F392523

General Info

Members Datasets Scaffolds Average Seq Length
295 176 590 286

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100092046|Ga0070694_1000920462
Length 319
Sequence VSVRVNSWIGCSTPAVRTFHEFTRNDTKDRDKEIEEMKESTFEGVGGLKVFTRSWQPEGKTRAVVVIVPGFNSHSGQYLWVGEQFAAKGLAAYVIDLRGRGRSEGERYYVEKIEDYTEDVATLVRTAKAENPGLPLFVLGHSAGGVVSCIYALDHPSEIDGLICESFAYDLPAPDLVLSFIKGLSYITKHTHVYTLKNEVFSRDPQVVDSMNNDLLIKGESQPVQTSVVMIDAASRLNQEFSLIKLPVLILHGTEDKVTNPSGSQFFYDNAGSTDKTLKLYEGHYHDLLNDVDKEIVMADINNWIDARVPVTQTKSAAL

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
151 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
158 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 2508501050 Microvirga lupini Lut6 Isolate Nodule
175 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
176 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0.34
Rhizoplane 1.02
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 12.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100092046 3300005444 Bacteria 2130
2 JGI24034J26672_10005730 3300002239 Bacteria 1784
3 JGI25406J46586_10001498 3300003203 Bacteria 11028
4 JGI25406J46586_10057069 3300003203 Bacteria 1278
5 rootL2_10065775 3300003322 Unclassified 3341
6 Ga0065714_10064432 3300005288 Bacteria 133542
7 Ga0065712_10067730 3300005290 Bacteria 133482
8 Ga0065712_10157547 3300005290 Bacteria 1287
9 Ga0065715_10092139 3300005293 Bacteria 5308
10 Ga0065707_10017818 3300005295 Bacteria 2003
11 Ga0070670_100026382 3300005331 Bacteria 5001
12 Ga0070670_100071814 3300005331 Bacteria 2972
13 Ga0070670_100424390 3300005331 Bacteria 1176
14 Ga0070680_100327313 3300005336 Bacteria 1301
15 Ga0068868_100527000 3300005338 Unclassified 1038
16 Ga0070689_100015630 3300005340 Bacteria 5539
17 Ga0070661_100161520 3300005344 Unclassified 1697
18 Ga0070668_100000058 3300005347 Bacteria 69744
19 Ga0070668_100107645 3300005347 Bacteria 2216
20 Ga0070669_100002306 3300005353 Bacteria 13818
21 Ga0070669_100010861 3300005353 Bacteria 6463
22 Ga0070675_100083475 3300005354 Bacteria 2667
23 Ga0070671_100002701 3300005355 Bacteria 13763
24 Ga0070671_100262050 3300005355 Bacteria 1469
25 Ga0070673_100199518 3300005364 Bacteria 1723
26 Ga0070673_100469583 3300005364 Bacteria 1134
27 Ga0070703_10001966 3300005406 Bacteria 6014
28 Ga0070701_10001411 3300005438 Bacteria 8906
29 Ga0070701_10089835 3300005438 Bacteria 1681
30 Ga0070705_100044535 3300005440 Bacteria 2549
31 Ga0070705_100398423 3300005440 Bacteria 1018
32 Ga0070700_100006885 3300005441 Bacteria 6102
33 Ga0070694_100002896 3300005444 Bacteria 10197
34 Ga0070694_100058748 3300005444 Unclassified 2617
35 Ga0070694_100072074 3300005444 Bacteria 2382
36 Ga0070694_100114774 3300005444 Bacteria 1924
37 Ga0070694_100132064 3300005444 Bacteria 1805
38 Ga0070694_100299596 3300005444 Bacteria 1231
39 Ga0070708_100148112 3300005445 Bacteria 2182
40 Ga0070662_100239067 3300005457 Bacteria 1456
41 Ga0068867_100001060 3300005459 Bacteria 18761
