F392618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 200 | 278 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10000308|Ga0105243_1000030847 |
| Length | 359 |
| Sequence | MRGPLFPRRQHVVRRVARQEGRHFATRWFEPRARRRYSAAMRFAFVKCHGSGNDFPMIDARAIDLPDAAWARVALALADRRGPVGGDGLLLLTAGDARHDFGFRMFNSDGSEAETCLNGLRCVARAGFEALGIDHAHVHLKTSVVEVTRDPDLAPGVVTVRELAGPASLDIAQWPMTIDRQQNVQMAIPGLPSTRPFTAVSIPNPHLIAFVDAVDEQELVAIGQLCESAPDWLPNRANVSFVETRPGGLFVRTFERGVGLTDSCGSAMAASTFAACLTERARFDTEITVWNAGGLIRACADPDGMVRLSGNATYEWEGSADVDLDRALAGEVVVTRHFNDEIAAWAKVADQAIAVPRPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 4 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 5 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 6 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 7 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 8 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 9 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 10 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 11 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 12 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 13 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 14 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 15 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 16 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 17 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 129 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 130 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 134 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 135 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 174 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 183 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 184 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 185 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 187 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 188 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 189 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 190 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 194 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 195 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 196 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 198 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 199 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 200 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.9 |
| Metatranscriptomes | 0.34 |
| Isolates | 5.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.36 |
| Bulb | 0 |
| Endosphere | 28.14 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 55.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c004719 | 3300000041 | Bacteria | 1177 |
| 2 | JGI24741J21665_1002914 | 3300001915 | Bacteria | 4282 |
| 3 | JGI24740J21852_10007533 | 3300001979 | Bacteria | 4414 |
| 4 | JGI24737J22298_10001740 | 3300001990 | Bacteria | 7772 |
| 5 | JGI25150J39212_1000282 | 3300002774 | Bacteria | 26768 |
| 6 | JGI25165J46597_1000065 | 3300003214 | Bacteria | 199761 |
| 7 | JGI25153J46596_10000032 | 3300003215 | Bacteria | 196732 |
| 8 | JGI25153J46596_10000097 | 3300003215 | Bacteria | 101627 |
| 9 | JGI25153J46596_10006076 | 3300003215 | Bacteria | 6203 |
| 10 | rootL2_10220847 | 3300003322 | Bacteria | 1336 |
| 11 | Ga0055525_1000086 | 3300003759 | Bacteria | 150228 |
| 12 | Ga0055542_1000041 | 3300003762 | Bacteria | 208892 |
| 13 | Ga0055529_1000040 | 3300003763 | Bacteria | 230562 |
| 14 | Ga0055526_1010403 | 3300003771 | Bacteria | 4330 |
| 15 | Ga0055524_1000133 | 3300003775 | Bacteria | 87720 |
| 16 | Ga0055530_10000114 | 3300003791 | Bacteria | 70700 |
| 17 | Ga0055530_10007007 | 3300003791 | Bacteria | 4859 |
| 18 | Ga0055530_10010211 | 3300003791 | Bacteria | 3498 |
| 19 | Ga0055530_10018169 | 3300003791 | Bacteria | 2178 |
| 20 | Ga0055540_1000427 | 3300003792 | Bacteria | 33646 |
| 21 | Ga0055540_1001864 | 3300003792 | Bacteria | 11855 |
| 22 | Ga0055531_10000095 | 3300003794 | Bacteria | 96056 |
| 23 | Ga0055531_10004220 | 3300003794 | Bacteria | 8849 |
| 24 | Ga0055531_10017158 | 3300003794 | Bacteria | 3072 |
| 25 | Ga0055531_10017161 | 3300003794 | Bacteria | 3072 |
| 26 | Ga0065165_1002993 | 3300005262 | Bacteria | 12818 |
| 27 | Ga0065165_1003798 | 3300005262 | Bacteria | 10098 |
| 28 | Ga0065165_1014431 | 3300005262 | Bacteria | 3067 |
| 29 | Ga0065165_1026972 | 3300005262 | Bacteria | 1880 |
| 30 | Ga0065165_1045945 | 3300005262 | Bacteria | 1269 |
| 31 | Ga0065714_10098881 | 3300005288 | Bacteria | 1699 |
| 32 | Ga0070658_10009301 | 3300005327 | Bacteria | 7904 |
| 33 | Ga0070676_10075396 | 3300005328 | Bacteria | 2034 |
| 34 | Ga0070661_100003101 | 3300005344 | Bacteria | 11434 |
| 35 | Ga0070661_100074162 | 3300005344 | Bacteria | 2505 |
| 36 | Ga0070675_100018052 | 3300005354 | Bacteria | 5615 |
| 37 | Ga0070674_100053493 | 3300005356 | Bacteria | 2788 |
| 38 | Ga0070659_100365270 | 3300005366 | Bacteria | 1213 |
| 39 | Ga0070663_100259704 | 3300005455 | Bacteria | 1377 |
| 40 | Ga0070678_100028265 | 3300005456 | Bacteria | 3822 |
| 41 | Ga0068867_100140622 | 3300005459 | Bacteria | 1886 |
| 42 | Ga0070679_100210330 | 3300005530 | Bacteria | 1909 |
| 43 | Ga0068853_100023688 | 3300005539 | Bacteria | 5143 |
