F392618

General Info

Members Datasets Scaffolds Average Seq Length
295 200 278 317

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000308|Ga0105243_1000030847
Length 359
Sequence MRGPLFPRRQHVVRRVARQEGRHFATRWFEPRARRRYSAAMRFAFVKCHGSGNDFPMIDARAIDLPDAAWARVALALADRRGPVGGDGLLLLTAGDARHDFGFRMFNSDGSEAETCLNGLRCVARAGFEALGIDHAHVHLKTSVVEVTRDPDLAPGVVTVRELAGPASLDIAQWPMTIDRQQNVQMAIPGLPSTRPFTAVSIPNPHLIAFVDAVDEQELVAIGQLCESAPDWLPNRANVSFVETRPGGLFVRTFERGVGLTDSCGSAMAASTFAACLTERARFDTEITVWNAGGLIRACADPDGMVRLSGNATYEWEGSADVDLDRALAGEVVVTRHFNDEIAAWAKVADQAIAVPRPA

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
6 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
12 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
13 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
14 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
17 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
183 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
196 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
200 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 0.34
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 1.36
Bulb 0
Endosphere 28.14
Nodule 0
Rhizoplane 3.73
Rhizosphere 55.93
Stem 0
Stem Tuber 0
Unclassified 10.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004719 3300000041 Bacteria 1177
2 JGI24741J21665_1002914 3300001915 Bacteria 4282
3 JGI24740J21852_10007533 3300001979 Bacteria 4414
4 JGI24737J22298_10001740 3300001990 Bacteria 7772
5 JGI25150J39212_1000282 3300002774 Bacteria 26768
6 JGI25165J46597_1000065 3300003214 Bacteria 199761
7 JGI25153J46596_10000032 3300003215 Bacteria 196732
8 JGI25153J46596_10000097 3300003215 Bacteria 101627
9 JGI25153J46596_10006076 3300003215 Bacteria 6203
10 rootL2_10220847 3300003322 Bacteria 1336
11 Ga0055525_1000086 3300003759 Bacteria 150228
12 Ga0055542_1000041 3300003762 Bacteria 208892
13 Ga0055529_1000040 3300003763 Bacteria 230562
14 Ga0055526_1010403 3300003771 Bacteria 4330
15 Ga0055524_1000133 3300003775 Bacteria 87720
16 Ga0055530_10000114 3300003791 Bacteria 70700
17 Ga0055530_10007007 3300003791 Bacteria 4859
18 Ga0055530_10010211 3300003791 Bacteria 3498
19 Ga0055530_10018169 3300003791 Bacteria 2178
20 Ga0055540_1000427 3300003792 Bacteria 33646
21 Ga0055540_1001864 3300003792 Bacteria 11855
22 Ga0055531_10000095 3300003794 Bacteria 96056
23 Ga0055531_10004220 3300003794 Bacteria 8849
24 Ga0055531_10017158 3300003794 Bacteria 3072
25 Ga0055531_10017161 3300003794 Bacteria 3072
26 Ga0065165_1002993 3300005262 Bacteria 12818
27 Ga0065165_1003798 3300005262 Bacteria 10098
28 Ga0065165_1014431 3300005262 Bacteria 3067
29 Ga0065165_1026972 3300005262 Bacteria 1880
30 Ga0065165_1045945 3300005262 Bacteria 1269
31 Ga0065714_10098881 3300005288 Bacteria 1699
32 Ga0070658_10009301 3300005327 Bacteria 7904
33 Ga0070676_10075396 3300005328 Bacteria 2034
34 Ga0070661_100003101 3300005344 Bacteria 11434
35 Ga0070661_100074162 3300005344 Bacteria 2505
36 Ga0070675_100018052 3300005354 Bacteria 5615
37 Ga0070674_100053493 3300005356 Bacteria 2788
38 Ga0070659_100365270 3300005366 Bacteria 1213
39 Ga0070663_100259704 3300005455 Bacteria 1377
40 Ga0070678_100028265 3300005456 Bacteria 3822
41 Ga0068867_100140622 3300005459 Bacteria 1886
42 Ga0070679_100210330 3300005530 Bacteria 1909
43 Ga0068853_100023688 3300005539 Bacteria 5143
44 Ga0068853_100137452 3300005539 Bacteria 2191
45 Ga0070665_100000043 3300005548 Bacteria 279774
46 Ga0070665_100066541 3300005548 Bacteria 3615
47 Ga0070665_100170391 3300005548 Bacteria 2178
48 Ga0070664_100033839 3300005564 Bacteria 4284
49 Ga0068857_100025968 3300005577 Bacteria 5159
50 Ga0068859_100000913 3300005617 Bacteria 30198
51 Ga0068864_100003105 3300005618 Bacteria 13719
52 Ga0068861_100000882 3300005719 Bacteria 18211
53 Ga0068858_100011445 3300005842 Bacteria 8375
54 Ga0068858_100083832 3300005842 Bacteria 2965
55 Ga0097620_100000913 3300006931 Bacteria 30198
56 Ga0105243_10000308 3300009148 Bacteria 54026
57 Ga0105243_10470680 3300009148 Bacteria 1184
58 Ga0105241_10037202 3300009174 Bacteria 3666
59 Ga0105248_10000558 3300009177 Bacteria 42249
60 Ga0105248_10090211 3300009177 Bacteria 3451
61 Ga0105237_10053828 3300009545 Bacteria 4035
62 Ga0105238_10027753 3300009551 Bacteria 5770