42 Ga0070685_10129289 3300005466 Bacteria 1577
43 Ga0070706_100203506 3300005467 Bacteria 1849
44 Ga0070706_100215276 3300005467 Bacteria 1793
45 Ga0070698_100018186 3300005471 Bacteria 7400
46 Ga0070698_100111419 3300005471 Bacteria 2701
47 Ga0070699_100037200 3300005518 Bacteria 4211
48 Ga0070699_100196834 3300005518 Unclassified 1791
49 Ga0070697_100005375 3300005536 Bacteria 9854
50 Ga0070697_100023521 3300005536 Bacteria 4900
51 Ga0070697_100250820 3300005536 Bacteria 1513
52 Ga0070672_100041797 3300005543 Bacteria 3527
53 Ga0070686_100010008 3300005544 Bacteria 5338
54 Ga0070686_100069724 3300005544 Bacteria 2297
55 Ga0070696_100227033 3300005546 Unclassified 1403
56 Ga0070693_100019135 3300005547 Bacteria 3585
57 Ga0070665_100000024 3300005548 Bacteria 374559
58 Ga0070665_100034078 3300005548 Bacteria 5121
59 Ga0070665_100090416 3300005548 Bacteria 3067
60 Ga0070704_100001101 3300005549 Bacteria 14031
61 Ga0070704_100005281 3300005549 Bacteria 7525
62 Ga0070664_100188462 3300005564 Bacteria 1837
63 Ga0070664_100295530 3300005564 Unclassified 1463
64 Ga0068857_100017950 3300005577 Bacteria 6206
65 Ga0068857_100099338 3300005577 Bacteria 2611
66 Ga0068857_100147330 3300005577 Bacteria 2130
67 Ga0070702_100023062 3300005615 Bacteria 3301
68 Ga0068859_100008144 3300005617 Bacteria 10628
69 Ga0068859_100021279 3300005617 Bacteria 6508
70 Ga0068864_100142737 3300005618 Bacteria 2162
71 Ga0068864_100291213 3300005618 Bacteria 1526
72 Ga0068866_10371199 3300005718 Unclassified 915
73 Ga0068861_100007229 3300005719 Bacteria 7607
74 Ga0068861_100007882 3300005719 Bacteria 7328
75 Ga0068861_100040532 3300005719 Unclassified 3484
76 Ga0068870_10001713 3300005840 Bacteria 8979
77 Ga0068863_100000012 3300005841 Bacteria 229774
78 Ga0068863_100147117 3300005841 Bacteria 2254
79 Ga0068863_100218761 3300005841 Bacteria 1835
80 Ga0068858_100156696 3300005842 Bacteria 2143
81 Ga0068858_100197381 3300005842 Bacteria 1902
82 Ga0068860_100257345 3300005843 Bacteria 1701
83 Ga0068860_100437710 3300005843 Bacteria 1298
84 Ga0068862_100002477 3300005844 Bacteria 16352
85 Ga0068862_100011825 3300005844 Bacteria 7207
86 Ga0068862_100072211 3300005844 Bacteria 2981
87 Ga0068862_100088322 3300005844 Bacteria 2697
88 Ga0068862_100110369 3300005844 Bacteria 2413
89 Ga0068862_100240811 3300005844 Bacteria 1645
90 Ga0081455_10275866 3300005937 Unclassified 1217
91 Ga0081538_10167568 3300005981 Bacteria 964
92 Ga0081539_10000243 3300005985 Bacteria 127575
93 Ga0081539_10003813 3300005985 Bacteria 17719
94 Ga0081539_10047928 3300005985 Bacteria 2435
95 Ga0081539_10076585 3300005985 Unclassified 1772
96 Ga0070715_10000026 3300006163 Bacteria 97907
97 Ga0070712_100179047 3300006175 Bacteria 1651
98 Ga0075366_10001077 3300006195 Bacteria 13410
99 Ga0075370_10003860 3300006353 Bacteria 7179
100 Ga0075370_10039671 3300006353 Bacteria 2654
101 Ga0075428_100074899 3300006844 Bacteria 3697
102 Ga0075430_100195894 3300006846 Bacteria 1678