| 44 | Ga0068853_100137452 | 3300005539 | Bacteria | 2191 |
| 45 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 46 | Ga0070665_100066541 | 3300005548 | Bacteria | 3615 |
| 47 | Ga0070665_100170391 | 3300005548 | Bacteria | 2178 |
| 48 | Ga0070664_100033839 | 3300005564 | Bacteria | 4284 |
| 49 | Ga0068857_100025968 | 3300005577 | Bacteria | 5159 |
| 50 | Ga0068859_100000913 | 3300005617 | Bacteria | 30198 |
| 51 | Ga0068864_100003105 | 3300005618 | Bacteria | 13719 |
| 52 | Ga0068861_100000882 | 3300005719 | Bacteria | 18211 |
| 53 | Ga0068858_100011445 | 3300005842 | Bacteria | 8375 |
| 54 | Ga0068858_100083832 | 3300005842 | Bacteria | 2965 |
| 55 | Ga0097620_100000913 | 3300006931 | Bacteria | 30198 |
| 56 | Ga0105243_10000308 | 3300009148 | Bacteria | 54026 |
| 57 | Ga0105243_10470680 | 3300009148 | Bacteria | 1184 |
| 58 | Ga0105241_10037202 | 3300009174 | Bacteria | 3666 |
| 59 | Ga0105248_10000558 | 3300009177 | Bacteria | 42249 |
| 60 | Ga0105248_10090211 | 3300009177 | Bacteria | 3451 |
| 61 | Ga0105237_10053828 | 3300009545 | Bacteria | 4035 |
| 62 | Ga0105238_10027753 | 3300009551 | Bacteria | 5770 |
| 63 | Ga0157373_10071438 | 3300013100 | Bacteria | 2451 |
| 64 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 65 | Ga0157371_10065560 | 3300013102 | Bacteria | 2572 |
| 66 | Ga0157370_10280033 | 3300013104 | Bacteria | 1541 |
| 67 | Ga0157369_10362428 | 3300013105 | Bacteria | 1505 |
| 68 | Ga0157374_10097681 | 3300013296 | Bacteria | 2811 |
| 69 | Ga0157374_10110952 | 3300013296 | Bacteria | 2638 |
| 70 | Ga0157378_10257230 | 3300013297 | Bacteria | 1674 |
| 71 | Ga0163162_10024549 | 3300013306 | Bacteria | 5952 |
| 72 | Ga0157372_10083501 | 3300013307 | Bacteria | 3618 |
| 73 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 74 | Ga0163161_10060666 | 3300017792 | Bacteria | 2753 |
| 75 | Ga0206353_11826136 | 3300020082 | Bacteria | 2079 |
| 76 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 77 | Ga0207425_1000025 | 3300025245 | Bacteria | 321872 |
| 78 | Ga0207425_1005298 | 3300025245 | Bacteria | 3696 |
| 79 | Ga0209026_1009464 | 3300025250 | Bacteria | 1912 |
| 80 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 81 | Ga0209129_1000916 | 3300025258 | Bacteria | 18023 |
| 82 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 83 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 84 | Ga0209565_1000044 | 3300025263 | Bacteria | 229969 |
| 85 | Ga0209565_1016133 | 3300025263 | Bacteria | 1669 |
| 86 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 87 | Ga0209673_1001675 | 3300025273 | Bacteria | 18942 |
| 88 | Ga0209673_1024365 | 3300025273 | Bacteria | 2035 |
| 89 | Ga0209675_1014694 | 3300025291 | Bacteria | 2369 |
| 90 | Ga0209676_1001255 | 3300025292 | Bacteria | 26544 |
| 91 | Ga0209676_1007560 | 3300025292 | Bacteria | 5062 |
| 92 | Ga0209025_1000176 | 3300025294 | Bacteria | 158186 |
| 93 | Ga0209564_1000886 | 3300025295 | Bacteria | 39513 |
| 94 | Ga0209564_1009736 | 3300025295 | Bacteria | 4523 |
| 95 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 96 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 97 | Ga0209758_1001400 | 3300025297 | Bacteria | 28614 |
| 98 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 99 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 100 | Ga0209050_1000350 | 3300025298 | Bacteria | 88878 |
| 101 | Ga0209050_1005851 | 3300025298 | Bacteria | 7534 |
| 102 | Ga0209050_1009648 | 3300025298 | Bacteria | 4901 |
| 103 | Ga0209050_1022425 | 3300025298 | Bacteria | 2262 |
| 104 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 105 | Ga0207426_1015708 | 3300025302 | Bacteria | 2740 |
| 106 | Ga0209051_1000919 | 3300025303 | Bacteria | 29216 |
| 107 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 108 | Ga0209257_1001366 | 3300025304 | Bacteria | 29440 |
| 109 | Ga0209257_1001406 | 3300025304 | Bacteria | 28716 |
| 110 | Ga0209257_1001709 | 3300025304 | Bacteria | 24597 |
| 111 | Ga0209257_1012638 | 3300025304 | Bacteria | 3872 |
| 112 | Ga0207697_10005019 | 3300025315 | Bacteria | 6212 |
| 113 | Ga0207656_10009045 | 3300025321 | Bacteria | 3691 |
| 114 | Ga0207688_10049194 | 3300025901 | Bacteria | 2356 |
| 115 | Ga0207647_10048486 | 3300025904 | Bacteria | 2637 |
| 116 | Ga0207645_10050657 | 3300025907 | Bacteria | 2652 |
| 117 | Ga0207705_10000154 | 3300025909 | Bacteria | 73880 |
| 118 | Ga0207695_10015208 | 3300025913 | Bacteria | 9075 |
| 119 | Ga0207671_10009010 | 3300025914 | Bacteria | 8393 |
| 120 | Ga0207671_10010992 | 3300025914 | Bacteria | 7412 |
| 121 | Ga0207657_10009444 | 3300025919 | Bacteria | 9798 |
| 122 | Ga0207649_10000749 | 3300025920 | Bacteria | 21220 |
| 123 | Ga0207649_10054606 | 3300025920 | Bacteria | 2487 |
| 124 | Ga0207652_10182361 | 3300025921 | Bacteria | 1887 |
| 125 | Ga0207694_10001580 | 3300025924 | Bacteria | 19295 |
| 126 | Ga0207694_10003792 | 3300025924 | Bacteria | 11961 |
| 127 | Ga0207694_10015221 | 3300025924 | Bacteria | 5801 |
| 128 | Ga0207687_10000415 | 3300025927 | Bacteria | 28949 |
| 129 | Ga0207690_10000325 | 3300025932 | Bacteria | 31915 |
| 130 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 131 | Ga0207709_10445662 | 3300025935 | Bacteria | 1000 |
| 132 | Ga0207669_10001439 | 3300025937 | Bacteria | 10150 |
