ga0265314_10005870
489 Ga0265314_10078129
490 Ga0265314_10196281
491 Ga0265342_10007582
492 Ga0307415_100193728
493 Ga0373933_0245759
494 Ga0436364_0256011
495 Ga0436361_0056219
496 Ga0451841_0661234
497 Ga0453683_0508650
498 Ga0466966_0010607
499 Ga0466966_0029395
500 Ga0466961_0001276
501 Ga0466964_0000048
502 Ga0453684_0016153
503 Ga0453684_0328119
504 Ga0466971_0001113
505 Ga0466968_0061324
506 Ga0466970_0000695
507 Ga0466957_0123348
508 Ga0466959_0006813
509 Ga0466959_0325951
510 Ga0451576_0411486
511 Ga0466958_0034712
512 Ga0495650_0022742
513 Ga0495582_0611340
514 Ga0495606_0006903
515 Ga0495606_0059800
516 Ga0495618_0160497
517 Ga0495630_0337197
518 Ga0495630_0486475
519 Ga0495652_0582022
520 Ga0495645_0142839
521 Ga0495645_0424589
522 Ga0495667_0128029
523 Ga0495656_0057780
524 Ga0495634_0532971
525 Ga0495599_0064349
526 Ga0495647_0080854
527 Ga0495658_0286919
528 Ga0495613_0388644
529 Ga0495674_0088281
530 Ga0495675_0035641
531 Ga0495684_0115603
532 Ga0495686_0224344
533 Ga0496101_0692361
534 Ga0496103_0141460
535 Ga0496106_0111216
536 Ga0496107_0301302
537 Ga0496108_0062429
538 Ga0496108_0462147
539 Ga0496109_0139882
540 Ga0496109_0211778
541 Ga0496110_0008001
542 Ga0496110_0054104
543 Ga0496111_0088436
544 Ga0496111_0349133
545 Ga0496112_0074515
546 Ga0496113_0033866
547 Ga0496113_0145437
548 Ga0496121_0001314
549 Ga0496123_0184475
550 Ga0496124_0000273
551 Ga0496125_0012030
552 Ga0496125_0029775
553 Ga0501033_0041192
554 Ga0501036_0051191
555 Ga0501036_1306733
556 Ga0501040_0009587
557 Ga0501041_0007200
558 Ga0501046_0096687
559 Ga0501047_0414585
560 Ga0501067_0321690
561 Ga0501068_0020887
562 Ga0501069_0106481
563 Ga0501071_0028175
564 Ga0501072_0443445
565 Ga0501072_0535769
566 Ga0501075_0038188
567 Ga0501075_0618421
568 Ga0501076_0026437
569 Ga0501076_1160765
570 Ga0501077_0000746
571 Ga0501260_048474
572 Ga0501079_0007674
573 Ga0501081_0004231
574 Ga0501035_0321634
575 Ga0501035_0362230
576 nmdc:mga08y16_153464_c1
577 nmdc:mga0n895_5200_c1
578 nmdc:mga0rr50_527808_c1
579 Ga0495601_0159427
580 Ga0495595_0014004
581 Ga0495619_0242284
582 Ga0500566_0004184
583 Ga0500650_0173331
584 Ga0500591_226120
585 Ga0500603_002463
586 Ga0501084_0225707
587 Ga0501082_0010830
588 Ga0466962_0001743
589 Ga0530510_0001488
590 2595447348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

28

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7092 15 131
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6978 11 130
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6826 11 130
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.651 15 131
3f6t-assembly1.cif.gz_B crystal structure of aspartate aminotransferase (e.c. 2.6.1.1) (yp_194538.1) from lactobacillus acidophilus ncfm at 2.15 a resolution 0.6271 97 136
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7552 15 126 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7209 15 126 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6996 15 130 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6898 29 129 3.90.1150.30
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6791 15 130 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A561I0U0-F1-model_v4 deleted 0.9929 9 126
AF-A0A370D3G0-F1-model_v4 deleted 0.9911 9 127
AF-A0A4V5MSA1-F1-model_v4 deleted 0.9907 7 126
AF-A0A4R5XB74-F1-model_v4 DUF1801 domain-containing protein 0.9856 9 127
AF-A0A5E4ICR6-F1-model_v4 YdhG-like domain-containing protein 0.9848 9 130

Map