103 Ga0075433_10102522 3300006852 Bacteria 2534
104 Ga0075434_100189727 3300006871 Bacteria 2075
105 Ga0068865_100025314 3300006881 Bacteria 3902
106 Ga0075436_100125677 3300006914 Bacteria 1796
107 Ga0097620_100008143 3300006931 Bacteria 10628
108 Ga0097620_100021277 3300006931 Bacteria 6508
109 Ga0105240_10044974 3300009093 Bacteria 5603
110 Ga0111539_10004693 3300009094 Bacteria 17863
111 Ga0111539_10014389 3300009094 Bacteria 9874
112 Ga0111539_10230733 3300009094 Bacteria 2155
113 Ga0105247_10261385 3300009101 Bacteria 1187
114 Ga0114129_10049496 3300009147 Bacteria 5904
115 Ga0105243_10322671 3300009148 Bacteria 1408
116 Ga0105241_10315475 3300009174 Bacteria 1346
117 Ga0105242_10073266 3300009176 Bacteria 2847
118 Ga0105242_10093782 3300009176 Bacteria 2531
119 Ga0105242_10094517 3300009176 Bacteria 2522
120 Ga0105242_10328519 3300009176 Bacteria 1405
121 Ga0105242_10479968 3300009176 Bacteria 1178
122 Ga0105248_10006838 3300009177 Bacteria 12499
123 Ga0105248_10067818 3300009177 Bacteria 4005
124 Ga0105248_10097026 3300009177 Bacteria 3321
125 Ga0105248_10506063 3300009177 Bacteria 1362
126 Ga0105248_10743896 3300009177 Bacteria 1106
127 Ga0105249_10007410 3300009553 Bacteria 9572
128 Ga0105239_10502456 3300010375 Bacteria 1378
129 Ga0163162_10168519 3300013306 Bacteria 2314
130 Ga0163162_10259175 3300013306 Unclassified 1871
131 Ga0163162_10328914 3300013306 Bacteria 1661
132 Ga0157375_10001796 3300013308 Bacteria 18404
133 Ga0157375_10095641 3300013308 Bacteria 3042
134 Ga0157375_10124207 3300013308 Bacteria 2694
135 Ga0157375_11197712 3300013308 Bacteria 891
136 Ga0163163_10057038 3300014325 Bacteria 3861
137 Ga0157380_10013529 3300014326 Bacteria 5953
138 Ga0157380_10028486 3300014326 Bacteria 4259
139 Ga0213876_10006176 3300021384 Bacteria 6535
140 Ga0207653_10000008 3300025885 Bacteria 197323
141 Ga0207653_10091950 3300025885 Unclassified 1064
142 Ga0207688_10223849 3300025901 Unclassified 1134
143 Ga0207685_10000009 3300025905 Bacteria 242842
144 Ga0207645_10203428 3300025907 Unclassified 1303
145 Ga0207643_10004221 3300025908 Bacteria 7740
146 Ga0207684_10021814 3300025910 Bacteria 5467
147 Ga0207684_10025432 3300025910 Bacteria 5044
148 Ga0207695_10043996 3300025913 Bacteria 4754
149 Ga0207660_10151027 3300025917 Bacteria 1785
150 Ga0207657_10193361 3300025919 Bacteria 1640
151 Ga0207646_10004579 3300025922 Bacteria 14960
152 Ga0207646_10021760 3300025922 Bacteria 5918
153 Ga0207681_10006123 3300025923 Bacteria 7378
154 Ga0207681_10006747 3300025923 Bacteria 7045
155 Ga0207650_10047299 3300025925 Bacteria 3170
156 Ga0207659_10065344 3300025926 Bacteria 2636
157 Ga0207644_10000070 3300025931 Bacteria 74994
158 Ga0207706_10272127 3300025933 Bacteria 1478
159 Ga0207686_10326880 3300025934 Bacteria 1148
160 Ga0207709_10087869 3300025935 Bacteria 2022
161 Ga0207670_10009992 3300025936 Bacteria 5443
162 Ga0207670_10050234 3300025936 Bacteria 2794
163 Ga0207704_10020066 3300025938 Bacteria 3527