| 133 | Ga0207669_10036879 | 3300025937 | Bacteria | 2798 |
| 134 | Ga0207711_10016370 | 3300025941 | Bacteria | 6163 |
| 135 | Ga0207711_10052855 | 3300025941 | Bacteria | 3483 |
| 136 | Ga0207679_10040186 | 3300025945 | Bacteria | 3346 |
| 137 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 138 | Ga0207640_10005991 | 3300025981 | Bacteria | 6644 |
| 139 | Ga0207640_10014164 | 3300025981 | Bacteria | 4584 |
| 140 | Ga0207703_10000611 | 3300026035 | Bacteria | 36227 |
| 141 | Ga0207703_10001110 | 3300026035 | Bacteria | 25489 |
| 142 | Ga0207639_10008353 | 3300026041 | Bacteria | 7097 |
| 143 | Ga0207639_10009690 | 3300026041 | Bacteria | 6653 |
| 144 | Ga0207678_10007422 | 3300026067 | Bacteria | 9710 |
| 145 | Ga0207702_10003659 | 3300026078 | Bacteria | 13925 |
| 146 | Ga0207648_10198968 | 3300026089 | Bacteria | 1777 |
| 147 | Ga0207676_10000730 | 3300026095 | Bacteria | 25739 |
| 148 | Ga0207674_10016045 | 3300026116 | Bacteria | 8205 |
| 149 | Ga0207675_100002491 | 3300026118 | Bacteria | 18232 |
| 150 | Ga0207683_10006531 | 3300026121 | Bacteria | 9983 |
| 151 | Ga0207698_10003762 | 3300026142 | Bacteria | 9171 |
| 152 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 153 | Ga0268266_10019801 | 3300028379 | Bacteria | 5735 |
| 154 | Ga0307517_10017144 | 3300028786 | Bacteria | 9461 |
| 155 | Ga0307517_10022435 | 3300028786 | Bacteria | 7912 |
| 156 | Ga0307513_10029351 | 3300031456 | Bacteria | 6273 |
| 157 | Ga0307513_10185454 | 3300031456 | Bacteria | 1938 |
| 158 | Ga0307509_10034522 | 3300031507 | Bacteria | 5558 |
| 159 | Ga0307508_10001326 | 3300031616 | Bacteria | 28003 |
| 160 | Ga0307412_10005010 | 3300031911 | Bacteria | 7405 |
| 161 | Ga0307412_10016781 | 3300031911 | Bacteria | 4370 |
| 162 | Ga0307510_10000081 | 3300033180 | Bacteria | 72540 |
| 163 | Ga0395901_0069063 | 3300038443 | Bacteria | 3680 |
| 164 | Ga0436363_0614164 | 3300039450 | Bacteria | 2124 |
| 165 | Ga0439461_0008102 | 3300041410 | Bacteria | 1877 |
| 166 | Ga0439465_0000768 | 3300041413 | Bacteria | 9975 |
| 167 | Ga0439431_0000153 | 3300041997 | Bacteria | 12648 |
| 168 | Ga0439445_0007616 | 3300042004 | Bacteria | 2517 |
| 169 | Ga0439452_019700 | 3300042010 | Bacteria | 1780 |
| 170 | Ga0439452_021753 | 3300042010 | Bacteria | 1667 |
| 171 | Ga0439462_0000068 | 3300042015 | Bacteria | 15535 |
| 172 | Ga0439462_0002189 | 3300042015 | Bacteria | 4506 |
| 173 | Ga0439434_0003739 | 3300042435 | Bacteria | 4443 |
| 174 | Ga0439434_0003908 | 3300042435 | Bacteria | 4351 |
| 175 | Ga0495638_0000048 | 3300046460 | Bacteria | 209787 |
| 176 | Ga0495650_0000096 | 3300046471 | Bacteria | 217464 |
| 177 | Ga0495584_0015943 | 3300046491 | Bacteria | 3834 |
| 178 | Ga0495584_0065236 | 3300046491 | Bacteria | 1831 |
| 179 | Ga0495585_0013234 | 3300046492 | Bacteria | 4833 |
| 180 | Ga0495585_0026458 | 3300046492 | Bacteria | 3313 |
| 181 | Ga0495596_0008702 | 3300046500 | Bacteria | 4499 |
| 182 | Ga0495583_0000897 | 3300046506 | Bacteria | 35572 |
| 183 | Ga0495583_0004543 | 3300046506 | Bacteria | 9870 |
| 184 | Ga0495583_0018653 | 3300046506 | Bacteria | 3647 |
| 185 | Ga0495583_0026657 | 3300046506 | Bacteria | 2860 |
| 186 | Ga0495606_0000668 | 3300046507 | Bacteria | 53635 |
| 187 | Ga0495606_0039207 | 3300046507 | Bacteria | 3196 |
| 188 | Ga0495606_0138685 | 3300046507 | Bacteria | 1438 |
| 189 | Ga0495631_0002628 | 3300046518 | Bacteria | 10030 |
| 190 | Ga0495643_0006530 | 3300046522 | Bacteria | 7671 |
| 191 | Ga0495643_0011891 | 3300046522 | Bacteria | 5271 |
| 192 | Ga0495648_0000065 | 3300046524 | Bacteria | 145024 |
| 193 | Ga0495648_0016914 | 3300046524 | Bacteria | 5240 |
| 194 | Ga0495648_0035740 | 3300046524 | Bacteria | 3217 |
| 195 | Ga0495648_0066166 | 3300046524 | Bacteria | 2120 |
| 196 | Ga0495663_0004173 | 3300046525 | Bacteria | 4083 |
| 197 | Ga0495663_0004522 | 3300046525 | Bacteria | 3904 |
| 198 | Ga0495642_0006834 | 3300046528 | Bacteria | 4375 |
| 199 | Ga0495633_0000634 | 3300046558 | Bacteria | 32773 |
| 200 | Ga0495668_0000022 | 3300046616 | Bacteria | 363999 |
| 201 | Ga0495611_0064276 | 3300046648 | Bacteria | 1671 |
| 202 | Ga0495625_0000212 | 3300046660 | Bacteria | 91883 |
| 203 | Ga0495625_0000860 | 3300046660 | Bacteria | 41288 |
| 204 | Ga0495625_0009022 | 3300046660 | Bacteria | 8421 |
| 205 | Ga0495625_0034603 | 3300046660 | Bacteria | 3727 |
| 206 | Ga0495625_0048327 | 3300046660 | Bacteria | 3065 |
| 207 | Ga0495625_0055793 | 3300046660 | Bacteria | 2816 |
| 208 | Ga0495661_0033545 | 3300046665 | Bacteria | 3238 |
| 209 | Ga0495669_0000069 | 3300046684 | Bacteria | 68241 |
| 210 | Ga0495613_0212326 | 3300046689 | Bacteria | 1361 |
| 211 | Ga0495670_0000010 | 3300046691 | Bacteria | 174071 |
| 212 | Ga0495670_0014426 | 3300046691 | Bacteria | 3885 |
| 213 | Ga0495670_0017878 | 3300046691 | Bacteria | 3492 |
| 214 | Ga0495670_0097168 | 3300046691 | Bacteria | 1513 |
| 215 | Ga0495649_0045543 | 3300046694 | Bacteria | 2391 |
| 216 | Ga0495649_0088581 | 3300046694 | Bacteria | 1651 |
| 217 | Ga0495649_0123509 | 3300046694 | Bacteria | 1368 |
| 218 | Ga0495600_0006079 | 3300046809 | Bacteria | 7315 |
| 219 | Ga0495683_0005840 | 3300047323 | Bacteria | 6771 |
| 220 | Ga0495687_006732 | 3300047443 | Bacteria | 6959 |
| 221 | Ga0495687_007036 | 3300047443 | Bacteria | 6738 |