63 Ga0157373_10071438 3300013100 Bacteria 2451
64 Ga0157371_10000011 3300013102 Bacteria 377608
65 Ga0157371_10065560 3300013102 Bacteria 2572
66 Ga0157370_10280033 3300013104 Bacteria 1541
67 Ga0157369_10362428 3300013105 Bacteria 1505
68 Ga0157374_10097681 3300013296 Bacteria 2811
69 Ga0157374_10110952 3300013296 Bacteria 2638
70 Ga0157378_10257230 3300013297 Bacteria 1674
71 Ga0163162_10024549 3300013306 Bacteria 5952
72 Ga0157372_10083501 3300013307 Bacteria 3618
73 Ga0183363_1007 3300015690 Bacteria 315687
74 Ga0163161_10060666 3300017792 Bacteria 2753
75 Ga0206353_11826136 3300020082 Bacteria 2079
76 Ga0209563_100024 3300025230 Bacteria 601155
77 Ga0207425_1000025 3300025245 Bacteria 321872
78 Ga0207425_1005298 3300025245 Bacteria 3696
79 Ga0209026_1009464 3300025250 Bacteria 1912
80 Ga0209148_1000008 3300025254 Bacteria 1504371
81 Ga0209129_1000916 3300025258 Bacteria 18023
82 Ga0209233_1000107 3300025261 Bacteria 267399
83 Ga0209565_1000007 3300025263 Bacteria 784361
84 Ga0209565_1000044 3300025263 Bacteria 229969
85 Ga0209565_1016133 3300025263 Bacteria 1669
86 Ga0209455_1000002 3300025272 Bacteria 1505459
87 Ga0209673_1001675 3300025273 Bacteria 18942
88 Ga0209673_1024365 3300025273 Bacteria 2035
89 Ga0209675_1014694 3300025291 Bacteria 2369
90 Ga0209676_1001255 3300025292 Bacteria 26544
91 Ga0209676_1007560 3300025292 Bacteria 5062
92 Ga0209025_1000176 3300025294 Bacteria 158186
93 Ga0209564_1000886 3300025295 Bacteria 39513
94 Ga0209564_1009736 3300025295 Bacteria 4523
95 Ga0209758_1000002 3300025297 Bacteria 1400310
96 Ga0209758_1000007 3300025297 Bacteria 1270410
97 Ga0209758_1001400 3300025297 Bacteria 28614
98 Ga0209050_1000001 3300025298 Bacteria 3563507
99 Ga0209050_1000051 3300025298 Bacteria 353153
100 Ga0209050_1000350 3300025298 Bacteria 88878
101 Ga0209050_1005851 3300025298 Bacteria 7534
102 Ga0209050_1009648 3300025298 Bacteria 4901
103 Ga0209050_1022425 3300025298 Bacteria 2262
104 Ga0209256_1000008 3300025299 Bacteria 975723
105 Ga0207426_1015708 3300025302 Bacteria 2740
106 Ga0209051_1000919 3300025303 Bacteria 29216
107 Ga0209257_1000028 3300025304 Bacteria 699493
108 Ga0209257_1001366 3300025304 Bacteria 29440
109 Ga0209257_1001406 3300025304 Bacteria 28716
110 Ga0209257_1001709 3300025304 Bacteria 24597
111 Ga0209257_1012638 3300025304 Bacteria 3872
112 Ga0207697_10005019 3300025315 Bacteria 6212
113 Ga0207656_10009045 3300025321 Bacteria 3691
114 Ga0207688_10049194 3300025901 Bacteria 2356
115 Ga0207647_10048486 3300025904 Bacteria 2637
116 Ga0207645_10050657 3300025907 Bacteria 2652
117 Ga0207705_10000154 3300025909 Bacteria 73880
118 Ga0207695_10015208 3300025913 Bacteria 9075
119 Ga0207671_10009010 3300025914 Bacteria 8393
120 Ga0207671_10010992 3300025914 Bacteria 7412
121 Ga0207657_10009444 3300025919 Bacteria 9798
122 Ga0207649_10000749 3300025920 Bacteria 21220
123 Ga0207649_10054606 3300025920 Bacteria 2487
124 Ga0207652_10182361 3300025921 Bacteria 1887
125 Ga0207694_10001580 3300025924 Bacteria 19295
126 Ga0207694_10003792 3300025924 Bacteria 11961
127 Ga0207694_10015221 3300025924 Bacteria 5801
128 Ga0207687_10000415 3300025927 Bacteria 28949
129 Ga0207690_10000325 3300025932 Bacteria 31915
130 Ga0207709_10000005 3300025935 Bacteria 806813
131 Ga0207709_10445662 3300025935 Bacteria 1000
132 Ga0207669_10001439 3300025937 Bacteria 10150
133 Ga0207669_10036879 3300025937 Bacteria 2798
134 Ga0207711_10016370 3300025941 Bacteria 6163
135 Ga0207711_10052855 3300025941 Bacteria 3483
136 Ga0207679_10040186 3300025945 Bacteria 3346
137 Ga0207667_10000001 3300025949 Bacteria 1178522
138 Ga0207640_10005991 3300025981 Bacteria 6644
139 Ga0207640_10014164 3300025981 Bacteria 4584
140 Ga0207703_10000611 3300026035 Bacteria 36227
141 Ga0207703_10001110 3300026035 Bacteria 25489
142 Ga0207639_10008353 3300026041 Bacteria 7097
143 Ga0207639_10009690 3300026041 Bacteria 6653
144 Ga0207678_10007422 3300026067 Bacteria 9710
145 Ga0207702_10003659 3300026078 Bacteria 13925
146 Ga0207648_10198968 3300026089 Bacteria 1777
147 Ga0207676_10000730 3300026095 Bacteria 25739
148 Ga0207674_10016045 3300026116 Bacteria 8205
149 Ga0207675_100002491 3300026118 Bacteria 18232
150 Ga0207683_10006531 3300026121 Bacteria 9983