164 Ga0207665_10024392 3300025939 Bacteria 3986
165 Ga0207691_10012570 3300025940 Bacteria 8115
166 Ga0207711_10005052 3300025941 Bacteria 11189
167 Ga0207711_10168898 3300025941 Bacteria 1984
168 Ga0207711_10258878 3300025941 Bacteria 1599
169 Ga0207689_10043483 3300025942 Bacteria 3713
170 Ga0207689_10058409 3300025942 Bacteria 3173
171 Ga0207679_10170893 3300025945 Bacteria 1789
172 Ga0207679_10238693 3300025945 Unclassified 1539
173 Ga0207651_10378197 3300025960 Bacteria 1199
174 Ga0207668_10000061 3300025972 Bacteria 89620
175 Ga0207640_10239903 3300025981 Bacteria 1400
176 Ga0207658_10026090 3300025986 Bacteria 4094
177 Ga0207677_10204429 3300026023 Unclassified 1572
178 Ga0207703_10147640 3300026035 Bacteria 2047
179 Ga0207703_10487632 3300026035 Bacteria 1155
180 Ga0207708_10006188 3300026075 Bacteria 8869
181 Ga0207708_10009020 3300026075 Bacteria 7379
182 Ga0207708_10218141 3300026075 Bacteria 1527
183 Ga0207708_10266219 3300026075 Unclassified 1385
184 Ga0207702_10246637 3300026078 Bacteria 1675
185 Ga0207641_10000024 3300026088 Bacteria 250751
186 Ga0207641_10011266 3300026088 Bacteria 7335
187 Ga0207641_10128580 3300026088 Bacteria 2271
188 Ga0207648_10000486 3300026089 Bacteria 44160
189 Ga0207648_10085142 3300026089 Bacteria 2758
190 Ga0207676_10035582 3300026095 Bacteria 3781
191 Ga0207676_10048329 3300026095 Bacteria 3302
192 Ga0207676_10051849 3300026095 Unclassified 3205
193 Ga0207676_10064156 3300026095 Bacteria 2920
194 Ga0207674_10012129 3300026116 Bacteria 9650
195 Ga0207674_10018163 3300026116 Bacteria 7652
196 Ga0207675_100014470 3300026118 Bacteria 7357
197 Ga0207675_100398595 3300026118 Bacteria 1356
198 Ga0207675_100447326 3300026118 Unclassified 1280
199 Ga0207428_10000231 3300027907 Bacteria 77049
200 Ga0268266_10000019 3300028379 Bacteria 556465
201 Ga0268266_10293656 3300028379 Unclassified 1514
202 Ga0268265_10000222 3300028380 Bacteria 65954
203 Ga0268265_10074589 3300028380 Bacteria 2654
204 Ga0268265_10293982 3300028380 Bacteria 1459
205 Ga0268265_10620985 3300028380 Unclassified 1035
206 Ga0268264_10001482 3300028381 Bacteria 21904
207 Ga0268264_10178909 3300028381 Bacteria 1924
208 Ga0265323_10001517 3300028653 Bacteria 11324
209 Ga0265316_10001548 3300031344 Bacteria 24672
210 Ga0307408_100004452 3300031548 Bacteria 9514
211 Ga0307408_100106462 3300031548 Bacteria 2146
212 Ga0307408_100367803 3300031548 Bacteria 1225
213 Ga0307405_10002843 3300031731 Bacteria 7780
214 Ga0307405_10123528 3300031731 Bacteria 1776
215 Ga0307405_10327227 3300031731 Bacteria 1173
216 Ga0307413_10136886 3300031824 Bacteria 1685
217 Ga0307413_10268460 3300031824 Bacteria 1276
218 Ga0307410_10000947 3300031852 Bacteria 12455
219 Ga0307410_10027954 3300031852 Unclassified 3570
220 Ga0307410_10054713 3300031852 Bacteria 2706
221 Ga0307406_10016526 3300031901 Bacteria 4290
222 Ga0307407_10001660 3300031903 Bacteria 8234
223 Ga0307407_10190819 3300031903 Bacteria 1365