| 222 | Ga0495677_0000976 | 3300047445 | Bacteria | 11512 |
| 223 | Ga0495677_0013067 | 3300047445 | Bacteria | 3021 |
| 224 | Ga0495686_0000238 | 3300047472 | Bacteria | 99919 |
| 225 | Ga0495686_0011471 | 3300047472 | Bacteria | 6240 |
| 226 | Ga0495686_0017863 | 3300047472 | Bacteria | 4770 |
| 227 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 228 | Ga0496103_0000671 | 3300048906 | Bacteria | 25726 |
| 229 | Ga0496104_0000924 | 3300048907 | Bacteria | 25198 |
| 230 | Ga0496105_0013617 | 3300048908 | Bacteria | 6457 |
| 231 | Ga0496110_0007701 | 3300048913 | Bacteria | 8619 |
| 232 | Ga0496111_0034002 | 3300048914 | Bacteria | 3638 |
| 233 | Ga0496114_0002319 | 3300048917 | Bacteria | 14497 |
| 234 | Ga0496115_0000651 | 3300048918 | Bacteria | 25969 |
| 235 | Ga0496115_0000906 | 3300048918 | Bacteria | 21502 |
| 236 | Ga0496116_0013768 | 3300048919 | Bacteria | 6500 |
| 237 | Ga0496117_0000046 | 3300048920 | Bacteria | 300879 |
| 238 | Ga0496118_0000036 | 3300048921 | Bacteria | 318213 |
| 239 | Ga0496119_0014304 | 3300048922 | Bacteria | 6225 |
| 240 | Ga0496120_0007522 | 3300048923 | Bacteria | 8087 |
| 241 | Ga0496121_0000702 | 3300048924 | Bacteria | 62249 |
| 242 | Ga0496121_0001202 | 3300048924 | Bacteria | 45329 |
| 243 | Ga0496122_0015295 | 3300048925 | Bacteria | 7342 |
| 244 | Ga0496122_0022431 | 3300048925 | Bacteria | 5613 |
| 245 | Ga0496123_0013558 | 3300048926 | Bacteria | 6826 |
| 246 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 247 | Ga0496124_0000648 | 3300048927 | Bacteria | 57426 |
| 248 | Ga0496124_0007657 | 3300048927 | Bacteria | 11424 |
| 249 | Ga0496124_0022568 | 3300048927 | Bacteria | 5765 |
| 250 | Ga0496125_0000309 | 3300048928 | Bacteria | 96047 |
| 251 | Ga0496126_0000771 | 3300048929 | Bacteria | 57837 |
| 252 | Ga0496126_0031373 | 3300048929 | Bacteria | 5023 |
| 253 | Ga0501047_0280134 | 3300049581 | Bacteria | 1512 |
| 254 | Ga0501071_0120216 | 3300049587 | Bacteria | 1947 |
| 255 | Ga0501241_005024 | 3300049758 | Bacteria | 2472 |
| 256 | Ga0500610_0117763 | 3300053079 | Bacteria | 1360 |
| 257 | Ga0500643_001540 | 3300053087 | Bacteria | 13078 |
| 258 | Ga0500643_004413 | 3300053087 | Bacteria | 6375 |
| 259 | Ga0500566_0001217 | 3300053094 | Bacteria | 15061 |
| 260 | Ga0500641_0003308 | 3300053096 | Bacteria | 5703 |
| 261 | Ga0500641_0028358 | 3300053096 | Bacteria | 2186 |
| 262 | Ga0500595_004864 | 3300053119 | Bacteria | 5945 |
| 263 | Ga0500607_132033 | 3300053121 | Bacteria | 1189 |
| 264 | Ga0500642_0003270 | 3300053130 | Bacteria | 4875 |
| 265 | Ga0500658_0008794 | 3300053134 | Bacteria | 3727 |
| 266 | Ga0500658_0010897 | 3300053134 | Bacteria | 3354 |
| 267 | Ga0500559_0045423 | 3300053136 | Bacteria | 1923 |
| 268 | Ga0500559_0052163 | 3300053136 | Bacteria | 1807 |
| 269 | Ga0500568_0003373 | 3300053139 | Bacteria | 8928 |
| 270 | Ga0500568_0017801 | 3300053139 | Bacteria | 3127 |
| 271 | Ga0500573_0000093 | 3300053140 | Bacteria | 40260 |
| 272 | Ga0500577_0015329 | 3300053142 | Bacteria | 2392 |
| 273 | Ga0500619_007678 | 3300053154 | Bacteria | 2571 |
| 274 | Ga0500627_0055237 | 3300053158 | Bacteria | 1738 |
| 275 | Ga0500636_0001530 | 3300053177 | Bacteria | 12586 |
| 276 | Ga0500645_000113 | 3300053730 | Bacteria | 64693 |
| 277 | Ga0500645_001293 | 3300053730 | Bacteria | 13036 |
| 278 | Ga0500596_000925 | 3300053735 | Bacteria | 5865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047445 | Ga0495677_0013067 | Ga0495677_0013067_2240_3010 | 243 |
| 2 | 3300031507 | Ga0307509_10034522 | Ga0307509_100345229 | 277 |
| 3 | 3300005842 | Ga0068858_100011445 | Ga0068858_1000114451 | 278 |
| 4 | 3300009148 | Ga0105243_10470680 | Ga0105243_104706801 | 278 |
| 5 | 3300013296 | Ga0157374_10097681 | Ga0157374_100976812 | 278 |
| 6 | 3300025927 | Ga0207687_10000415 | Ga0207687_1000041519 | 278 |
| 7 | 3300025935 | Ga0207709_10445662 | Ga0207709_104456621 | 278 |
| 8 | 3300026035 | Ga0207703_10001110 | Ga0207703_1000111022 | 278 |
| 9 | 3300046492 | Ga0495585_0026458 | Ga0495585_0026458_1956_2915 | 278 |
| 10 | 3300031616 | Ga0307508_10001326 | Ga0307508_1000132613 | 281 |
| 11 | iso_pu_bacteria | 2830075706 | 2830078515 | 285 |
| 12 | 3300026089 | Ga0207648_10198968 | Ga0207648_101989682 | 289 |
| 13 | 3300053142 | Ga0500577_0015329 | Ga0500577_0015329_1192_2082 | 294 |
| 14 | iso_pu_bacteria | 2984564862 | 2984568717 | 294 |
| 15 | 3300046460 | Ga0495638_0000048 | Ga0495638_0000048_168003_168983 | 297 |
| 16 | 3300046507 | Ga0495606_0138685 | Ga0495606_0138685_148_1089 | 297 |
| 17 | 3300046525 | Ga0495663_0004173 | Ga0495663_0004173_1090_2070 | 297 |
| 18 | 3300046660 | Ga0495625_0000860 | Ga0495625_0000860_9253_10194 | 297 |
| 19 | 3300053134 | Ga0500658_0010897 | Ga0500658_0010897_1527_2507 | 297 |
| 20 | iso_pu_bacteria | 2885429604 | 2885432613 | 298 |
| 21 | iso_pu_bacteria | 2990265787 | 2990265815 | 298 |
| 22 | 3300005288 | Ga0065714_10098881 | Ga0065714_100988811 | 299 |
| 23 | iso_pu_bacteria | 2928027323 | 2928029460 | 299 |
| 24 | iso_pu_bacteria | 2984555340 | 2984556976 | 299 |
| 25 | iso_pu_bacteria | 2993356040 | 2993359708 | 299 |
| 26 | iso_pu_bacteria | 8057101203 | 8057101505 | 299 |
| 27 | 3300046691 | Ga0495670_0097168 | Ga0495670_0097168_49_990 | 300 |