151 Ga0207698_10003762 3300026142 Bacteria 9171
152 Ga0268266_10000002 3300028379 Bacteria 3059047
153 Ga0268266_10019801 3300028379 Bacteria 5735
154 Ga0307517_10017144 3300028786 Bacteria 9461
155 Ga0307517_10022435 3300028786 Bacteria 7912
156 Ga0307513_10029351 3300031456 Bacteria 6273
157 Ga0307513_10185454 3300031456 Bacteria 1938
158 Ga0307509_10034522 3300031507 Bacteria 5558
159 Ga0307508_10001326 3300031616 Bacteria 28003
160 Ga0307412_10005010 3300031911 Bacteria 7405
161 Ga0307412_10016781 3300031911 Bacteria 4370
162 Ga0307510_10000081 3300033180 Bacteria 72540
163 Ga0395901_0069063 3300038443 Bacteria 3680
164 Ga0436363_0614164 3300039450 Bacteria 2124
165 Ga0439461_0008102 3300041410 Bacteria 1877
166 Ga0439465_0000768 3300041413 Bacteria 9975
167 Ga0439431_0000153 3300041997 Bacteria 12648
168 Ga0439445_0007616 3300042004 Bacteria 2517
169 Ga0439452_019700 3300042010 Bacteria 1780
170 Ga0439452_021753 3300042010 Bacteria 1667
171 Ga0439462_0000068 3300042015 Bacteria 15535
172 Ga0439462_0002189 3300042015 Bacteria 4506
173 Ga0439434_0003739 3300042435 Bacteria 4443
174 Ga0439434_0003908 3300042435 Bacteria 4351
175 Ga0495638_0000048 3300046460 Bacteria 209787
176 Ga0495650_0000096 3300046471 Bacteria 217464
177 Ga0495584_0015943 3300046491 Bacteria 3834
178 Ga0495584_0065236 3300046491 Bacteria 1831
179 Ga0495585_0013234 3300046492 Bacteria 4833
180 Ga0495585_0026458 3300046492 Bacteria 3313
181 Ga0495596_0008702 3300046500 Bacteria 4499
182 Ga0495583_0000897 3300046506 Bacteria 35572
183 Ga0495583_0004543 3300046506 Bacteria 9870
184 Ga0495583_0018653 3300046506 Bacteria 3647
185 Ga0495583_0026657 3300046506 Bacteria 2860
186 Ga0495606_0000668 3300046507 Bacteria 53635
187 Ga0495606_0039207 3300046507 Bacteria 3196
188 Ga0495606_0138685 3300046507 Bacteria 1438
189 Ga0495631_0002628 3300046518 Bacteria 10030
190 Ga0495643_0006530 3300046522 Bacteria 7671
191 Ga0495643_0011891 3300046522 Bacteria 5271
192 Ga0495648_0000065 3300046524 Bacteria 145024
193 Ga0495648_0016914 3300046524 Bacteria 5240
194 Ga0495648_0035740 3300046524 Bacteria 3217
195 Ga0495648_0066166 3300046524 Bacteria 2120
196 Ga0495663_0004173 3300046525 Bacteria 4083
197 Ga0495663_0004522 3300046525 Bacteria 3904
198 Ga0495642_0006834 3300046528 Bacteria 4375
199 Ga0495633_0000634 3300046558 Bacteria 32773
200 Ga0495668_0000022 3300046616 Bacteria 363999
201 Ga0495611_0064276 3300046648 Bacteria 1671
202 Ga0495625_0000212 3300046660 Bacteria 91883
203 Ga0495625_0000860 3300046660 Bacteria 41288
204 Ga0495625_0009022 3300046660 Bacteria 8421
205 Ga0495625_0034603 3300046660 Bacteria 3727
206 Ga0495625_0048327 3300046660 Bacteria 3065
207 Ga0495625_0055793 3300046660 Bacteria 2816
208 Ga0495661_0033545 3300046665 Bacteria 3238
209 Ga0495669_0000069 3300046684 Bacteria 68241
210 Ga0495613_0212326 3300046689 Bacteria 1361
211 Ga0495670_0000010 3300046691 Bacteria 174071
212 Ga0495670_0014426 3300046691 Bacteria 3885
213 Ga0495670_0017878 3300046691 Bacteria 3492
214 Ga0495670_0097168 3300046691 Bacteria 1513
215 Ga0495649_0045543 3300046694 Bacteria 2391
216 Ga0495649_0088581 3300046694 Bacteria 1651
217 Ga0495649_0123509 3300046694 Bacteria 1368
218 Ga0495600_0006079 3300046809 Bacteria 7315
219 Ga0495683_0005840 3300047323 Bacteria 6771
220 Ga0495687_006732 3300047443 Bacteria 6959
221 Ga0495687_007036 3300047443 Bacteria 6738
222 Ga0495677_0000976 3300047445 Bacteria 11512
223 Ga0495677_0013067 3300047445 Bacteria 3021
224 Ga0495686_0000238 3300047472 Bacteria 99919
225 Ga0495686_0011471 3300047472 Bacteria 6240
226 Ga0495686_0017863 3300047472 Bacteria 4770
227 Ga0496102_0000022 3300048905 Bacteria 246314
228 Ga0496103_0000671 3300048906 Bacteria 25726
229 Ga0496104_0000924 3300048907 Bacteria 25198
230 Ga0496105_0013617 3300048908 Bacteria 6457
231 Ga0496110_0007701 3300048913 Bacteria 8619
232 Ga0496111_0034002 3300048914 Bacteria 3638
233 Ga0496114_0002319 3300048917 Bacteria 14497
234 Ga0496115_0000651 3300048918 Bacteria 25969
235 Ga0496115_0000906 3300048918 Bacteria 21502
236 Ga0496116_0013768 3300048919 Bacteria 6500
237 Ga0496117_0000046 3300048920 Bacteria 300879
238 Ga0496118_0000036 3300048921 Bacteria 318213
239 Ga0496119_0014304 3300048922 Bacteria 6225