224 Ga0307407_10193987 3300031903 Unclassified 1356
225 Ga0307407_10338791 3300031903 Bacteria 1061
226 Ga0307412_10003000 3300031911 Bacteria 9343
227 Ga0307412_10130361 3300031911 Bacteria 1825
228 Ga0307412_10328813 3300031911 Bacteria 1219
229 Ga0307409_100050611 3300031995 Unclassified 3173
230 Ga0307409_100107442 3300031995 Bacteria 2331
231 Ga0307409_100186285 3300031995 Bacteria 1843
232 Ga0307416_100033602 3300032002 Unclassified 3890
233 Ga0307416_100140042 3300032002 Bacteria 2197
234 Ga0307416_100322779 3300032002 Bacteria 1547
235 Ga0307414_10048650 3300032004 Unclassified 2926
236 Ga0307411_10006745 3300032005 Bacteria 5774
237 Ga0307411_10009984 3300032005 Bacteria 5030
238 Ga0307411_10010358 3300032005 Bacteria 4964
239 Ga0307411_10117427 3300032005 Bacteria 1917
240 Ga0307411_10142365 3300032005 Bacteria 1770
241 Ga0307415_100009661 3300032126 Bacteria 5423
242 Ga0395900_0432732 3300037418 Unclassified 1275
243 Ga0395905_0047737 3300037471 Bacteria 4011
244 Ga0395905_0054138 3300037471 Bacteria 3755
245 Ga0395905_0167342 3300037471 Bacteria 2066
246 Ga0395901_0033156 3300038443 Bacteria 5330
247 Ga0436365_0286234 3300039437 Bacteria 10730
248 Ga0439455_0028009 3300042012 Bacteria 1384
249 Ga0450918_014714 3300042531 Bacteria 1359
250 Ga0451576_0397450 3300045051 Unclassified 1445
251 Ga0495584_0213330 3300046491 Bacteria 981
252 Ga0495654_0045873 3300046530 Bacteria 2155
253 Ga0495668_0000716 3300046616 Bacteria 39924
254 Ga0495668_0045607 3300046616 Bacteria 2437
255 Ga0495668_0142964 3300046616 Unclassified 1309
256 Ga0495625_0269626 3300046660 Bacteria 1099
257 Ga0495669_0005380 3300046684 Bacteria 5339
258 Ga0495670_0111242 3300046691 Bacteria 1417
259 Ga0495670_0130706 3300046691 Bacteria 1308
260 Ga0495636_0028539 3300047318 Bacteria 2277
261 Ga0496110_0173977 3300048913 Bacteria 1954
262 Ga0496111_0499205 3300048914 Unclassified 896
263 Ga0496113_0289320 3300048916 Bacteria 1311
264 Ga0501291_006641 3300049514 Bacteria 1547
265 Ga0501295_061134 3300049518 Bacteria 825
266 Ga0501040_0084785 3300049576 Unclassified 2198
267 Ga0501048_0046123 3300049582 Bacteria 3112
268 Ga0501075_0198934 3300049591 Unclassified 1528
269 Ga0501240_010733 3300049673 Bacteria 1222
270 Ga0501249_004674 3300049679 Bacteria 2785
271 Ga0501264_005051 3300049761 Bacteria 1198
272 Ga0501272_003767 3300049769 Bacteria 1556
273 Ga0501045_0075978 3300049824 Unclassified 2474
274 nmdc:mga07m45_10034_c1 3300050496 Bacteria 4930
275 nmdc:mga07m45_24094_c1 3300050496 Bacteria 3331
276 nmdc:mga05p37_37867_c1 3300050507 Bacteria 5915
277 nmdc:mga05p37_503365_c1 3300050507 Bacteria 1389
278 nmdc:mga09592_162647_c1 3300050508 Bacteria 1928
279 nmdc:mga0qj67_227997_c1 3300050509 Unclassified 1512
280 nmdc:mga06r32_525931_c1 3300050510 Unclassified 1158
281 nmdc:mga08y16_139531_c1 3300050511 Bacteria 2520
282 nmdc:mga08y16_262630_c1 3300050511 Bacteria 1783
283 nmdc:mga0n895_135546_c1 3300050512 Bacteria 2489