| 28 | 3300047472 | Ga0495686_0017863 | Ga0495686_0017863_485_1456 | 300 |
| 29 | 3300053096 | Ga0500641_0028358 | Ga0500641_0028358_1071_2012 | 300 |
| 30 | 3300053139 | Ga0500568_0017801 | Ga0500568_0017801_628_1569 | 300 |
| 31 | 3300005539 | Ga0068853_100023688 | Ga0068853_1000236887 | 301 |
| 32 | 3300026041 | Ga0207639_10008353 | Ga0207639_100083533 | 301 |
| 33 | iso_pu_bacteria | 2599185354 | 2600201918 | 301 |
| 34 | iso_pu_bacteria | 2751185897 | 2753766667 | 301 |
| 35 | iso_pu_bacteria | 2879163058 | 2879164323 | 301 |
| 36 | iso_pu_bacteria | 2928526807 | 2928531132 | 301 |
| 37 | iso_pu_bacteria | 2928968154 | 2928972309 | 301 |
| 38 | 3300046524 | Ga0495648_0016914 | Ga0495648_0016914_2685_3617 | 302 |
| 39 | 3300003791 | Ga0055530_10007007 | Ga0055530_100070072 | 303 |
| 40 | 3300003792 | Ga0055540_1000427 | Ga0055540_100042725 | 303 |
| 41 | 3300003792 | Ga0055540_1001864 | Ga0055540_100186411 | 303 |
| 42 | 3300003794 | Ga0055531_10017161 | Ga0055531_100171613 | 303 |
| 43 | 3300005617 | Ga0068859_100000913 | Ga0068859_10000091333 | 303 |
| 44 | 3300005719 | Ga0068861_100000882 | Ga0068861_10000088215 | 303 |
| 45 | 3300006931 | Ga0097620_100000913 | Ga0097620_10000091333 | 303 |
| 46 | 3300009177 | Ga0105248_10000558 | Ga0105248_1000055813 | 303 |
| 47 | 3300025292 | Ga0209676_1001255 | Ga0209676_100125523 | 303 |
| 48 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001227 | 303 |
| 49 | 3300025298 | Ga0209050_1000350 | Ga0209050_100035033 | 303 |
| 50 | 3300025303 | Ga0209051_1000919 | Ga0209051_100091932 | 303 |
| 51 | 3300025304 | Ga0209257_1001366 | Ga0209257_100136624 | 303 |
| 52 | 3300025941 | Ga0207711_10016370 | Ga0207711_100163707 | 303 |
| 53 | 3300026118 | Ga0207675_100002491 | Ga0207675_1000024917 | 303 |
| 54 | 3300039450 | Ga0436363_0614164 | Ga0436363_0614164_369_1346 | 303 |
| 55 | iso_pu_bacteria | 2946787523 | 2946790192 | 303 |
| 56 | 3300013102 | Ga0157371_10065560 | Ga0157371_100655602 | 304 |
| 57 | 3300013105 | Ga0157369_10362428 | Ga0157369_103624282 | 304 |
| 58 | 3300028786 | Ga0307517_10022435 | Ga0307517_100224352 | 304 |
| 59 | 3300047472 | Ga0495686_0000238 | Ga0495686_0000238_30127_31071 | 304 |
| 60 | 3300053096 | Ga0500641_0003308 | Ga0500641_0003308_2646_3593 | 304 |
| 61 | iso_pu_bacteria | 2599185359 | 2600228077 | 304 |
| 62 | iso_pu_bacteria | 2643221622 | 2644127692 | 304 |
| 63 | iso_pu_bacteria | 2818991466 | 2819715118 | 304 |
| 64 | 3300001915 | JGI24741J21665_1002914 | JGI24741J21665_10029142 | 305 |
| 65 | 3300001979 | JGI24740J21852_10007533 | JGI24740J21852_100075333 | 305 |
| 66 | 3300001990 | JGI24737J22298_10001740 | JGI24737J22298_100017406 | 305 |
| 67 | 3300003214 | JGI25165J46597_1000065 | JGI25165J46597_1000065112 | 305 |
| 68 | 3300003215 | JGI25153J46596_10000097 | JGI25153J46596_1000009713 | 305 |
| 69 | 3300003322 | rootL2_10220847 | rootL2_102208471 | 305 |
| 70 | 3300003759 | Ga0055525_1000086 | Ga0055525_1000086105 | 305 |
| 71 | 3300005262 | Ga0065165_1003798 | Ga0065165_10037982 | 305 |
| 72 | 3300005262 | Ga0065165_1045945 | Ga0065165_10459452 | 305 |
| 73 | 3300005327 | Ga0070658_10009301 | Ga0070658_100093012 | 305 |
| 74 | 3300005328 | Ga0070676_10075396 | Ga0070676_100753962 | 305 |
| 75 | 3300005344 | Ga0070661_100003101 | Ga0070661_1000031012 | 305 |
| 76 | 3300005344 | Ga0070661_100074162 | Ga0070661_1000741622 | 305 |
| 77 | 3300005354 | Ga0070675_100018052 | Ga0070675_1000180522 | 305 |
| 78 | 3300005356 | Ga0070674_100053493 | Ga0070674_1000534932 | 305 |
| 79 | 3300005366 | Ga0070659_100365270 | Ga0070659_1003652701 | 305 |
| 80 | 3300005455 | Ga0070663_100259704 | Ga0070663_1002597042 | 305 |
| 81 | 3300005456 | Ga0070678_100028265 | Ga0070678_1000282653 | 305 |
| 82 | 3300005459 | Ga0068867_100140622 | Ga0068867_1001406222 | 305 |
| 83 | 3300005530 | Ga0070679_100210330 | Ga0070679_1002103301 | 305 |
| 84 | 3300005539 | Ga0068853_100137452 | Ga0068853_1001374522 | 305 |
| 85 | 3300005548 | Ga0070665_100000043 | Ga0070665_1000000433 | 305 |
| 86 | 3300005548 | Ga0070665_100066541 | Ga0070665_1000665412 | 305 |
| 87 | 3300005548 | Ga0070665_100170391 | Ga0070665_1001703912 | 305 |
| 88 | 3300005564 | Ga0070664_100033839 | Ga0070664_1000338393 | 305 |
| 89 | 3300005618 | Ga0068864_100003105 | Ga0068864_10000310513 | 305 |
| 90 | 3300005842 | Ga0068858_100083832 | Ga0068858_1000838323 | 305 |
| 91 | 3300009174 | Ga0105241_10037202 | Ga0105241_100372023 | 305 |
| 92 | 3300009177 | Ga0105248_10090211 | Ga0105248_100902113 | 305 |
| 93 | 3300009551 | Ga0105238_10027753 | Ga0105238_100277537 | 305 |
| 94 | 3300013100 | Ga0157373_10071438 | Ga0157373_100714382 | 305 |
| 95 | 3300013102 | Ga0157371_10000011 | Ga0157371_10000011234 | 305 |
| 96 | 3300013104 | Ga0157370_10280033 | Ga0157370_102800331 | 305 |
| 97 | 3300013296 | Ga0157374_10110952 | Ga0157374_101109522 | 305 |
| 98 | 3300013297 | Ga0157378_10257230 | Ga0157378_102572303 | 305 |
| 99 | 3300013306 | Ga0163162_10024549 | Ga0163162_100245492 | 305 |
| 100 | 3300013307 | Ga0157372_10083501 | Ga0157372_100835013 | 305 |
| 101 | 3300020082 | Ga0206353_11826136 | Ga0206353_118261362 | 305 |
| 102 | 3300025230 | Ga0209563_100024 | Ga0209563_100024185 | 305 |
| 103 | 3300025261 | Ga0209233_1000107 | Ga0209233_100010797 | 305 |