240 Ga0496120_0007522 3300048923 Bacteria 8087
241 Ga0496121_0000702 3300048924 Bacteria 62249
242 Ga0496121_0001202 3300048924 Bacteria 45329
243 Ga0496122_0015295 3300048925 Bacteria 7342
244 Ga0496122_0022431 3300048925 Bacteria 5613
245 Ga0496123_0013558 3300048926 Bacteria 6826
246 Ga0496124_0000011 3300048927 Bacteria 524145
247 Ga0496124_0000648 3300048927 Bacteria 57426
248 Ga0496124_0007657 3300048927 Bacteria 11424
249 Ga0496124_0022568 3300048927 Bacteria 5765
250 Ga0496125_0000309 3300048928 Bacteria 96047
251 Ga0496126_0000771 3300048929 Bacteria 57837
252 Ga0496126_0031373 3300048929 Bacteria 5023
253 Ga0501047_0280134 3300049581 Bacteria 1512
254 Ga0501071_0120216 3300049587 Bacteria 1947
255 Ga0501241_005024 3300049758 Bacteria 2472
256 Ga0500610_0117763 3300053079 Bacteria 1360
257 Ga0500643_001540 3300053087 Bacteria 13078
258 Ga0500643_004413 3300053087 Bacteria 6375
259 Ga0500566_0001217 3300053094 Bacteria 15061
260 Ga0500641_0003308 3300053096 Bacteria 5703
261 Ga0500641_0028358 3300053096 Bacteria 2186
262 Ga0500595_004864 3300053119 Bacteria 5945
263 Ga0500607_132033 3300053121 Bacteria 1189
264 Ga0500642_0003270 3300053130 Bacteria 4875
265 Ga0500658_0008794 3300053134 Bacteria 3727
266 Ga0500658_0010897 3300053134 Bacteria 3354
267 Ga0500559_0045423 3300053136 Bacteria 1923
268 Ga0500559_0052163 3300053136 Bacteria 1807
269 Ga0500568_0003373 3300053139 Bacteria 8928
270 Ga0500568_0017801 3300053139 Bacteria 3127
271 Ga0500573_0000093 3300053140 Bacteria 40260
272 Ga0500577_0015329 3300053142 Bacteria 2392
273 Ga0500619_007678 3300053154 Bacteria 2571
274 Ga0500627_0055237 3300053158 Bacteria 1738
275 Ga0500636_0001530 3300053177 Bacteria 12586
276 Ga0500645_000113 3300053730 Bacteria 64693
277 Ga0500645_001293 3300053730 Bacteria 13036
278 Ga0500596_000925 3300053735 Bacteria 5865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0013067 Ga0495677_0013067_2240_3010 243
2 3300031507 Ga0307509_10034522 Ga0307509_100345229 277
3 3300005842 Ga0068858_100011445 Ga0068858_1000114451 278
4 3300009148 Ga0105243_10470680 Ga0105243_104706801 278
5 3300013296 Ga0157374_10097681 Ga0157374_100976812 278
6 3300025927 Ga0207687_10000415 Ga0207687_1000041519 278
7 3300025935 Ga0207709_10445662 Ga0207709_104456621 278
8 3300026035 Ga0207703_10001110 Ga0207703_1000111022 278
9 3300046492 Ga0495585_0026458 Ga0495585_0026458_1956_2915 278
10 3300031616 Ga0307508_10001326 Ga0307508_1000132613 281
11 iso_pu_bacteria 2830075706 2830078515 285
12 3300026089 Ga0207648_10198968 Ga0207648_101989682 289
13 3300053142 Ga0500577_0015329 Ga0500577_0015329_1192_2082 294
14 iso_pu_bacteria 2984564862 2984568717 294
15 3300046460 Ga0495638_0000048 Ga0495638_0000048_168003_168983 297
16 3300046507 Ga0495606_0138685 Ga0495606_0138685_148_1089 297
17 3300046525 Ga0495663_0004173 Ga0495663_0004173_1090_2070 297
18 3300046660 Ga0495625_0000860 Ga0495625_0000860_9253_10194 297
19 3300053134 Ga0500658_0010897 Ga0500658_0010897_1527_2507 297
20 iso_pu_bacteria 2885429604 2885432613 298
21 iso_pu_bacteria 2990265787 2990265815 298
22 3300005288 Ga0065714_10098881 Ga0065714_100988811 299
23 iso_pu_bacteria 2928027323 2928029460 299
24 iso_pu_bacteria 2984555340 2984556976 299
25 iso_pu_bacteria 2993356040 2993359708 299
26 iso_pu_bacteria 8057101203 8057101505 299
27 3300046691 Ga0495670_0097168 Ga0495670_0097168_49_990 300
28 3300047472 Ga0495686_0017863 Ga0495686_0017863_485_1456 300
29 3300053096 Ga0500641_0028358 Ga0500641_0028358_1071_2012 300
30 3300053139 Ga0500568_0017801 Ga0500568_0017801_628_1569 300
31 3300005539 Ga0068853_100023688 Ga0068853_1000236887 301
32 3300026041 Ga0207639_10008353 Ga0207639_100083533 301
33 iso_pu_bacteria 2599185354 2600201918 301
34 iso_pu_bacteria 2751185897 2753766667 301
35 iso_pu_bacteria 2879163058 2879164323 301
36 iso_pu_bacteria 2928526807 2928531132 301
37 iso_pu_bacteria 2928968154 2928972309 301
38 3300046524 Ga0495648_0016914 Ga0495648_0016914_2685_3617 302
39 3300003791 Ga0055530_10007007 Ga0055530_100070072 303
40 3300003792 Ga0055540_1000427 Ga0055540_100042725 303
41 3300003792 Ga0055540_1001864 Ga0055540_100186411 303
42 3300003794 Ga0055531_10017161 Ga0055531_100171613 303
43 3300005617 Ga0068859_100000913 Ga0068859_10000091333 303