284 nmdc:mga08x19_40733_c1 3300050514 Bacteria 2957
285 nmdc:mga0a205_166445_c1 3300050515 Bacteria 2100
286 nmdc:mga0a205_9116_c1 3300050515 Bacteria 9054
287 Ga0500643_023006 3300053087 Bacteria 1997
288 Ga0500658_0000128 3300053134 Bacteria 35779
289 Ga0500577_0002024 3300053142 Bacteria 5191
290 Ga0500622_0001014 3300053156 Bacteria 23572
291 Ga0501084_0096122 3300054114 Bacteria 2488
292 Ga0501084_0169722 3300054114 Unclassified 1841
293 2508735454 2508501050 Bacteria 9633614
294 2643951926 2643221588 Bacteria 3692460
295 2896431729 2896429255 Bacteria 2557483
296 Ga0070694_100092046
297 JGI24034J26672_10005730
298 JGI25406J46586_10001498
299 JGI25406J46586_10057069
300 rootL2_10065775
301 Ga0065714_10064432
302 Ga0065712_10067730
303 Ga0065712_10157547
304 Ga0065715_10092139
305 Ga0065707_10017818
306 Ga0070670_100026382
307 Ga0070670_100071814
308 Ga0070670_100424390
309 Ga0070680_100327313
310 Ga0068868_100527000
311 Ga0070689_100015630
312 Ga0070661_100161520
313 Ga0070668_100000058
314 Ga0070668_100107645
315 Ga0070669_100002306
316 Ga0070669_100010861
317 Ga0070675_100083475
318 Ga0070671_100002701
319 Ga0070671_100262050
320 Ga0070673_100199518
321 Ga0070673_100469583
322 Ga0070703_10001966
323 Ga0070701_10001411
324 Ga0070701_10089835
325 Ga0070705_100044535
326 Ga0070705_100398423
327 Ga0070700_100006885
328 Ga0070694_100002896
329 Ga0070694_100058748
330 Ga0070694_100072074
331 Ga0070694_100114774
332 Ga0070694_100132064
333 Ga0070694_100299596
334 Ga0070708_100148112
335 Ga0070662_100239067
336 Ga0068867_100001060
337 Ga0070685_10129289
338 Ga0070706_100203506
339 Ga0070706_100215276
340 Ga0070698_100018186
341 Ga0070698_100111419
342 Ga0070699_100037200
343 Ga0070699_100196834
344 Ga0070697_100005375
345 Ga0070697_100023521
346 Ga0070697_100250820
347 Ga0070672_100041797
348 Ga0070686_100010008
349 Ga0070686_100069724
350 Ga0070696_100227033
351 Ga0070693_100019135
352 Ga0070665_100000024
353 Ga0070665_100034078
354 Ga0070665_100090416
355 Ga0070704_100001101
356 Ga0070704_100005281
357 Ga0070664_100188462
358 Ga0070664_100295530
359 Ga0068857_100017950
360 Ga0068857_100099338
361 Ga0068857_100147330
362 Ga0070702_100023062
363 Ga0068859_100008144
364 Ga0068859_100021279
365 Ga0068864_100142737
366 Ga0068864_100291213
367 Ga0068866_10371199
368 Ga0068861_100007229
369 Ga0068861_100007882
370 Ga0068861_100040532
371 Ga0068870_10001713
372 Ga0068863_100000012
373 Ga0068863_100147117
374 Ga0068863_100218761
375 Ga0068858_100156696
376 Ga0068858_100197381
377 Ga0068860_100257345
378 Ga0068860_100437710
379 Ga0068862_100002477
380 Ga0068862_100011825
381 Ga0068862_100072211
382 Ga0068862_100088322
383 Ga0068862_100110369
384 Ga0068862_100240811
385 Ga0081455_10275866
386 Ga0081538_10167568
387 Ga0081539_10000243
388 Ga0081539_10003813
389 Ga0081539_10047928
390 Ga0081539_10076585
391 Ga0070715_10000026
392 Ga0070712_100179047
393 Ga0075366_10001077
394 Ga0075370_10003860
395 Ga0075370_10039671