| 104 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007456 | 305 |
| 105 | 3300025315 | Ga0207697_10005019 | Ga0207697_100050194 | 305 |
| 106 | 3300025321 | Ga0207656_10009045 | Ga0207656_100090453 | 305 |
| 107 | 3300025901 | Ga0207688_10049194 | Ga0207688_100491942 | 305 |
| 108 | 3300025904 | Ga0207647_10048486 | Ga0207647_100484862 | 305 |
| 109 | 3300025907 | Ga0207645_10050657 | Ga0207645_100506572 | 305 |
| 110 | 3300025909 | Ga0207705_10000154 | Ga0207705_1000015467 | 305 |
| 111 | 3300025913 | Ga0207695_10015208 | Ga0207695_100152087 | 305 |
| 112 | 3300025914 | Ga0207671_10010992 | Ga0207671_100109925 | 305 |
| 113 | 3300025919 | Ga0207657_10009444 | Ga0207657_100094444 | 305 |
| 114 | 3300025920 | Ga0207649_10000749 | Ga0207649_1000074917 | 305 |
| 115 | 3300025920 | Ga0207649_10054606 | Ga0207649_100546062 | 305 |
| 116 | 3300025921 | Ga0207652_10182361 | Ga0207652_101823613 | 305 |
| 117 | 3300025924 | Ga0207694_10001580 | Ga0207694_100015803 | 305 |
| 118 | 3300025924 | Ga0207694_10003792 | Ga0207694_100037922 | 305 |
| 119 | 3300025924 | Ga0207694_10015221 | Ga0207694_100152216 | 305 |
| 120 | 3300025932 | Ga0207690_10000325 | Ga0207690_1000032525 | 305 |
| 121 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005123 | 305 |
| 122 | 3300025937 | Ga0207669_10001439 | Ga0207669_100014398 | 305 |
| 123 | 3300025937 | Ga0207669_10036879 | Ga0207669_100368792 | 305 |
| 124 | 3300025941 | Ga0207711_10052855 | Ga0207711_100528554 | 305 |
| 125 | 3300025945 | Ga0207679_10040186 | Ga0207679_100401863 | 305 |
| 126 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001690 | 305 |
| 127 | 3300025981 | Ga0207640_10005991 | Ga0207640_100059916 | 305 |
| 128 | 3300026035 | Ga0207703_10000611 | Ga0207703_100006113 | 305 |
| 129 | 3300026041 | Ga0207639_10009690 | Ga0207639_100096903 | 305 |
| 130 | 3300026067 | Ga0207678_10007422 | Ga0207678_100074228 | 305 |
| 131 | 3300026078 | Ga0207702_10003659 | Ga0207702_100036594 | 305 |
| 132 | 3300026095 | Ga0207676_10000730 | Ga0207676_1000073011 | 305 |
| 133 | 3300026116 | Ga0207674_10016045 | Ga0207674_100160456 | 305 |
| 134 | 3300026121 | Ga0207683_10006531 | Ga0207683_100065312 | 305 |
| 135 | 3300026142 | Ga0207698_10003762 | Ga0207698_100037623 | 305 |
| 136 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002584 | 305 |
| 137 | 3300028379 | Ga0268266_10019801 | Ga0268266_100198014 | 305 |
| 138 | 3300028786 | Ga0307517_10017144 | Ga0307517_100171443 | 305 |
| 139 | 3300031456 | Ga0307513_10029351 | Ga0307513_100293513 | 305 |
| 140 | 3300031456 | Ga0307513_10185454 | Ga0307513_101854542 | 305 |
| 141 | 3300031911 | Ga0307412_10016781 | Ga0307412_100167812 | 305 |
| 142 | 3300033180 | Ga0307510_10000081 | Ga0307510_1000008149 | 305 |
| 143 | 3300038443 | Ga0395901_0069063 | Ga0395901_0069063_2188_3135 | 305 |
| 144 | 3300041410 | Ga0439461_0008102 | Ga0439461_0008102_529_1446 | 305 |
| 145 | 3300042004 | Ga0439445_0007616 | Ga0439445_0007616_639_1556 | 305 |
| 146 | 3300042010 | Ga0439452_019700 | Ga0439452_019700_403_1320 | 305 |
| 147 | 3300042015 | Ga0439462_0002189 | Ga0439462_0002189_3452_4369 | 305 |
| 148 | 3300042435 | Ga0439434_0003908 | Ga0439434_0003908_3243_4160 | 305 |
| 149 | 3300046471 | Ga0495650_0000096 | Ga0495650_0000096_6283_7233 | 305 |
| 150 | 3300046491 | Ga0495584_0015943 | Ga0495584_0015943_1174_2133 | 305 |
| 151 | 3300046491 | Ga0495584_0065236 | Ga0495584_0065236_432_1382 | 305 |
| 152 | 3300046492 | Ga0495585_0013234 | Ga0495585_0013234_2607_3557 | 305 |
| 153 | 3300046506 | Ga0495583_0000897 | Ga0495583_0000897_32606_33556 | 305 |
| 154 | 3300046506 | Ga0495583_0004543 | Ga0495583_0004543_4359_5315 | 305 |
| 155 | 3300046506 | Ga0495583_0026657 | Ga0495583_0026657_43_1002 | 305 |
| 156 | 3300046507 | Ga0495606_0000668 | Ga0495606_0000668_1226_2176 | 305 |
| 157 | 3300046507 | Ga0495606_0039207 | Ga0495606_0039207_1139_2098 | 305 |
| 158 | 3300046518 | Ga0495631_0002628 | Ga0495631_0002628_1122_2081 | 305 |
| 159 | 3300046522 | Ga0495643_0006530 | Ga0495643_0006530_2778_3728 | 305 |
| 160 | 3300046522 | Ga0495643_0011891 | Ga0495643_0011891_1152_2102 | 305 |
| 161 | 3300046524 | Ga0495648_0035740 | Ga0495648_0035740_683_1639 | 305 |
| 162 | 3300046524 | Ga0495648_0066166 | Ga0495648_0066166_1056_2006 | 305 |
| 163 | 3300046528 | Ga0495642_0006834 | Ga0495642_0006834_625_1575 | 305 |
| 164 | 3300046616 | Ga0495668_0000022 | Ga0495668_0000022_291529_292488 | 305 |
| 165 | 3300046648 | Ga0495611_0064276 | Ga0495611_0064276_378_1328 | 305 |
| 166 | 3300046660 | Ga0495625_0000212 | Ga0495625_0000212_28754_29704 | 305 |
| 167 | 3300046660 | Ga0495625_0009022 | Ga0495625_0009022_3379_4335 | 305 |
| 168 | 3300046660 | Ga0495625_0034603 | Ga0495625_0034603_1107_2066 | 305 |
| 169 | 3300046665 | Ga0495661_0033545 | Ga0495661_0033545_742_1692 | 305 |
| 170 | 3300046684 | Ga0495669_0000069 | Ga0495669_0000069_58204_59163 | 305 |
| 171 | 3300046689 | Ga0495613_0212326 | Ga0495613_0212326_16_966 | 305 |
| 172 | 3300046691 | Ga0495670_0017878 | Ga0495670_0017878_1905_2858 | 305 |
| 173 | 3300046694 | Ga0495649_0045543 | Ga0495649_0045543_296_1255 | 305 |
| 174 | 3300046694 | Ga0495649_0123509 | Ga0495649_0123509_65_1015 | 305 |
| 175 | 3300046809 | Ga0495600_0006079 | Ga0495600_0006079_6183_7133 | 305 |