44 3300005719 Ga0068861_100000882 Ga0068861_10000088215 303
45 3300006931 Ga0097620_100000913 Ga0097620_10000091333 303
46 3300009177 Ga0105248_10000558 Ga0105248_1000055813 303
47 3300025292 Ga0209676_1001255 Ga0209676_100125523 303
48 3300025298 Ga0209050_1000001 Ga0209050_1000001227 303
49 3300025298 Ga0209050_1000350 Ga0209050_100035033 303
50 3300025303 Ga0209051_1000919 Ga0209051_100091932 303
51 3300025304 Ga0209257_1001366 Ga0209257_100136624 303
52 3300025941 Ga0207711_10016370 Ga0207711_100163707 303
53 3300026118 Ga0207675_100002491 Ga0207675_1000024917 303
54 3300039450 Ga0436363_0614164 Ga0436363_0614164_369_1346 303
55 iso_pu_bacteria 2946787523 2946790192 303
56 3300013102 Ga0157371_10065560 Ga0157371_100655602 304
57 3300013105 Ga0157369_10362428 Ga0157369_103624282 304
58 3300028786 Ga0307517_10022435 Ga0307517_100224352 304
59 3300047472 Ga0495686_0000238 Ga0495686_0000238_30127_31071 304
60 3300053096 Ga0500641_0003308 Ga0500641_0003308_2646_3593 304
61 iso_pu_bacteria 2599185359 2600228077 304
62 iso_pu_bacteria 2643221622 2644127692 304
63 iso_pu_bacteria 2818991466 2819715118 304
64 3300001915 JGI24741J21665_1002914 JGI24741J21665_10029142 305
65 3300001979 JGI24740J21852_10007533 JGI24740J21852_100075333 305
66 3300001990 JGI24737J22298_10001740 JGI24737J22298_100017406 305
67 3300003214 JGI25165J46597_1000065 JGI25165J46597_1000065112 305
68 3300003215 JGI25153J46596_10000097 JGI25153J46596_1000009713 305
69 3300003322 rootL2_10220847 rootL2_102208471 305
70 3300003759 Ga0055525_1000086 Ga0055525_1000086105 305
71 3300005262 Ga0065165_1003798 Ga0065165_10037982 305
72 3300005262 Ga0065165_1045945 Ga0065165_10459452 305
73 3300005327 Ga0070658_10009301 Ga0070658_100093012 305
74 3300005328 Ga0070676_10075396 Ga0070676_100753962 305
75 3300005344 Ga0070661_100003101 Ga0070661_1000031012 305
76 3300005344 Ga0070661_100074162 Ga0070661_1000741622 305
77 3300005354 Ga0070675_100018052 Ga0070675_1000180522 305
78 3300005356 Ga0070674_100053493 Ga0070674_1000534932 305
79 3300005366 Ga0070659_100365270 Ga0070659_1003652701 305
80 3300005455 Ga0070663_100259704 Ga0070663_1002597042 305
81 3300005456 Ga0070678_100028265 Ga0070678_1000282653 305
82 3300005459 Ga0068867_100140622 Ga0068867_1001406222 305
83 3300005530 Ga0070679_100210330 Ga0070679_1002103301 305
84 3300005539 Ga0068853_100137452 Ga0068853_1001374522 305
85 3300005548 Ga0070665_100000043 Ga0070665_1000000433 305
86 3300005548 Ga0070665_100066541 Ga0070665_1000665412 305
87 3300005548 Ga0070665_100170391 Ga0070665_1001703912 305
88 3300005564 Ga0070664_100033839 Ga0070664_1000338393 305
89 3300005618 Ga0068864_100003105 Ga0068864_10000310513 305
90 3300005842 Ga0068858_100083832 Ga0068858_1000838323 305
91 3300009174 Ga0105241_10037202 Ga0105241_100372023 305
92 3300009177 Ga0105248_10090211 Ga0105248_100902113 305
93 3300009551 Ga0105238_10027753 Ga0105238_100277537 305
94 3300013100 Ga0157373_10071438 Ga0157373_100714382 305
95 3300013102 Ga0157371_10000011 Ga0157371_10000011234 305
96 3300013104 Ga0157370_10280033 Ga0157370_102800331 305
97 3300013296 Ga0157374_10110952 Ga0157374_101109522 305
98 3300013297 Ga0157378_10257230 Ga0157378_102572303 305
99 3300013306 Ga0163162_10024549 Ga0163162_100245492 305
100 3300013307 Ga0157372_10083501 Ga0157372_100835013 305
101 3300020082 Ga0206353_11826136 Ga0206353_118261362 305
102 3300025230 Ga0209563_100024 Ga0209563_100024185 305
103 3300025261 Ga0209233_1000107 Ga0209233_100010797 305
104 3300025297 Ga0209758_1000007 Ga0209758_1000007456 305
105 3300025315 Ga0207697_10005019 Ga0207697_100050194 305
106 3300025321 Ga0207656_10009045 Ga0207656_100090453 305
107 3300025901 Ga0207688_10049194 Ga0207688_100491942 305
108 3300025904 Ga0207647_10048486 Ga0207647_100484862 305
109 3300025907 Ga0207645_10050657 Ga0207645_100506572 305
110 3300025909 Ga0207705_10000154 Ga0207705_1000015467 305
111 3300025913 Ga0207695_10015208 Ga0207695_100152087 305
112 3300025914 Ga0207671_10010992 Ga0207671_100109925 305
113 3300025919 Ga0207657_10009444 Ga0207657_100094444 305
114 3300025920 Ga0207649_10000749 Ga0207649_1000074917 305
115 3300025920 Ga0207649_10054606 Ga0207649_100546062 305
116 3300025921 Ga0207652_10182361 Ga0207652_101823613 305