396 Ga0075428_100074899
397 Ga0075430_100195894
398 Ga0075433_10102522
399 Ga0075434_100189727
400 Ga0068865_100025314
401 Ga0075436_100125677
402 Ga0097620_100008143
403 Ga0097620_100021277
404 Ga0105240_10044974
405 Ga0111539_10004693
406 Ga0111539_10014389
407 Ga0111539_10230733
408 Ga0105247_10261385
409 Ga0114129_10049496
410 Ga0105243_10322671
411 Ga0105241_10315475
412 Ga0105242_10073266
413 Ga0105242_10093782
414 Ga0105242_10094517
415 Ga0105242_10328519
416 Ga0105242_10479968
417 Ga0105248_10006838
418 Ga0105248_10067818
419 Ga0105248_10097026
420 Ga0105248_10506063
421 Ga0105248_10743896
422 Ga0105249_10007410
423 Ga0105239_10502456
424 Ga0163162_10168519
425 Ga0163162_10259175
426 Ga0163162_10328914
427 Ga0157375_10001796
428 Ga0157375_10095641
429 Ga0157375_10124207
430 Ga0157375_11197712
431 Ga0163163_10057038
432 Ga0157380_10013529
433 Ga0157380_10028486
434 Ga0213876_10006176
435 Ga0207653_10000008
436 Ga0207653_10091950
437 Ga0207688_10223849
438 Ga0207685_10000009
439 Ga0207645_10203428
440 Ga0207643_10004221
441 Ga0207684_10021814
442 Ga0207684_10025432
443 Ga0207695_10043996
444 Ga0207660_10151027
445 Ga0207657_10193361
446 Ga0207646_10004579
447 Ga0207646_10021760
448 Ga0207681_10006123
449 Ga0207681_10006747
450 Ga0207650_10047299
451 Ga0207659_10065344
452 Ga0207644_10000070
453 Ga0207706_10272127
454 Ga0207686_10326880
455 Ga0207709_10087869
456 Ga0207670_10009992
457 Ga0207670_10050234
458 Ga0207704_10020066
459 Ga0207665_10024392
460 Ga0207691_10012570
461 Ga0207711_10005052
462 Ga0207711_10168898
463 Ga0207711_10258878
464 Ga0207689_10043483
465 Ga0207689_10058409
466 Ga0207679_10170893
467 Ga0207679_10238693
468 Ga0207651_10378197
469 Ga0207668_10000061
470 Ga0207640_10239903
471 Ga0207658_10026090
472 Ga0207677_10204429
473 Ga0207703_10147640
474 Ga0207703_10487632
475 Ga0207708_10006188
476 Ga0207708_10009020
477 Ga0207708_10218141
478 Ga0207708_10266219
479 Ga0207702_10246637
480 Ga0207641_10000024
481 Ga0207641_10011266
482 Ga0207641_10128580
483 Ga0207648_10000486
484 Ga0207648_10085142
485 Ga0207676_10035582
486 Ga0207676_10048329
487 Ga0207676_10051849
488 Ga0207676_10064156
489 Ga0207674_10012129
490 Ga0207674_10018163
491 Ga0207675_100014470
492 Ga0207675_100398595
493 Ga0207675_100447326
494 Ga0207428_10000231
495 Ga0268266_10000019
496 Ga0268266_10293656
497 Ga0268265_10000222
498 Ga0268265_10074589
499 Ga0268265_10293982
500 Ga0268265_10620985
501 Ga0268264_10001482
502 Ga0268264_10178909
503 Ga0265323_10001517
504 Ga0265316_10001548
505 Ga0307408_100004452
506 Ga0307408_100106462
507 Ga0307408_100367803
508 Ga0307405_10002843
509 Ga0307405_10123528
510 Ga0307405_10327227
511 Ga0307413_10136886
512 Ga0307413_10268460
513 Ga0307410_10000947
514 Ga0307410_10027954
515 Ga0307410_10054713
516 Ga0307406_10016526
517 Ga0307407_10001660
518 Ga0307407_10190819
519 Ga0307407_10193987
520 Ga0307407_10338791
521 Ga0307412_10003000
522 Ga0307412_10130361