| 176 | 3300047323 | Ga0495683_0005840 | Ga0495683_0005840_2704_3663 | 305 |
| 177 | 3300047443 | Ga0495687_006732 | Ga0495687_006732_1199_2149 | 305 |
| 178 | 3300047443 | Ga0495687_007036 | Ga0495687_007036_1222_2181 | 305 |
| 179 | 3300047445 | Ga0495677_0000976 | Ga0495677_0000976_2847_3797 | 305 |
| 180 | 3300049587 | Ga0501071_0120216 | Ga0501071_0120216_949_1896 | 305 |
| 181 | 3300049758 | Ga0501241_005024 | Ga0501241_005024_1311_2228 | 305 |
| 182 | 3300053079 | Ga0500610_0117763 | Ga0500610_0117763_210_1169 | 305 |
| 183 | 3300053087 | Ga0500643_001540 | Ga0500643_001540_10944_11900 | 305 |
| 184 | 3300053094 | Ga0500566_0001217 | Ga0500566_0001217_13193_14110 | 305 |
| 185 | 3300053119 | Ga0500595_004864 | Ga0500595_004864_1510_2460 | 305 |
| 186 | 3300053121 | Ga0500607_132033 | Ga0500607_132033_23_973 | 305 |
| 187 | 3300053136 | Ga0500559_0052163 | Ga0500559_0052163_393_1364 | 305 |
| 188 | 3300053154 | Ga0500619_007678 | Ga0500619_007678_204_1154 | 305 |
| 189 | 3300053177 | Ga0500636_0001530 | Ga0500636_0001530_10072_11022 | 305 |
| 190 | 3300053730 | Ga0500645_000113 | Ga0500645_000113_4151_5110 | 305 |
| 191 | 3300053735 | Ga0500596_000925 | Ga0500596_000925_4394_5344 | 305 |
| 192 | 3300002774 | JGI25150J39212_1000282 | JGI25150J39212_100028224 | 306 |
| 193 | 3300003215 | JGI25153J46596_10000032 | JGI25153J46596_10000032147 | 306 |
| 194 | 3300003771 | Ga0055526_1010403 | Ga0055526_10104033 | 306 |
| 195 | 3300003791 | Ga0055530_10018169 | Ga0055530_100181693 | 306 |
| 196 | 3300003794 | Ga0055531_10017158 | Ga0055531_100171583 | 306 |
| 197 | 3300005262 | Ga0065165_1026972 | Ga0065165_10269721 | 306 |
| 198 | 3300025245 | Ga0207425_1000025 | Ga0207425_1000025231 | 306 |
| 199 | 3300025258 | Ga0209129_1000916 | Ga0209129_100091615 | 306 |
| 200 | 3300025263 | Ga0209565_1000044 | Ga0209565_1000044179 | 306 |
| 201 | 3300025263 | Ga0209565_1016133 | Ga0209565_10161332 | 306 |
| 202 | 3300025273 | Ga0209673_1024365 | Ga0209673_10243653 | 306 |
| 203 | 3300025292 | Ga0209676_1007560 | Ga0209676_10075606 | 306 |
| 204 | 3300025295 | Ga0209564_1000886 | Ga0209564_100088640 | 306 |
| 205 | 3300025295 | Ga0209564_1009736 | Ga0209564_10097362 | 306 |
| 206 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002315 | 306 |
| 207 | 3300025298 | Ga0209050_1009648 | Ga0209050_10096482 | 306 |
| 208 | 3300025298 | Ga0209050_1022425 | Ga0209050_10224252 | 306 |
| 209 | 3300025302 | Ga0207426_1015708 | Ga0207426_10157083 | 306 |
| 210 | 3300025304 | Ga0209257_1001406 | Ga0209257_100140629 | 306 |
| 211 | 3300048918 | Ga0496115_0000906 | Ga0496115_0000906_14159_15103 | 306 |
| 212 | 3300025294 | Ga0209025_1000176 | Ga0209025_100017612 | 307 |
| 213 | 3300053140 | Ga0500573_0000093 | Ga0500573_0000093_12386_13342 | 307 |
| 214 | 3300000041 | ARcpr5oldR_c004719 | ARcpr5oldR_0047192 | 308 |
| 215 | 3300003215 | JGI25153J46596_10006076 | JGI25153J46596_100060762 | 308 |
| 216 | 3300003762 | Ga0055542_1000041 | Ga0055542_1000041151 | 308 |
| 217 | 3300003763 | Ga0055529_1000040 | Ga0055529_1000040176 | 308 |
| 218 | 3300003775 | Ga0055524_1000133 | Ga0055524_100013361 | 308 |
| 219 | 3300003791 | Ga0055530_10000114 | Ga0055530_1000011451 | 308 |
| 220 | 3300003791 | Ga0055530_10010211 | Ga0055530_100102112 | 308 |
| 221 | 3300003794 | Ga0055531_10000095 | Ga0055531_1000009523 | 308 |
| 222 | 3300003794 | Ga0055531_10004220 | Ga0055531_100042203 | 308 |
| 223 | 3300005262 | Ga0065165_1002993 | Ga0065165_10029933 | 308 |
| 224 | 3300005262 | Ga0065165_1014431 | Ga0065165_10144313 | 308 |
| 225 | 3300005577 | Ga0068857_100025968 | Ga0068857_1000259682 | 308 |
| 226 | 3300009148 | Ga0105243_10000308 | Ga0105243_1000030847 | 308 |
| 227 | 3300009545 | Ga0105237_10053828 | Ga0105237_100538282 | 308 |
| 228 | 3300015690 | Ga0183363_1007 | Ga0183363_1007218 | 308 |
| 229 | 3300017792 | Ga0163161_10060666 | Ga0163161_100606661 | 308 |
| 230 | 3300025245 | Ga0207425_1005298 | Ga0207425_10052982 | 308 |
| 231 | 3300025250 | Ga0209026_1009464 | Ga0209026_10094642 | 308 |
| 232 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008142 | 308 |
| 233 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007681 | 308 |
| 234 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021283 | 308 |
| 235 | 3300025273 | Ga0209673_1001675 | Ga0209673_10016753 | 308 |
| 236 | 3300025291 | Ga0209675_1014694 | Ga0209675_10146942 | 308 |
| 237 | 3300025297 | Ga0209758_1001400 | Ga0209758_100140030 | 308 |
| 238 | 3300025298 | Ga0209050_1000051 | Ga0209050_100005123 | 308 |
| 239 | 3300025298 | Ga0209050_1005851 | Ga0209050_10058513 | 308 |
| 240 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008523 | 308 |
| 241 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028345 | 308 |
| 242 | 3300025304 | Ga0209257_1001709 | Ga0209257_100170913 | 308 |
| 243 | 3300025304 | Ga0209257_1012638 | Ga0209257_10126383 | 308 |
| 244 | 3300025914 | Ga0207671_10009010 | Ga0207671_100090102 | 308 |
| 245 | 3300025981 | Ga0207640_10014164 | Ga0207640_100141643 | 308 |
| 246 | 3300031911 | Ga0307412_10005010 | Ga0307412_100050106 | 308 |
| 247 | 3300041413 | Ga0439465_0000768 | Ga0439465_0000768_1769_2695 | 308 |
| 248 | 3300041997 | Ga0439431_0000153 | Ga0439431_0000153_7168_8094 | 308 |
| 249 | 3300042010 | Ga0439452_021753 | Ga0439452_021753_701_1627 | 308 |