117 3300025924 Ga0207694_10001580 Ga0207694_100015803 305
118 3300025924 Ga0207694_10003792 Ga0207694_100037922 305
119 3300025924 Ga0207694_10015221 Ga0207694_100152216 305
120 3300025932 Ga0207690_10000325 Ga0207690_1000032525 305
121 3300025935 Ga0207709_10000005 Ga0207709_10000005123 305
122 3300025937 Ga0207669_10001439 Ga0207669_100014398 305
123 3300025937 Ga0207669_10036879 Ga0207669_100368792 305
124 3300025941 Ga0207711_10052855 Ga0207711_100528554 305
125 3300025945 Ga0207679_10040186 Ga0207679_100401863 305
126 3300025949 Ga0207667_10000001 Ga0207667_10000001690 305
127 3300025981 Ga0207640_10005991 Ga0207640_100059916 305
128 3300026035 Ga0207703_10000611 Ga0207703_100006113 305
129 3300026041 Ga0207639_10009690 Ga0207639_100096903 305
130 3300026067 Ga0207678_10007422 Ga0207678_100074228 305
131 3300026078 Ga0207702_10003659 Ga0207702_100036594 305
132 3300026095 Ga0207676_10000730 Ga0207676_1000073011 305
133 3300026116 Ga0207674_10016045 Ga0207674_100160456 305
134 3300026121 Ga0207683_10006531 Ga0207683_100065312 305
135 3300026142 Ga0207698_10003762 Ga0207698_100037623 305
136 3300028379 Ga0268266_10000002 Ga0268266_10000002584 305
137 3300028379 Ga0268266_10019801 Ga0268266_100198014 305
138 3300028786 Ga0307517_10017144 Ga0307517_100171443 305
139 3300031456 Ga0307513_10029351 Ga0307513_100293513 305
140 3300031456 Ga0307513_10185454 Ga0307513_101854542 305
141 3300031911 Ga0307412_10016781 Ga0307412_100167812 305
142 3300033180 Ga0307510_10000081 Ga0307510_1000008149 305
143 3300038443 Ga0395901_0069063 Ga0395901_0069063_2188_3135 305
144 3300041410 Ga0439461_0008102 Ga0439461_0008102_529_1446 305
145 3300042004 Ga0439445_0007616 Ga0439445_0007616_639_1556 305
146 3300042010 Ga0439452_019700 Ga0439452_019700_403_1320 305
147 3300042015 Ga0439462_0002189 Ga0439462_0002189_3452_4369 305
148 3300042435 Ga0439434_0003908 Ga0439434_0003908_3243_4160 305
149 3300046471 Ga0495650_0000096 Ga0495650_0000096_6283_7233 305
150 3300046491 Ga0495584_0015943 Ga0495584_0015943_1174_2133 305
151 3300046491 Ga0495584_0065236 Ga0495584_0065236_432_1382 305
152 3300046492 Ga0495585_0013234 Ga0495585_0013234_2607_3557 305
153 3300046506 Ga0495583_0000897 Ga0495583_0000897_32606_33556 305
154 3300046506 Ga0495583_0004543 Ga0495583_0004543_4359_5315 305
155 3300046506 Ga0495583_0026657 Ga0495583_0026657_43_1002 305
156 3300046507 Ga0495606_0000668 Ga0495606_0000668_1226_2176 305
157 3300046507 Ga0495606_0039207 Ga0495606_0039207_1139_2098 305
158 3300046518 Ga0495631_0002628 Ga0495631_0002628_1122_2081 305
159 3300046522 Ga0495643_0006530 Ga0495643_0006530_2778_3728 305
160 3300046522 Ga0495643_0011891 Ga0495643_0011891_1152_2102 305
161 3300046524 Ga0495648_0035740 Ga0495648_0035740_683_1639 305
162 3300046524 Ga0495648_0066166 Ga0495648_0066166_1056_2006 305
163 3300046528 Ga0495642_0006834 Ga0495642_0006834_625_1575 305
164 3300046616 Ga0495668_0000022 Ga0495668_0000022_291529_292488 305
165 3300046648 Ga0495611_0064276 Ga0495611_0064276_378_1328 305
166 3300046660 Ga0495625_0000212 Ga0495625_0000212_28754_29704 305
167 3300046660 Ga0495625_0009022 Ga0495625_0009022_3379_4335 305
168 3300046660 Ga0495625_0034603 Ga0495625_0034603_1107_2066 305
169 3300046665 Ga0495661_0033545 Ga0495661_0033545_742_1692 305
170 3300046684 Ga0495669_0000069 Ga0495669_0000069_58204_59163 305
171 3300046689 Ga0495613_0212326 Ga0495613_0212326_16_966 305
172 3300046691 Ga0495670_0017878 Ga0495670_0017878_1905_2858 305
173 3300046694 Ga0495649_0045543 Ga0495649_0045543_296_1255 305
174 3300046694 Ga0495649_0123509 Ga0495649_0123509_65_1015 305
175 3300046809 Ga0495600_0006079 Ga0495600_0006079_6183_7133 305
176 3300047323 Ga0495683_0005840 Ga0495683_0005840_2704_3663 305
177 3300047443 Ga0495687_006732 Ga0495687_006732_1199_2149 305
178 3300047443 Ga0495687_007036 Ga0495687_007036_1222_2181 305
179 3300047445 Ga0495677_0000976 Ga0495677_0000976_2847_3797 305
180 3300049587 Ga0501071_0120216 Ga0501071_0120216_949_1896 305
181 3300049758 Ga0501241_005024 Ga0501241_005024_1311_2228 305
182 3300053079 Ga0500610_0117763 Ga0500610_0117763_210_1169 305
183 3300053087 Ga0500643_001540 Ga0500643_001540_10944_11900 305
184 3300053094 Ga0500566_0001217 Ga0500566_0001217_13193_14110 305
185 3300053119 Ga0500595_004864 Ga0500595_004864_1510_2460 305
186 3300053121 Ga0500607_132033 Ga0500607_132033_23_973 305
187 3300053136 Ga0500559_0052163 Ga0500559_0052163_393_1364 305
188 3300053154 Ga0500619_007678 Ga0500619_007678_204_1154 305
189 3300053177 Ga0500636_0001530 Ga0500636_0001530_10072_11022 305
190 3300053730 Ga0500645_000113 Ga0500645_000113_4151_5110 305
191 3300053735 Ga0500596_000925 Ga0500596_000925_4394_5344 305
192 3300002774 JGI25150J39212_1000282 JGI25150J39212_100028224 306
193 3300003215 JGI25153J46596_10000032 JGI25153J46596_10000032147 306
194 3300003771 Ga0055526_1010403 Ga0055526_10104033 306
195 3300003791 Ga0055530_10018169 Ga0055530_100181693 306
196 3300003794 Ga0055531_10017158 Ga0055531_100171583 306
197 3300005262 Ga0065165_1026972 Ga0065165_10269721 306
198 3300025245 Ga0207425_1000025 Ga0207425_1000025231 306
199 3300025258 Ga0209129_1000916 Ga0209129_100091615 306
200 3300025263 Ga0209565_1000044 Ga0209565_1000044179 306
201 3300025263 Ga0209565_1016133 Ga0209565_10161332 306
202 3300025273 Ga0209673_1024365 Ga0209673_10243653 306
203 3300025292 Ga0209676_1007560 Ga0209676_10075606 306
204 3300025295 Ga0209564_1000886 Ga0209564_100088640 306
205 3300025295 Ga0209564_1009736 Ga0209564_10097362 306
206 3300025297 Ga0209758_1000002 Ga0209758_1000002315 306
207 3300025298 Ga0209050_1009648 Ga0209050_10096482 306
208 3300025298 Ga0209050_1022425 Ga0209050_10224252 306
209 3300025302 Ga0207426_1015708 Ga0207426_10157083 306
210 3300025304 Ga0209257_1001406 Ga0209257_100140629 306
211 3300048918 Ga0496115_0000906 Ga0496115_0000906_14159_15103 306
212 3300025294 Ga0209025_1000176 Ga0209025_100017612 307
213 3300053140 Ga0500573_0000093 Ga0500573_0000093_12386_13342 307
214 3300000041 ARcpr5oldR_c004719 ARcpr5oldR_0047192 308
215 3300003215 JGI25153J46596_10006076 JGI25153J46596_100060762 308
216 3300003762 Ga0055542_1000041 Ga0055542_1000041151 308
217 3300003763 Ga0055529_1000040 Ga0055529_1000040176 308
218 3300003775 Ga0055524_1000133 Ga0055524_100013361 308
219 3300003791 Ga0055530_10000114 Ga0055530_1000011451 308
220 3300003791 Ga0055530_10010211 Ga0055530_100102112 308
221 3300003794 Ga0055531_10000095 Ga0055531_1000009523 308
222 3300003794 Ga0055531_10004220 Ga0055531_100042203 308
223 3300005262 Ga0065165_1002993 Ga0065165_10029933 308
224 3300005262 Ga0065165_1014431 Ga0065165_10144313 308
225 3300005577 Ga0068857_100025968 Ga0068857_1000259682 308
226 3300009148 Ga0105243_10000308 Ga0105243_1000030847 308
227 3300009545 Ga0105237_10053828 Ga0105237_100538282 308
228 3300015690 Ga0183363_1007 Ga0183363_1007218 308
229 3300017792 Ga0163161_10060666 Ga0163161_100606661 308
230 3300025245 Ga0207425_1005298 Ga0207425_10052982 308
231 3300025250 Ga0209026_1009464 Ga0209026_10094642 308
232 3300025254 Ga0209148_1000008 Ga0209148_1000008142 308
233 3300025263 Ga0209565_1000007 Ga0209565_1000007681 308
234 3300025272 Ga0209455_1000002 Ga0209455_10000021283 308
235 3300025273 Ga0209673_1001675 Ga0209673_10016753 308
236 3300025291 Ga0209675_1014694 Ga0209675_10146942 308
237 3300025297 Ga0209758_1001400 Ga0209758_100140030 308
238 3300025298 Ga0209050_1000051 Ga0209050_100005123 308
239 3300025298 Ga0209050_1005851 Ga0209050_10058513 308
240 3300025299 Ga0209256_1000008 Ga0209256_1000008523 308
241 3300025304 Ga0209257_1000028 Ga0209257_1000028345 308
242 3300025304 Ga0209257_1001709 Ga0209257_100170913 308
243 3300025304 Ga0209257_1012638 Ga0209257_10126383 308
244 3300025914 Ga0207671_10009010 Ga0207671_100090102 308
245 3300025981 Ga0207640_10014164 Ga0207640_100141643 308
246 3300031911 Ga0307412_10005010 Ga0307412_100050106 308
247 3300041413 Ga0439465_0000768 Ga0439465_0000768_1769_2695 308
248 3300041997 Ga0439431_0000153 Ga0439431_0000153_7168_8094 308
249 3300042010 Ga0439452_021753 Ga0439452_021753_701_1627 308
250 3300042015 Ga0439462_0000068 Ga0439462_0000068_12176_13102 308
251 3300042435 Ga0439434_0003739 Ga0439434_0003739_1310_2236 308
252 3300046500 Ga0495596_0008702 Ga0495596_0008702_2047_3129 308
253 3300046506 Ga0495583_0018653 Ga0495583_0018653_2193_3212 308
254 3300046524 Ga0495648_0000065 Ga0495648_0000065_127878_128897 308
255 3300046525 Ga0495663_0004522 Ga0495663_0004522_363_1382 308
256 3300046558 Ga0495633_0000634 Ga0495633_0000634_1371_2411 308
257 3300046660 Ga0495625_0048327 Ga0495625_0048327_1593_2633 308
258 3300046660 Ga0495625_0055793 Ga0495625_0055793_971_1924 308
259 3300046691 Ga0495670_0000010 Ga0495670_0000010_128427_129380 308
260 3300046691 Ga0495670_0014426 Ga0495670_0014426_1917_2957 308
261 3300046694 Ga0495649_0088581 Ga0495649_0088581_389_1441 308
262 3300047472 Ga0495686_0011471 Ga0495686_0011471_3257_4192 308
263 3300048905 Ga0496102_0000022 Ga0496102_0000022_232649_233701 308
264 3300048906 Ga0496103_0000671 Ga0496103_0000671_7372_8424 308
265 3300048907 Ga0496104_0000924 Ga0496104_0000924_6872_7924 308
266 3300048908 Ga0496105_0013617 Ga0496105_0013617_1362_2414 308
267 3300048913 Ga0496110_0007701 Ga0496110_0007701_2915_3967 308
268 3300048914 Ga0496111_0034002 Ga0496111_0034002_1540_2559 308
269 3300048917 Ga0496114_0002319 Ga0496114_0002319_9082_10134 308
270 3300048918 Ga0496115_0000651 Ga0496115_0000651_7617_8669 308
271 3300048919 Ga0496116_0013768 Ga0496116_0013768_4848_5900 308
272 3300048920 Ga0496117_0000046 Ga0496117_0000046_282525_283577 308
273 3300048921 Ga0496118_0000036 Ga0496118_0000036_17303_18355 308
274 3300048922 Ga0496119_0014304 Ga0496119_0014304_465_1517 308
275 3300048923 Ga0496120_0007522 Ga0496120_0007522_3045_4001 308
276 3300048924 Ga0496121_0000702 Ga0496121_0000702_48135_49187 308
277 3300048924 Ga0496121_0001202 Ga0496121_0001202_21546_22499 308
278 3300048925 Ga0496122_0015295 Ga0496122_0015295_4471_5523 308
279 3300048925 Ga0496122_0022431 Ga0496122_0022431_2127_3083 308
280 3300048926 Ga0496123_0013558 Ga0496123_0013558_3028_3984 308
281 3300048927 Ga0496124_0000011 Ga0496124_0000011_505791_506843 308
282 3300048927 Ga0496124_0000648 Ga0496124_0000648_27491_28447 308
283 3300048927 Ga0496124_0007657 Ga0496124_0007657_7343_8299 308
284 3300048927 Ga0496124_0022568 Ga0496124_0022568_546_1502 308
285 3300048928 Ga0496125_0000309 Ga0496125_0000309_15632_16684 308
286 3300048929 Ga0496126_0000771 Ga0496126_0000771_17303_18355 308
287 3300048929 Ga0496126_0031373 Ga0496126_0031373_1079_2035 308
288 3300049581 Ga0501047_0280134 Ga0501047_0280134_144_1151 308
289 3300053087 Ga0500643_004413 Ga0500643_004413_283_1209 308
290 3300053130 Ga0500642_0003270 Ga0500642_0003270_1458_2477 308
291 3300053134 Ga0500658_0008794 Ga0500658_0008794_2172_3098 308
292 3300053136 Ga0500559_0045423 Ga0500559_0045423_20_991 308
293 3300053139 Ga0500568_0003373 Ga0500568_0003373_1127_2053 308
294 3300053158 Ga0500627_0055237 Ga0500627_0055237_628_1581 308
295 3300053730 Ga0500645_001293 Ga0500645_001293_7732_8682 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

45

168

0.87

PF01678

DAP_epimerase

Diaminopimelate epimerase

198

314

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otn-assembly1.cif.gz_A crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis 0.8891 2 276
2q9h-assembly1.cif.gz_A crystal structure of the c73s mutant of diaminopimelate epimerase 0.8548 6 272
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.8522 6 272
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8489 6 272
2q9j-assembly1.cif.gz_A crystal structure of the c217s mutant of diaminopimelate epimerase 0.8484 6 272
ID Description Score Start End Superfamily
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8977 8 116 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8776 148 263 3.10.310.10
2otnA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8756 2 116 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8658 150 252 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8636 148 263 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7Y7UST4-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9865 4 305 GO:0005829
GO:0008837
GO:0009089
AF-A0A2W5BG54-F1-model_v4 deleted 0.9792 4 225
AF-A0A1R1YWS7-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9784 4 305 GO:0005829
GO:0008837
GO:0009089
AF-A0A396RR26-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9761 4 307 GO:0005829
GO:0008837
GO:0009089
AF-A0A0A6CYH3-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9682 45 306 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
94.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map