523 Ga0307412_10328813
524 Ga0307409_100050611
525 Ga0307409_100107442
526 Ga0307409_100186285
527 Ga0307416_100033602
528 Ga0307416_100140042
529 Ga0307416_100322779
530 Ga0307414_10048650
531 Ga0307411_10006745
532 Ga0307411_10009984
533 Ga0307411_10010358
534 Ga0307411_10117427
535 Ga0307411_10142365
536 Ga0307415_100009661
537 Ga0395900_0432732
538 Ga0395905_0047737
539 Ga0395905_0054138
540 Ga0395905_0167342
541 Ga0395901_0033156
542 Ga0436365_0286234
543 Ga0439455_0028009
544 Ga0450918_014714
545 Ga0451576_0397450
546 Ga0495584_0213330
547 Ga0495654_0045873
548 Ga0495668_0000716
549 Ga0495668_0045607
550 Ga0495668_0142964
551 Ga0495625_0269626
552 Ga0495669_0005380
553 Ga0495670_0111242
554 Ga0495670_0130706
555 Ga0495636_0028539
556 Ga0496110_0173977
557 Ga0496111_0499205
558 Ga0496113_0289320
559 Ga0501291_006641
560 Ga0501295_061134
561 Ga0501040_0084785
562 Ga0501048_0046123
563 Ga0501075_0198934
564 Ga0501240_010733
565 Ga0501249_004674
566 Ga0501264_005051
567 Ga0501272_003767
568 Ga0501045_0075978
569 nmdc:mga07m45_10034_c1
570 nmdc:mga07m45_24094_c1
571 nmdc:mga05p37_37867_c1
572 nmdc:mga05p37_503365_c1
573 nmdc:mga09592_162647_c1
574 nmdc:mga0qj67_227997_c1
575 nmdc:mga06r32_525931_c1
576 nmdc:mga08y16_139531_c1
577 nmdc:mga08y16_262630_c1
578 nmdc:mga0n895_135546_c1
579 nmdc:mga08x19_40733_c1
580 nmdc:mga0a205_166445_c1
581 nmdc:mga0a205_9116_c1
582 Ga0500643_023006
583 Ga0500658_0000128
584 Ga0500577_0002024
585 Ga0500622_0001014
586 Ga0501084_0096122
587 Ga0501084_0169722
588 2508735454
589 2643951926
590 2896431729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

59

293

0.98

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

63

184

0.91

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

65

299

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.9588 6 277
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.953 8 277
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9522 6 277
6eic-assembly1.cif.gz_C crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9468 6 277
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.9427 8 277
ID Description Score Start End Superfamily
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9626 6 277 3.40.50.1820
af_Q4CSM0_30_309_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9566 11 276 3.40.50.1820
af_A4I6N9_26_311_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9485 11 278 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.939 6 277 3.40.50.1820
af_A3BYJ4_101_392_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.937 1 278 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A529KHK2-F1-model_v4 Alpha/beta hydrolase 0.9687 8 206 GO:0016787
AF-A0A7I7MZ99-F1-model_v4 deleted 0.9615 4 276
AF-A0A7W1S6N4-F1-model_v4 Alpha/beta hydrolase 0.9595 6 276 GO:0016787
AF-A0A7C3BPE0-F1-model_v4 Alpha/beta hydrolase 0.9581 6 279 GO:0016787
AF-B0BZU9-F1-model_v4 Alpha/beta hydrolase fold 0.9567 6 278 GO:0016787

Map