| 250 | 3300042015 | Ga0439462_0000068 | Ga0439462_0000068_12176_13102 | 308 |
| 251 | 3300042435 | Ga0439434_0003739 | Ga0439434_0003739_1310_2236 | 308 |
| 252 | 3300046500 | Ga0495596_0008702 | Ga0495596_0008702_2047_3129 | 308 |
| 253 | 3300046506 | Ga0495583_0018653 | Ga0495583_0018653_2193_3212 | 308 |
| 254 | 3300046524 | Ga0495648_0000065 | Ga0495648_0000065_127878_128897 | 308 |
| 255 | 3300046525 | Ga0495663_0004522 | Ga0495663_0004522_363_1382 | 308 |
| 256 | 3300046558 | Ga0495633_0000634 | Ga0495633_0000634_1371_2411 | 308 |
| 257 | 3300046660 | Ga0495625_0048327 | Ga0495625_0048327_1593_2633 | 308 |
| 258 | 3300046660 | Ga0495625_0055793 | Ga0495625_0055793_971_1924 | 308 |
| 259 | 3300046691 | Ga0495670_0000010 | Ga0495670_0000010_128427_129380 | 308 |
| 260 | 3300046691 | Ga0495670_0014426 | Ga0495670_0014426_1917_2957 | 308 |
| 261 | 3300046694 | Ga0495649_0088581 | Ga0495649_0088581_389_1441 | 308 |
| 262 | 3300047472 | Ga0495686_0011471 | Ga0495686_0011471_3257_4192 | 308 |
| 263 | 3300048905 | Ga0496102_0000022 | Ga0496102_0000022_232649_233701 | 308 |
| 264 | 3300048906 | Ga0496103_0000671 | Ga0496103_0000671_7372_8424 | 308 |
| 265 | 3300048907 | Ga0496104_0000924 | Ga0496104_0000924_6872_7924 | 308 |
| 266 | 3300048908 | Ga0496105_0013617 | Ga0496105_0013617_1362_2414 | 308 |
| 267 | 3300048913 | Ga0496110_0007701 | Ga0496110_0007701_2915_3967 | 308 |
| 268 | 3300048914 | Ga0496111_0034002 | Ga0496111_0034002_1540_2559 | 308 |
| 269 | 3300048917 | Ga0496114_0002319 | Ga0496114_0002319_9082_10134 | 308 |
| 270 | 3300048918 | Ga0496115_0000651 | Ga0496115_0000651_7617_8669 | 308 |
| 271 | 3300048919 | Ga0496116_0013768 | Ga0496116_0013768_4848_5900 | 308 |
| 272 | 3300048920 | Ga0496117_0000046 | Ga0496117_0000046_282525_283577 | 308 |
| 273 | 3300048921 | Ga0496118_0000036 | Ga0496118_0000036_17303_18355 | 308 |
| 274 | 3300048922 | Ga0496119_0014304 | Ga0496119_0014304_465_1517 | 308 |
| 275 | 3300048923 | Ga0496120_0007522 | Ga0496120_0007522_3045_4001 | 308 |
| 276 | 3300048924 | Ga0496121_0000702 | Ga0496121_0000702_48135_49187 | 308 |
| 277 | 3300048924 | Ga0496121_0001202 | Ga0496121_0001202_21546_22499 | 308 |
| 278 | 3300048925 | Ga0496122_0015295 | Ga0496122_0015295_4471_5523 | 308 |
| 279 | 3300048925 | Ga0496122_0022431 | Ga0496122_0022431_2127_3083 | 308 |
| 280 | 3300048926 | Ga0496123_0013558 | Ga0496123_0013558_3028_3984 | 308 |
| 281 | 3300048927 | Ga0496124_0000011 | Ga0496124_0000011_505791_506843 | 308 |
| 282 | 3300048927 | Ga0496124_0000648 | Ga0496124_0000648_27491_28447 | 308 |
| 283 | 3300048927 | Ga0496124_0007657 | Ga0496124_0007657_7343_8299 | 308 |
| 284 | 3300048927 | Ga0496124_0022568 | Ga0496124_0022568_546_1502 | 308 |
| 285 | 3300048928 | Ga0496125_0000309 | Ga0496125_0000309_15632_16684 | 308 |
| 286 | 3300048929 | Ga0496126_0000771 | Ga0496126_0000771_17303_18355 | 308 |
| 287 | 3300048929 | Ga0496126_0031373 | Ga0496126_0031373_1079_2035 | 308 |
| 288 | 3300049581 | Ga0501047_0280134 | Ga0501047_0280134_144_1151 | 308 |
| 289 | 3300053087 | Ga0500643_004413 | Ga0500643_004413_283_1209 | 308 |
| 290 | 3300053130 | Ga0500642_0003270 | Ga0500642_0003270_1458_2477 | 308 |
| 291 | 3300053134 | Ga0500658_0008794 | Ga0500658_0008794_2172_3098 | 308 |
| 292 | 3300053136 | Ga0500559_0045423 | Ga0500559_0045423_20_991 | 308 |
| 293 | 3300053139 | Ga0500568_0003373 | Ga0500568_0003373_1127_2053 | 308 |
| 294 | 3300053158 | Ga0500627_0055237 | Ga0500627_0055237_628_1581 | 308 |
| 295 | 3300053730 | Ga0500645_001293 | Ga0500645_001293_7732_8682 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2otn-assembly1.cif.gz_A | crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis | 0.8891 | 2 | 276 |
| 2q9h-assembly1.cif.gz_A | crystal structure of the c73s mutant of diaminopimelate epimerase | 0.8548 | 6 | 272 |
| 4ik0-assembly1.cif.gz_A | crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli | 0.8522 | 6 | 272 |
| 1gqz-assembly1.cif.gz_A | refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a | 0.8489 | 6 | 272 |
| 2q9j-assembly1.cif.gz_A | crystal structure of the c217s mutant of diaminopimelate epimerase | 0.8484 | 6 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8977 | 8 | 116 | 3.10.310.10 |
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8776 | 148 | 263 | 3.10.310.10 |
| 2otnA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8756 | 2 | 116 | 3.10.310.10 |
| af_C6T990_209_343_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8658 | 150 | 252 | 3.10.310.10 |
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8636 | 148 | 263 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y7UST4-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9865 | 4 | 305 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A2W5BG54-F1-model_v4 | deleted | 0.9792 | 4 | 225 |
|
| AF-A0A1R1YWS7-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9784 | 4 | 305 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A396RR26-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9761 | 4 | 307 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A0A6CYH3-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.9682 | 45 | 306 |
GO:0005829
GO:0008837 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar