F392431
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 164 | 288 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10153934|rootH1_101539342 |
| Length | 136 |
| Sequence | MKKSAIFGLVVIAVAIAVIISTFRSASSYVSFKEAALSNDELQVIGHLDKQKELYYDATKDANYFSFYMTDNKGEERKVVITSTKPEDFEPSQQIVVTGKMVNNEFHASKILMKCPSKYTQDKLETTEVSAKKAEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 5 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 6 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 7 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 8 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 103 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 104 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 105 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 114 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 152 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 154 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 156 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 157 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 158 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 159 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 160 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 162 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 163 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 164 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.92 |
| Metatranscriptomes | 2.37 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.47 |
| Nodule | 0 |
| Rhizoplane | 1.02 |
| Rhizosphere | 82.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1006452 | 3300001904 | Bacteria | 1973 |
| 2 | JGI24741J21665_1016410 | 3300001915 | Bacteria | 1208 |
| 3 | JGI24740J21852_10056375 | 3300001979 | Bacteria | 1101 |
| 4 | JGI24739J22299_10018147 | 3300001989 | Bacteria | 2532 |
| 5 | JGI24739J22299_10096446 | 3300001989 | Bacteria | 896 |
| 6 | JGI24739J22299_10143728 | 3300001989 | Bacteria | 707 |
| 7 | JGI24737J22298_10002813 | 3300001990 | Bacteria | 6162 |
| 8 | JGI24737J22298_10020687 | 3300001990 | Bacteria | 2099 |
| 9 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 10 | JGI24735J21928_10018273 | 3300002067 | Bacteria | 2162 |
| 11 | JGI25162J39368_1000046 | 3300002737 | Bacteria | 169695 |
| 12 | JGI25157J39369_1005637 | 3300002741 | Bacteria | 2009 |
| 13 | rootH1_10043432 | 3300003316 | Bacteria | 19858 |
| 14 | rootH1_10043432 | 3300003323 | Bacteria | 7287 |
| 15 | rootH1_10104088 | 3300003316 | Bacteria | 2279 |
| 16 | rootH1_10153934 | 3300003316 | Bacteria | 2866 |
| 17 | rootH2_10230231 | 3300003320 | Bacteria | 1431 |
| 18 | rootL2_10080111 | 3300003322 | Bacteria | 2451 |
| 19 | rootL2_10150880 | 3300003322 | Bacteria | 1736 |
| 20 | rootL2_10150881 | 3300003322 | Bacteria | 3313 |
| 21 | rootH1_10046058 | 3300003323 | Bacteria | 2423 |
| 22 | rootH1_10149021 | 3300003323 | Bacteria | 2675 |
| 23 | Ga0058861_11794555 | 3300004800 | Bacteria | 1142 |
| 24 | Ga0058862_12311791 | 3300004803 | Bacteria | 1472 |
| 25 | Ga0065714_10067151 | 3300005288 | Bacteria | 5835 |
| 26 | Ga0065714_10137189 | 3300005288 | Bacteria | 1200 |
| 27 | Ga0065714_10162470 | 3300005288 | Bacteria | 1038 |
| 28 | Ga0070658_10862263 | 3300005327 | Bacteria | 787 |
| 29 | Ga0070683_100620116 | 3300005329 | Bacteria | 1035 |
| 30 | Ga0070680_100038285 | 3300005336 | Bacteria | 3878 |
| 31 | Ga0070660_100019467 | 3300005339 | Bacteria | 4975 |
| 32 | Ga0070675_101276649 | 3300005354 | Bacteria | 676 |
| 33 | Ga0070673_102087172 | 3300005364 | Bacteria | 538 |
| 34 | Ga0070659_100000675 | 3300005366 | Bacteria | 24835 |
| 35 | Ga0070659_100002141 | 3300005366 | Bacteria | 14074 |
| 36 | Ga0070714_100100624 | 3300005435 | Bacteria | 2546 |
| 37 | Ga0070713_100427913 | 3300005436 | Bacteria | 1240 |
| 38 | Ga0070663_100260943 | 3300005455 | Bacteria | 1374 |
| 39 | Ga0070678_100816794 | 3300005456 | Bacteria | 847 |
| 40 | Ga0070681_10009041 | 3300005458 | Bacteria | 9790 |
| 41 | Ga0070679_100003041 | 3300005530 | Bacteria | 15325 |
| 42 | Ga0070679_100578912 | 3300005530 | Bacteria | 1066 |
| 43 | Ga0070684_100088361 | 3300005535 | Bacteria | 2753 |
| 44 | Ga0068853_100338770 | 3300005539 | Bacteria | 1397 |
| 45 | Ga0070665_100583231 | 3300005548 | Bacteria | 1131 |
| 46 | Ga0068855_100000139 | 3300005563 | Bacteria | 92537 |
| 47 | Ga0068855_100003439 | 3300005563 | Bacteria | 19374 |
| 48 | Ga0068855_100015802 | 3300005563 | Bacteria | 9083 |
| 49 | Ga0068855_100147120 | 3300005563 | Bacteria | 2681 |
| 50 | Ga0068855_100181548 | 3300005563 | Bacteria | 2379 |
| 51 | Ga0068855_100528662 | 3300005563 | Bacteria | 1279 |
| 52 | Ga0068855_100556004 | 3300005563 | Bacteria | 1242 |
| 53 | Ga0068857_100013637 | 3300005577 | Bacteria | 7082 |
| 54 | Ga0068857_100457933 | 3300005577 | Bacteria | 1193 |
| 55 | Ga0068854_100303517 | 3300005578 | Bacteria | 1292 |
| 56 | Ga0068856_100000935 | 3300005614 | Bacteria | 31259 |
| 57 | Ga0068856_100005544 | 3300005614 | Bacteria | 12432 |
| 58 | Ga0068856_100013420 | 3300005614 | Bacteria | 7932 |
| 59 | Ga0068856_100046870 | 3300005614 | Bacteria | 4258 |
| 60 | Ga0068856_100186861 | 3300005614 | Bacteria | 2086 |
| 61 | Ga0068856_100348974 | 3300005614 | Unclassified | 1498 |
| 62 | Ga0068856_102200889 | 3300005614 | Bacteria | 560 |
| 63 | Ga0068852_100049032 | 3300005616 | Bacteria | 3611 |
| 64 | Ga0068852_100387930 | 3300005616 | Bacteria | 1371 |
| 65 | Ga0068852_101791695 | 3300005616 | Bacteria | 636 |
| 66 | Ga0068852_102051176 | 3300005616 | Bacteria | 594 |
| 67 | Ga0068852_102330950 | 3300005616 | Bacteria | 556 |
| 68 | Ga0068866_10330982 | 3300005718 | Bacteria | 961 |
| 69 | Ga0068858_100147907 | 3300005842 | Bacteria | 2207 |
| 70 | Ga0075366_10000042 | 3300006195 | Bacteria | 45313 |
| 71 | Ga0075366_10001607 | 3300006195 | Bacteria | 11320 |
| 72 | Ga0075366_10134441 | 3300006195 | Bacteria | 1493 |
| 73 | Ga0097621_100910646 | 3300006237 | Bacteria | 819 |
| 74 | Ga0068871_101064537 | 3300006358 | Bacteria | 755 |
| 75 | Ga0105240_10049267 | 3300009093 | Bacteria | 5319 |
| 76 | Ga0105240_10050570 | 3300009093 | Bacteria | 5238 |
| 77 | Ga0105240_10056706 | 3300009093 | Bacteria | 4900 |
| 78 | Ga0105240_10164679 | 3300009093 | Bacteria | 2631 |
| 79 | Ga0105240_10489973 | 3300009093 | Bacteria | 1369 |
| 80 | Ga0105240_10536715 | 3300009093 | Bacteria | 1296 |
| 81 | Ga0105240_10739132 | 3300009093 | Bacteria | 1071 |
| 82 | Ga0105241_12367964 | 3300009174 | Bacteria | 529 |
| 83 | Ga0105237_10120732 | 3300009545 | Bacteria | 2615 |
| 84 | Ga0105237_10769393 | 3300009545 | Bacteria | 970 |
| 85 | Ga0105238_11096602 | 3300009551 | Bacteria | 819 |
| 86 | Ga0105238_11207506 | 3300009551 | Bacteria | 781 |
| 87 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 88 | Ga0105239_10000228 | 3300010375 | Bacteria | 82820 |
| 89 | Ga0105239_10001327 | 3300010375 | Bacteria | 33331 |
| 90 | Ga0105239_10002117 | 3300010375 | Bacteria | 25632 |
| 91 | Ga0105239_10193614 | 3300010375 | Bacteria | 2276 |
| 92 | Ga0105239_10215976 | 3300010375 | Bacteria | 2150 |
| 93 | Ga0157373_10000249 | 3300013100 | Bacteria | 44077 |
| 94 | Ga0157373_10024378 | 3300013100 | Bacteria | 4383 |
| 95 | Ga0157371_10000135 | 3300013102 | Bacteria | 107607 |
| 96 | Ga0157371_10013676 | 3300013102 | Bacteria | 6157 |
| 97 | Ga0157371_10053592 | 3300013102 | Bacteria | 2864 |
| 98 | Ga0157370_10038243 | 3300013104 | Bacteria | 4642 |
| 99 | Ga0157370_10343772 | 3300013104 | Bacteria | 1375 |
| 100 | Ga0157370_11236788 | 3300013104 | Bacteria | 673 |
| 101 | Ga0157370_11397523 | 3300013104 | Bacteria | 630 |
| 102 | Ga0157370_11573641 | 3300013104 | Bacteria | 591 |
| 103 | Ga0157370_11682479 | 3300013104 | Bacteria | 570 |
| 104 | Ga0157369_10000475 | 3300013105 | Bacteria | 53219 |
| 105 | Ga0157369_10057193 | 3300013105 | Bacteria | 4208 |
| 106 | Ga0157369_10140408 | 3300013105 | Bacteria | 2557 |
| 107 | Ga0157374_10308203 | 3300013296 | Bacteria | 1567 |
| 108 | Ga0157374_10421200 | 3300013296 | Bacteria | 1334 |
| 109 | Ga0157374_10738348 | 3300013296 | Bacteria | 999 |
| 110 | Ga0157374_10827104 | 3300013296 | Bacteria | 942 |
| 111 | Ga0157378_10030113 | 3300013297 | Bacteria | 4795 |
| 112 | Ga0157378_10336387 | 3300013297 | Bacteria | 1471 |
| 113 | Ga0163162_10008274 | 3300013306 | Bacteria | 10151 |
| 114 | Ga0163162_11048826 | 3300013306 | Bacteria | 923 |
| 115 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 116 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 117 | Ga0157372_10002801 | 3300013307 | Bacteria | 18838 |
| 118 | Ga0157372_10004976 | 3300013307 | Bacteria | 14115 |
| 119 | Ga0157372_11772951 | 3300013307 | Bacteria | 710 |
| 120 | Ga0157375_12104791 | 3300013308 | Bacteria | 671 |
| 121 | Ga0163161_10062579 | 3300017792 | Bacteria | 2711 |
| 122 | Ga0206356_11776924 | 3300020070 | Bacteria | 529 |
| 123 | Ga0206349_1057602 | 3300020075 | Bacteria | 607 |
| 124 | Ga0206351_10227588 | 3300020077 | Bacteria | 597 |
| 125 | Ga0206352_10073269 | 3300020078 | Bacteria | 750 |
| 126 | Ga0206352_11210051 | 3300020078 | Bacteria | 562 |
| 127 | Ga0207427_109945 | 3300025231 | Bacteria | 1005 |
| 128 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 129 | Ga0209026_1000279 | 3300025250 | Bacteria | 59283 |
| 130 | Ga0209026_1003603 | 3300025250 | Bacteria | 4984 |
| 131 | Ga0209129_1014047 | 3300025258 | Bacteria | 1725 |
| 132 | Ga0209233_1002044 | 3300025261 | Bacteria | 7647 |
| 133 | Ga0209233_1045806 | 3300025261 | Bacteria | 918 |
| 134 | Ga0209455_1006195 | 3300025272 | Bacteria | 3568 |
| 135 | Ga0207647_10000105 | 3300025904 | Bacteria | 65502 |
| 136 | Ga0207647_10062362 | 3300025904 | Bacteria | 2272 |
| 137 | Ga0207705_10000112 | 3300025909 | Bacteria | 90821 |
| 138 | Ga0207654_10016650 | 3300025911 | Bacteria | 3830 |
| 139 | Ga0207707_10010429 | 3300025912 | Bacteria | 8063 |
| 140 | Ga0207695_10117544 | 3300025913 | Bacteria | 2631 |
| 141 | Ga0207695_10460572 | 3300025913 | Bacteria | 1154 |
| 142 | Ga0207695_10477317 | 3300025913 | Bacteria | 1129 |
| 143 | Ga0207695_10586075 | 3300025913 | Bacteria | 996 |
| 144 | Ga0207695_10611596 | 3300025913 | Bacteria | 971 |
| 145 | Ga0207671_10005430 | 3300025914 | Bacteria | 11736 |
| 146 | Ga0207671_10056716 | 3300025914 | Bacteria | 2903 |
| 147 | Ga0207671_10559220 | 3300025914 | Bacteria | 912 |
| 148 | Ga0207660_10017609 | 3300025917 | Bacteria | 4750 |
| 149 | Ga0207657_10029017 | 3300025919 | Bacteria | 5042 |
| 150 | Ga0207649_10561955 | 3300025920 | Bacteria | 874 |
| 151 | Ga0207652_10014447 | 3300025921 | Bacteria | 6397 |
| 152 | Ga0207652_10976279 | 3300025921 | Bacteria | 745 |
| 153 | Ga0207664_10153036 | 3300025929 | Bacteria | 1961 |
| 154 | Ga0207664_11784559 | 3300025929 | Unclassified | 538 |
| 155 | Ga0207690_10000439 | 3300025932 | Bacteria | 27079 |
| 156 | Ga0207690_10240360 | 3300025932 | Bacteria | 1394 |
| 157 | Ga0207689_10351007 | 3300025942 | Bacteria | 1226 |
| 158 | Ga0207689_10840070 | 3300025942 | Bacteria | 775 |
| 159 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 160 | Ga0207667_10000045 | 3300025949 | Bacteria | 246053 |
| 161 | Ga0207667_10006792 | 3300025949 | Bacteria | 13818 |
| 162 | Ga0207667_10009137 | 3300025949 | Bacteria | 11708 |
| 163 | Ga0207667_10163998 | 3300025949 | Bacteria | 2285 |
| 164 | Ga0207667_11367727 | 3300025949 | Bacteria | 682 |
| 165 | Ga0207667_11391532 | 3300025949 | Bacteria | 675 |
| 166 | Ga0207640_10276300 | 3300025981 | Bacteria | 1317 |
| 167 | Ga0207703_10141339 | 3300026035 | Bacteria | 2090 |
| 168 | Ga0207639_10383592 | 3300026041 | Bacteria | 1263 |
| 169 | Ga0207678_10199135 | 3300026067 | Bacteria | 1712 |
| 170 | Ga0207702_10021058 | 3300026078 | Bacteria | 5396 |
| 171 | Ga0207702_10031438 | 3300026078 | Bacteria | 4424 |
| 172 | Ga0207702_10033727 | 3300026078 | Bacteria | 4277 |
| 173 | Ga0207702_10193921 | 3300026078 | Bacteria | 1879 |
| 174 | Ga0207702_10206928 | 3300026078 | Bacteria | 1822 |
| 175 | Ga0207702_10369418 | 3300026078 | Unclassified | 1377 |
| 176 | Ga0207674_10023125 | 3300026116 | Bacteria | 6664 |
| 177 | Ga0207674_11667486 | 3300026116 | Bacteria | 606 |
| 178 | Ga0207683_11495887 | 3300026121 | Bacteria | 623 |
| 179 | Ga0207698_10037306 | 3300026142 | Bacteria | 3578 |
| 180 | Ga0207698_11166838 | 3300026142 | Bacteria | 784 |
| 181 | Ga0207698_11580853 | 3300026142 | Bacteria | 671 |
| 182 | Ga0207698_11652964 | 3300026142 | Bacteria | 656 |
| 183 | Ga0207698_11702248 | 3300026142 | Unclassified | 646 |
| 184 | Ga0307515_10064528 | 3300028794 | Bacteria | 5118 |
| 185 | Ga0307515_10242008 | 3300028794 | Bacteria | 1573 |
| 186 | Ga0265338_10018889 | 3300028800 | Bacteria | 7350 |
| 187 | Ga0307512_10236339 | 3300030522 | Bacteria | 931 |
| 188 | Ga0265327_10002033 | 3300031251 | Bacteria | 22765 |
| 189 | Ga0307513_10963898 | 3300031456 | Bacteria | 562 |
| 190 | Ga0307509_10148207 | 3300031507 | Bacteria | 2268 |
| 191 | Ga0307508_10316389 | 3300031616 | Bacteria | 1153 |
| 192 | Ga0307516_10525606 | 3300031730 | Bacteria | 837 |
| 193 | Ga0307507_10000023 | 3300033179 | Bacteria | 212423 |
| 194 | Ga0395899_0000382 | 3300037312 | Bacteria | 52888 |
| 195 | Ga0395899_0024608 | 3300037312 | Bacteria | 4551 |
| 196 | Ga0395900_0000506 | 3300037418 | Bacteria | 54890 |
| 197 | Ga0395900_0010229 | 3300037418 | Bacteria | 9595 |
| 198 | Ga0395900_0147124 | 3300037418 | Bacteria | 2409 |
| 199 | Ga0395898_0484773 | 3300037466 | Bacteria | 1176 |
| 200 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 201 | Ga0395905_0000379 | 3300037471 | Bacteria | 63171 |
| 202 | Ga0395905_0652400 | 3300037471 | Bacteria | 954 |
| 203 | Ga0395901_0001923 | 3300038443 | Bacteria | 21386 |
| 204 | Ga0451800_1204128 | 3300041459 | Bacteria | 1032 |
| 205 | Ga0451806_780729 | 3300041462 | Bacteria | 882 |
| 206 | Ga0451839_1037602 | 3300041496 | Bacteria | 611 |
| 207 | Ga0451577_1230953 | 3300042876 | Bacteria | 667 |
| 208 | Ga0466966_0003270 | 3300044684 | Bacteria | 10682 |
| 209 | Ga0466961_0041500 | 3300044693 | Bacteria | 2950 |
| 210 | Ga0453684_0051560 | 3300044712 | Bacteria | 5391 |
| 211 | Ga0466959_0069890 | 3300045049 | Bacteria | 2544 |
| 212 | Ga0466959_0221735 | 3300045049 | Bacteria | 1311 |
| 213 | Ga0495629_0303303 | 3300046459 | Bacteria | 1093 |
| 214 | Ga0495638_0206116 | 3300046460 | Bacteria | 1107 |
| 215 | Ga0495638_0238503 | 3300046460 | Bacteria | 1008 |
| 216 | Ga0495651_0193790 | 3300046462 | Bacteria | 1428 |
| 217 | Ga0495651_0251897 | 3300046462 | Bacteria | 1205 |
| 218 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 219 | Ga0495650_0074873 | 3300046471 | Bacteria | 1319 |
| 220 | Ga0495605_0199374 | 3300046474 | Bacteria | 873 |
| 221 | Ga0495585_0000081 | 3300046492 | Bacteria | 99243 |
| 222 | Ga0495585_0000436 | 3300046492 | Bacteria | 39946 |
| 223 | Ga0495583_0077805 | 3300046506 | Bacteria | 1446 |
| 224 | Ga0495606_0000020 | 3300046507 | Bacteria | 274490 |
| 225 | Ga0495606_0073493 | 3300046507 | Bacteria | 2145 |
| 226 | Ga0495606_0077922 | 3300046507 | Bacteria | 2068 |
| 227 | Ga0495606_0659256 | 3300046507 | Bacteria | 505 |
| 228 | Ga0495608_0152242 | 3300046511 | Bacteria | 1474 |
| 229 | Ga0495608_0882321 | 3300046511 | Bacteria | 524 |
| 230 | Ga0495610_0001403 | 3300046512 | Bacteria | 21412 |
| 231 | Ga0495610_0150539 | 3300046512 | Bacteria | 993 |
| 232 | Ga0495616_0010242 | 3300046513 | Bacteria | 5436 |
| 233 | Ga0495616_0086078 | 3300046513 | Bacteria | 1495 |
| 234 | Ga0495618_0304024 | 3300046514 | Bacteria | 991 |
| 235 | Ga0495637_0074951 | 3300046520 | Bacteria | 1358 |
| 236 | Ga0495648_0004976 | 3300046524 | Bacteria | 11167 |
| 237 | Ga0495663_0226341 | 3300046525 | Bacteria | 659 |
| 238 | Ga0495652_0158377 | 3300046529 | Bacteria | 1761 |
| 239 | Ga0495652_0190214 | 3300046529 | Bacteria | 1567 |
| 240 | Ga0495652_0897294 | 3300046529 | Bacteria | 585 |
| 241 | Ga0495609_0011195 | 3300046538 | Bacteria | 4280 |
| 242 | Ga0495609_0077546 | 3300046538 | Bacteria | 1455 |
| 243 | Ga0495609_0106212 | 3300046538 | Bacteria | 1214 |
| 244 | Ga0495622_0033844 | 3300046557 | Bacteria | 2385 |
| 245 | Ga0495633_0000101 | 3300046558 | Bacteria | 116147 |
| 246 | Ga0495633_0010759 | 3300046558 | Bacteria | 4976 |
| 247 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 248 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 249 | Ga0495625_0000374 | 3300046660 | Bacteria | 68566 |
| 250 | Ga0495625_0000893 | 3300046660 | Bacteria | 40260 |
| 251 | Ga0495625_0021094 | 3300046660 | Bacteria | 5021 |
| 252 | Ga0495625_0045813 | 3300046660 | Bacteria | 3159 |
| 253 | Ga0495625_0134055 | 3300046660 | Bacteria | 1675 |
| 254 | Ga0495625_0186428 | 3300046660 | Bacteria | 1377 |
| 255 | Ga0495661_0001043 | 3300046665 | Bacteria | 24580 |
| 256 | Ga0495661_0012768 | 3300046665 | Bacteria | 5668 |
| 257 | Ga0495661_0151421 | 3300046665 | Bacteria | 1253 |
| 258 | Ga0495588_0669550 | 3300046674 | Bacteria | 543 |
| 259 | Ga0495658_0131152 | 3300046683 | Bacteria | 1525 |
| 260 | Ga0495649_0000172 | 3300046694 | Bacteria | 56537 |
| 261 | Ga0495660_0005166 | 3300046810 | Bacteria | 7844 |
| 262 | Ga0495687_011686 | 3300047443 | Bacteria | 4697 |
| 263 | Ga0495685_040273 | 3300047447 | Bacteria | 1598 |
| 264 | Ga0495686_0001273 | 3300047472 | Bacteria | 28543 |
| 265 | Ga0495686_0001934 | 3300047472 | Bacteria | 20630 |
| 266 | Ga0495686_0013412 | 3300047472 | Bacteria | 5685 |
| 267 | Ga0495686_0017005 | 3300047472 | Bacteria | 4912 |
| 268 | Ga0495686_0265619 | 3300047472 | Bacteria | 959 |
| 269 | Ga0495626_0383308 | 3300048091 | Bacteria | 545 |
| 270 | Ga0495678_022372 | 3300049459 | Bacteria | 2765 |
| 271 | Ga0495682_0120236 | 3300049460 | Bacteria | 940 |
| 272 | Ga0501293_024637 | 3300049516 | Unclassified | 611 |
| 273 | Ga0501238_017938 | 3300049671 | Bacteria | 988 |
| 274 | nmdc:mga0k408_130323_c1 | 3300050493 | Bacteria | 1493 |
| 275 | nmdc:mga0k408_19858_c1 | 3300050493 | Bacteria | 3760 |
| 276 | nmdc:mga0k408_1998_c1 | 3300050493 | Bacteria | 10944 |
| 277 | nmdc:mga0k408_2055_c1 | 3300050493 | Bacteria | 10764 |
| 278 | nmdc:mga07m45_56066_c1 | 3300050496 | Bacteria | 2227 |
| 279 | Ga0500635_0004316 | 3300053080 | Bacteria | 3655 |
| 280 | Ga0500578_0762962 | 3300053086 | Unclassified | 515 |
| 281 | Ga0500618_000158 | 3300053125 | Bacteria | 56115 |
| 282 | Ga0500642_0092207 | 3300053130 | Bacteria | 1401 |
| 283 | Ga0500559_0437406 | 3300053136 | Bacteria | 606 |
| 284 | Ga0500564_187082 | 3300053138 | Bacteria | 859 |
| 285 | Ga0500616_0401096 | 3300053153 | Bacteria | 548 |
| 286 | Ga0500622_0001415 | 3300053156 | Bacteria | 19325 |
| 287 | Ga0500624_001066 | 3300053157 | Bacteria | 5315 |
| 288 | Ga0500634_0154689 | 3300053161 | Bacteria | 1067 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10150880 | rootL2_101508802 | 109 |
| 2 | 3300046506 | Ga0495583_0077805 | Ga0495583_0077805_1016_1426 | 115 |
| 3 | 3300046512 | Ga0495610_0150539 | Ga0495610_0150539_74_484 | 115 |
| 4 | 3300001989 | JGI24739J22299_10143728 | JGI24739J22299_101437281 | 116 |
| 5 | 3300005435 | Ga0070714_100100624 | Ga0070714_1001006242 | 116 |
| 6 | 3300005436 | Ga0070713_100427913 | Ga0070713_1004279132 | 116 |
| 7 | 3300005563 | Ga0068855_100015802 | Ga0068855_1000158028 | 116 |
| 8 | 3300009093 | Ga0105240_10489973 | Ga0105240_104899734 | 116 |
| 9 | 3300010375 | Ga0105239_10193614 | Ga0105239_101936142 | 116 |
| 10 | 3300013104 | Ga0157370_11682479 | Ga0157370_116824791 | 116 |
| 11 | 3300013297 | Ga0157378_10336387 | Ga0157378_103363871 | 116 |
| 12 | 3300025261 | Ga0209233_1045806 | Ga0209233_10458062 | 116 |
| 13 | 3300025909 | Ga0207705_10000112 | Ga0207705_1000011238 | 116 |
| 14 | 3300025929 | Ga0207664_10153036 | Ga0207664_101530363 | 116 |
| 15 | 3300025949 | Ga0207667_10009137 | Ga0207667_1000913714 | 116 |
| 16 | 3300026142 | Ga0207698_11702248 | Ga0207698_117022482 | 116 |
| 17 | 3300031251 | Ga0265327_10002033 | Ga0265327_1000203316 | 116 |
| 18 | 3300049516 | Ga0501293_024637 | Ga0501293_024637_190_576 | 116 |
| 19 | 3300053153 | Ga0500616_0401096 | Ga0500616_0401096_57_443 | 116 |
| 20 | 3300013296 | Ga0157374_10308203 | Ga0157374_103082032 | 117 |
| 21 | 3300042876 | Ga0451577_1230953 | Ga0451577_1230953_61_450 | 117 |
| 22 | 3300044712 | Ga0453684_0051560 | Ga0453684_0051560_4628_5017 | 117 |
| 23 | 3300046492 | Ga0495585_0000081 | Ga0495585_0000081_2658_3068 | 117 |
| 24 | 3300046520 | Ga0495637_0074951 | Ga0495637_0074951_504_914 | 117 |
| 25 | 3300004800 | Ga0058861_11794555 | Ga0058861_117945552 | 118 |
| 26 | 3300004803 | Ga0058862_12311791 | Ga0058862_123117912 | 118 |
| 27 | 3300005336 | Ga0070680_100038285 | Ga0070680_1000382851 | 118 |
| 28 | 3300005458 | Ga0070681_10009041 | Ga0070681_100090413 | 118 |
| 29 | 3300005530 | Ga0070679_100003041 | Ga0070679_10000304112 | 118 |
| 30 | 3300025912 | Ga0207707_10010429 | Ga0207707_100104297 | 118 |
| 31 | 3300025917 | Ga0207660_10017609 | Ga0207660_100176093 | 118 |
| 32 | 3300025921 | Ga0207652_10014447 | Ga0207652_100144472 | 118 |
| 33 | 3300047472 | Ga0495686_0017005 | Ga0495686_0017005_3174_3584 | 118 |
| 34 | 3300005354 | Ga0070675_101276649 | Ga0070675_1012766491 | 119 |
| 35 | 3300005364 | Ga0070673_102087172 | Ga0070673_1020871721 | 119 |
| 36 | 3300005614 | Ga0068856_100013420 | Ga0068856_1000134203 | 119 |
| 37 | 3300005614 | Ga0068856_102200889 | Ga0068856_1022008891 | 119 |
| 38 | 3300005616 | Ga0068852_100049032 | Ga0068852_1000490322 | 119 |
| 39 | 3300005718 | Ga0068866_10330982 | Ga0068866_103309821 | 119 |
| 40 | 3300005842 | Ga0068858_100147907 | Ga0068858_1001479072 | 119 |
| 41 | 3300009093 | Ga0105240_10164679 | Ga0105240_101646792 | 119 |
| 42 | 3300013296 | Ga0157374_10421200 | Ga0157374_104212002 | 119 |
| 43 | 3300013296 | Ga0157374_10738348 | Ga0157374_107383482 | 119 |
| 44 | 3300013306 | Ga0163162_11048826 | Ga0163162_110488262 | 119 |
| 45 | 3300025913 | Ga0207695_10117544 | Ga0207695_101175442 | 119 |
| 46 | 3300026035 | Ga0207703_10141339 | Ga0207703_101413391 | 119 |
| 47 | 3300026078 | Ga0207702_10021058 | Ga0207702_100210584 | 119 |
| 48 | 3300026142 | Ga0207698_10037306 | Ga0207698_100373062 | 119 |
| 49 | 3300028800 | Ga0265338_10018889 | Ga0265338_100188897 | 119 |
| 50 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_368290_368685 | 119 |
| 51 | 3300046507 | Ga0495606_0073493 | Ga0495606_0073493_1105_1515 | 119 |
| 52 | 3300046665 | Ga0495661_0151421 | Ga0495661_0151421_824_1234 | 119 |
| 53 | 3300046810 | Ga0495660_0005166 | Ga0495660_0005166_5693_6103 | 119 |
| 54 | 3300047447 | Ga0495685_040273 | Ga0495685_040273_1114_1524 | 119 |
| 55 | 3300001989 | JGI24739J22299_10018147 | JGI24739J22299_100181473 | 120 |
| 56 | 3300001989 | JGI24739J22299_10096446 | JGI24739J22299_100964461 | 120 |
| 57 | 3300001990 | JGI24737J22298_10002813 | JGI24737J22298_100028135 | 120 |
| 58 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_10000006223 | 120 |
| 59 | 3300003316 | rootH1_10043432 | rootH1_100434322 | 120 |
| 60 | 3300003320 | rootH2_10230231 | rootH2_102302312 | 120 |
| 61 | 3300003322 | rootL2_10080111 | rootL2_100801112 | 120 |
| 62 | 3300005563 | Ga0068855_100181548 | Ga0068855_1001815482 | 120 |
| 63 | 3300009545 | Ga0105237_10769393 | Ga0105237_107693932 | 120 |
| 64 | 3300010375 | Ga0105239_10215976 | Ga0105239_102159762 | 120 |
| 65 | 3300013102 | Ga0157371_10013676 | Ga0157371_100136766 | 120 |
| 66 | 3300013105 | Ga0157369_10057193 | Ga0157369_100571932 | 120 |
| 67 | 3300013306 | Ga0163162_10008274 | Ga0163162_100082747 | 120 |
| 68 | 3300013307 | Ga0157372_10002801 | Ga0157372_1000280113 | 120 |
| 69 | 3300020078 | Ga0206352_10073269 | Ga0206352_100732692 | 120 |
| 70 | 3300025904 | Ga0207647_10062362 | Ga0207647_100623622 | 120 |
| 71 | 3300025949 | Ga0207667_11367727 | Ga0207667_113677271 | 120 |
| 72 | 3300044684 | Ga0466966_0003270 | Ga0466966_0003270_1859_2269 | 120 |
| 73 | 3300044693 | Ga0466961_0041500 | Ga0466961_0041500_1271_1681 | 120 |
| 74 | 3300045049 | Ga0466959_0221735 | Ga0466959_0221735_770_1180 | 120 |
| 75 | 3300046460 | Ga0495638_0238503 | Ga0495638_0238503_529_939 | 120 |
| 76 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_331670_332080 | 120 |
| 77 | 3300046507 | Ga0495606_0000020 | Ga0495606_0000020_240822_241232 | 120 |
| 78 | 3300046512 | Ga0495610_0001403 | Ga0495610_0001403_1399_1809 | 120 |
| 79 | 3300046513 | Ga0495616_0086078 | Ga0495616_0086078_889_1299 | 120 |
| 80 | 3300046529 | Ga0495652_0190214 | Ga0495652_0190214_728_1138 | 120 |
| 81 | 3300046538 | Ga0495609_0106212 | Ga0495609_0106212_258_668 | 120 |
| 82 | 3300046558 | Ga0495633_0010759 | Ga0495633_0010759_1291_1701 | 120 |
| 83 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_295475_295885 | 120 |
| 84 | 3300046665 | Ga0495661_0012768 | Ga0495661_0012768_1384_1794 | 120 |
| 85 | 3300046694 | Ga0495649_0000172 | Ga0495649_0000172_46592_47002 | 120 |
| 86 | 3300047443 | Ga0495687_011686 | Ga0495687_011686_3889_4299 | 120 |
| 87 | 3300047472 | Ga0495686_0265619 | Ga0495686_0265619_323_733 | 120 |
| 88 | 3300050493 | nmdc:mga0k408_19858_c1 | nmdc:mga0k408_19858_c1_1381_1791 | 120 |
| 89 | 3300001915 | JGI24741J21665_1016410 | JGI24741J21665_10164102 | 121 |
| 90 | 3300005455 | Ga0070663_100260943 | Ga0070663_1002609431 | 121 |
| 91 | 3300005563 | Ga0068855_100003439 | Ga0068855_1000034394 | 121 |
| 92 | 3300005614 | Ga0068856_100046870 | Ga0068856_1000468704 | 121 |
| 93 | 3300013102 | Ga0157371_10053592 | Ga0157371_100535922 | 121 |
| 94 | 3300013105 | Ga0157369_10000475 | Ga0157369_1000047529 | 121 |
| 95 | 3300013307 | Ga0157372_10000017 | Ga0157372_10000017180 | 121 |
| 96 | 3300020077 | Ga0206351_10227588 | Ga0206351_102275881 | 121 |
| 97 | 3300025949 | Ga0207667_10006792 | Ga0207667_1000679211 | 121 |
| 98 | 3300026067 | Ga0207678_10199135 | Ga0207678_101991351 | 121 |
| 99 | 3300026078 | Ga0207702_10033727 | Ga0207702_100337272 | 121 |
| 100 | 3300037312 | Ga0395899_0000382 | Ga0395899_0000382_45047_45457 | 121 |
| 101 | iso_pu_bacteria | 2599185184 | 2599477029 | 121 |
| 102 | iso_pu_bacteria | 2919437846 | 2919442344 | 121 |
| 103 | iso_pu_bacteria | 2928078545 | 2928078943 | 121 |
| 104 | iso_pu_bacteria | 2928147474 | 2928148691 | 121 |
| 105 | iso_pu_bacteria | 2932082852 | 2932085591 | 121 |
| 106 | iso_pu_bacteria | 2977232053 | 2977236859 | 121 |
| 107 | 3300050496 | nmdc:mga07m45_56066_c1 | nmdc:mga07m45_56066_c1_852_1262 | 122 |
| 108 | iso_pu_bacteria | 2852623160 | 2852624040 | 122 |
| 109 | iso_pu_bacteria | 2884933994 | 2884937038 | 122 |
| 110 | 3300013104 | Ga0157370_10343772 | Ga0157370_103437722 | 124 |
| 111 | 3300025250 | Ga0209026_1003603 | Ga0209026_10036033 | 124 |
| 112 | 3300026116 | Ga0207674_11667486 | Ga0207674_116674861 | 124 |
| 113 | 3300002737 | JGI25162J39368_1000046 | JGI25162J39368_100004612 | 125 |
| 114 | 3300002741 | JGI25157J39369_1005637 | JGI25157J39369_10056372 | 125 |
| 115 | 3300003316 | rootH1_10104088 | rootH1_101040884 | 125 |
| 116 | 3300003316 | rootH1_10153934 | rootH1_101539342 | 125 |
| 117 | 3300003322 | rootL2_10150881 | rootL2_101508812 | 125 |
| 118 | 3300003323 | rootH1_10046058 | rootH1_100460582 | 125 |
| 119 | 3300003323 | rootH1_10149021 | rootH1_101490212 | 125 |
| 120 | 3300005288 | Ga0065714_10067151 | Ga0065714_100671514 | 125 |
| 121 | 3300005288 | Ga0065714_10137189 | Ga0065714_101371892 | 125 |
| 122 | 3300005288 | Ga0065714_10162470 | Ga0065714_101624702 | 125 |
| 123 | 3300005327 | Ga0070658_10862263 | Ga0070658_108622631 | 125 |
| 124 | 3300005329 | Ga0070683_100620116 | Ga0070683_1006201162 | 125 |
| 125 | 3300005339 | Ga0070660_100019467 | Ga0070660_1000194672 | 125 |
| 126 | 3300005366 | Ga0070659_100000675 | Ga0070659_10000067516 | 125 |
| 127 | 3300005456 | Ga0070678_100816794 | Ga0070678_1008167941 | 125 |
| 128 | 3300005530 | Ga0070679_100578912 | Ga0070679_1005789122 | 125 |
| 129 | 3300005535 | Ga0070684_100088361 | Ga0070684_1000883614 | 125 |
| 130 | 3300005539 | Ga0068853_100338770 | Ga0068853_1003387702 | 125 |
| 131 | 3300005548 | Ga0070665_100583231 | Ga0070665_1005832312 | 125 |
| 132 | 3300005563 | Ga0068855_100000139 | Ga0068855_10000013941 | 125 |
| 133 | 3300005563 | Ga0068855_100528662 | Ga0068855_1005286622 | 125 |
| 134 | 3300005563 | Ga0068855_100556004 | Ga0068855_1005560042 | 125 |
| 135 | 3300005577 | Ga0068857_100457933 | Ga0068857_1004579332 | 125 |
| 136 | 3300005578 | Ga0068854_100303517 | Ga0068854_1003035172 | 125 |
| 137 | 3300005614 | Ga0068856_100000935 | Ga0068856_1000009354 | 125 |
| 138 | 3300005614 | Ga0068856_100005544 | Ga0068856_10000554411 | 125 |
| 139 | 3300005614 | Ga0068856_100186861 | Ga0068856_1001868612 | 125 |
| 140 | 3300005614 | Ga0068856_100348974 | Ga0068856_1003489743 | 125 |
| 141 | 3300005616 | Ga0068852_101791695 | Ga0068852_1017916951 | 125 |
| 142 | 3300005616 | Ga0068852_102051176 | Ga0068852_1020511761 | 125 |
| 143 | 3300005616 | Ga0068852_102330950 | Ga0068852_1023309501 | 125 |
| 144 | 3300006195 | Ga0075366_10000042 | Ga0075366_1000004239 | 125 |
| 145 | 3300006195 | Ga0075366_10001607 | Ga0075366_100016077 | 125 |
| 146 | 3300006195 | Ga0075366_10134441 | Ga0075366_101344413 | 125 |
| 147 | 3300006237 | Ga0097621_100910646 | Ga0097621_1009106462 | 125 |
| 148 | 3300006358 | Ga0068871_101064537 | Ga0068871_1010645372 | 125 |
| 149 | 3300009093 | Ga0105240_10049267 | Ga0105240_100492671 | 125 |
| 150 | 3300009093 | Ga0105240_10050570 | Ga0105240_100505703 | 125 |
| 151 | 3300009093 | Ga0105240_10056706 | Ga0105240_100567062 | 125 |
| 152 | 3300009093 | Ga0105240_10536715 | Ga0105240_105367152 | 125 |
| 153 | 3300009093 | Ga0105240_10739132 | Ga0105240_107391321 | 125 |
| 154 | 3300009174 | Ga0105241_12367964 | Ga0105241_123679641 | 125 |
| 155 | 3300009545 | Ga0105237_10120732 | Ga0105237_101207322 | 125 |
| 156 | 3300009551 | Ga0105238_11096602 | Ga0105238_110966022 | 125 |
| 157 | 3300009551 | Ga0105238_11207506 | Ga0105238_112075061 | 125 |
| 158 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002119 | 125 |
| 159 | 3300010375 | Ga0105239_10000228 | Ga0105239_1000022849 | 125 |
| 160 | 3300010375 | Ga0105239_10001327 | Ga0105239_100013273 | 125 |
| 161 | 3300010375 | Ga0105239_10002117 | Ga0105239_1000211720 | 125 |
| 162 | 3300013100 | Ga0157373_10000249 | Ga0157373_1000024917 | 125 |
| 163 | 3300013104 | Ga0157370_11236788 | Ga0157370_112367882 | 125 |
| 164 | 3300013104 | Ga0157370_11397523 | Ga0157370_113975232 | 125 |
| 165 | 3300013104 | Ga0157370_11573641 | Ga0157370_115736411 | 125 |
| 166 | 3300013296 | Ga0157374_10827104 | Ga0157374_108271042 | 125 |
| 167 | 3300013297 | Ga0157378_10030113 | Ga0157378_100301133 | 125 |
| 168 | 3300013307 | Ga0157372_10004976 | Ga0157372_100049762 | 125 |
| 169 | 3300013307 | Ga0157372_11772951 | Ga0157372_117729512 | 125 |
| 170 | 3300013308 | Ga0157375_12104791 | Ga0157375_121047911 | 125 |
| 171 | 3300017792 | Ga0163161_10062579 | Ga0163161_100625793 | 125 |
| 172 | 3300020075 | Ga0206349_1057602 | Ga0206349_10576021 | 125 |
| 173 | 3300025233 | Ga0209437_100070 | Ga0209437_10007085 | 125 |
| 174 | 3300025250 | Ga0209026_1000279 | Ga0209026_100027914 | 125 |
| 175 | 3300025258 | Ga0209129_1014047 | Ga0209129_10140472 | 125 |
| 176 | 3300025272 | Ga0209455_1006195 | Ga0209455_10061952 | 125 |
| 177 | 3300025911 | Ga0207654_10016650 | Ga0207654_100166502 | 125 |
| 178 | 3300025913 | Ga0207695_10460572 | Ga0207695_104605721 | 125 |
| 179 | 3300025913 | Ga0207695_10477317 | Ga0207695_104773172 | 125 |
| 180 | 3300025913 | Ga0207695_10586075 | Ga0207695_105860752 | 125 |
| 181 | 3300025913 | Ga0207695_10611596 | Ga0207695_106115961 | 125 |
| 182 | 3300025914 | Ga0207671_10005430 | Ga0207671_100054304 | 125 |
| 183 | 3300025914 | Ga0207671_10056716 | Ga0207671_100567163 | 125 |
| 184 | 3300025914 | Ga0207671_10559220 | Ga0207671_105592202 | 125 |
| 185 | 3300025919 | Ga0207657_10029017 | Ga0207657_100290174 | 125 |
| 186 | 3300025920 | Ga0207649_10561955 | Ga0207649_105619552 | 125 |
| 187 | 3300025921 | Ga0207652_10976279 | Ga0207652_109762791 | 125 |
| 188 | 3300025929 | Ga0207664_11784559 | Ga0207664_117845592 | 125 |
| 189 | 3300025932 | Ga0207690_10000439 | Ga0207690_1000043914 | 125 |
| 190 | 3300025942 | Ga0207689_10351007 | Ga0207689_103510072 | 125 |
| 191 | 3300025942 | Ga0207689_10840070 | Ga0207689_108400702 | 125 |
| 192 | 3300025949 | Ga0207667_10000033 | Ga0207667_1000003340 | 125 |
| 193 | 3300025949 | Ga0207667_10000045 | Ga0207667_1000004512 | 125 |
| 194 | 3300025949 | Ga0207667_11391532 | Ga0207667_113915322 | 125 |
| 195 | 3300025981 | Ga0207640_10276300 | Ga0207640_102763002 | 125 |
| 196 | 3300026041 | Ga0207639_10383592 | Ga0207639_103835922 | 125 |
| 197 | 3300026078 | Ga0207702_10031438 | Ga0207702_100314384 | 125 |
| 198 | 3300026078 | Ga0207702_10193921 | Ga0207702_101939212 | 125 |
| 199 | 3300026078 | Ga0207702_10206928 | Ga0207702_102069282 | 125 |
| 200 | 3300026078 | Ga0207702_10369418 | Ga0207702_103694183 | 125 |
| 201 | 3300026121 | Ga0207683_11495887 | Ga0207683_114958871 | 125 |
| 202 | 3300026142 | Ga0207698_11166838 | Ga0207698_111668382 | 125 |
| 203 | 3300026142 | Ga0207698_11580853 | Ga0207698_115808532 | 125 |
| 204 | 3300026142 | Ga0207698_11652964 | Ga0207698_116529641 | 125 |
| 205 | 3300028794 | Ga0307515_10064528 | Ga0307515_100645285 | 125 |
| 206 | 3300028794 | Ga0307515_10242008 | Ga0307515_102420082 | 125 |
| 207 | 3300030522 | Ga0307512_10236339 | Ga0307512_102363391 | 125 |
| 208 | 3300031456 | Ga0307513_10963898 | Ga0307513_109638981 | 125 |
| 209 | 3300031507 | Ga0307509_10148207 | Ga0307509_101482072 | 125 |
| 210 | 3300031616 | Ga0307508_10316389 | Ga0307508_103163891 | 125 |
| 211 | 3300031730 | Ga0307516_10525606 | Ga0307516_105256062 | 125 |
| 212 | 3300033179 | Ga0307507_10000023 | Ga0307507_10000023188 | 125 |
| 213 | 3300037312 | Ga0395899_0024608 | Ga0395899_0024608_1282_1692 | 125 |
| 214 | 3300037418 | Ga0395900_0000506 | Ga0395900_0000506_679_1089 | 125 |
| 215 | 3300037418 | Ga0395900_0010229 | Ga0395900_0010229_7330_7740 | 125 |
| 216 | 3300037466 | Ga0395898_0484773 | Ga0395898_0484773_506_916 | 125 |
| 217 | 3300037471 | Ga0395905_0000379 | Ga0395905_0000379_10151_10561 | 125 |
| 218 | 3300038443 | Ga0395901_0001923 | Ga0395901_0001923_1976_2386 | 125 |
| 219 | 3300041459 | Ga0451800_1204128 | Ga0451800_1204128_43_456 | 125 |
| 220 | 3300041462 | Ga0451806_780729 | Ga0451806_780729_203_616 | 125 |
| 221 | 3300041496 | Ga0451839_1037602 | Ga0451839_1037602_166_576 | 125 |
| 222 | 3300045049 | Ga0466959_0069890 | Ga0466959_0069890_1438_1848 | 125 |
| 223 | 3300046459 | Ga0495629_0303303 | Ga0495629_0303303_277_687 | 125 |
| 224 | 3300046460 | Ga0495638_0206116 | Ga0495638_0206116_467_877 | 125 |
| 225 | 3300046462 | Ga0495651_0193790 | Ga0495651_0193790_761_1171 | 125 |
| 226 | 3300046462 | Ga0495651_0251897 | Ga0495651_0251897_295_705 | 125 |
| 227 | 3300046471 | Ga0495650_0074873 | Ga0495650_0074873_253_663 | 125 |
| 228 | 3300046474 | Ga0495605_0199374 | Ga0495605_0199374_20_430 | 125 |
| 229 | 3300046492 | Ga0495585_0000436 | Ga0495585_0000436_2243_2653 | 125 |
| 230 | 3300046507 | Ga0495606_0077922 | Ga0495606_0077922_579_989 | 125 |
| 231 | 3300046507 | Ga0495606_0659256 | Ga0495606_0659256_21_431 | 125 |
| 232 | 3300046511 | Ga0495608_0152242 | Ga0495608_0152242_433_843 | 125 |
| 233 | 3300046511 | Ga0495608_0882321 | Ga0495608_0882321_68_478 | 125 |
| 234 | 3300046513 | Ga0495616_0010242 | Ga0495616_0010242_4843_5253 | 125 |
| 235 | 3300046514 | Ga0495618_0304024 | Ga0495618_0304024_316_726 | 125 |
| 236 | 3300046524 | Ga0495648_0004976 | Ga0495648_0004976_5656_6066 | 125 |
| 237 | 3300046525 | Ga0495663_0226341 | Ga0495663_0226341_118_528 | 125 |
| 238 | 3300046529 | Ga0495652_0158377 | Ga0495652_0158377_1268_1678 | 125 |
| 239 | 3300046529 | Ga0495652_0897294 | Ga0495652_0897294_55_465 | 125 |
| 240 | 3300046538 | Ga0495609_0011195 | Ga0495609_0011195_1484_1894 | 125 |
| 241 | 3300046538 | Ga0495609_0077546 | Ga0495609_0077546_480_890 | 125 |
| 242 | 3300046557 | Ga0495622_0033844 | Ga0495622_0033844_1102_1512 | 125 |
| 243 | 3300046558 | Ga0495633_0000101 | Ga0495633_0000101_50473_50883 | 125 |
| 244 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_119874_120284 | 125 |
| 245 | 3300046660 | Ga0495625_0000374 | Ga0495625_0000374_5862_6272 | 125 |
| 246 | 3300046660 | Ga0495625_0000893 | Ga0495625_0000893_38938_39348 | 125 |
| 247 | 3300046660 | Ga0495625_0021094 | Ga0495625_0021094_3201_3611 | 125 |
| 248 | 3300046660 | Ga0495625_0045813 | Ga0495625_0045813_2698_3108 | 125 |
| 249 | 3300046660 | Ga0495625_0134055 | Ga0495625_0134055_944_1354 | 125 |
| 250 | 3300046660 | Ga0495625_0186428 | Ga0495625_0186428_956_1366 | 125 |
| 251 | 3300046665 | Ga0495661_0001043 | Ga0495661_0001043_12937_13347 | 125 |
| 252 | 3300046674 | Ga0495588_0669550 | Ga0495588_0669550_29_439 | 125 |
| 253 | 3300046683 | Ga0495658_0131152 | Ga0495658_0131152_432_842 | 125 |
| 254 | 3300047472 | Ga0495686_0001273 | Ga0495686_0001273_23985_24395 | 125 |
| 255 | 3300047472 | Ga0495686_0001934 | Ga0495686_0001934_1529_1939 | 125 |
| 256 | 3300047472 | Ga0495686_0013412 | Ga0495686_0013412_2455_2865 | 125 |
| 257 | 3300048091 | Ga0495626_0383308 | Ga0495626_0383308_42_452 | 125 |
| 258 | 3300049459 | Ga0495678_022372 | Ga0495678_022372_870_1280 | 125 |
| 259 | 3300049460 | Ga0495682_0120236 | Ga0495682_0120236_152_562 | 125 |
| 260 | 3300049671 | Ga0501238_017938 | Ga0501238_017938_497_910 | 125 |
| 261 | 3300050493 | nmdc:mga0k408_130323_c1 | nmdc:mga0k408_130323_c1_451_861 | 125 |
| 262 | 3300050493 | nmdc:mga0k408_1998_c1 | nmdc:mga0k408_1998_c1_1335_1745 | 125 |
| 263 | 3300050493 | nmdc:mga0k408_2055_c1 | nmdc:mga0k408_2055_c1_2720_3130 | 125 |
| 264 | 3300053080 | Ga0500635_0004316 | Ga0500635_0004316_1856_2266 | 125 |
| 265 | 3300053086 | Ga0500578_0762962 | Ga0500578_0762962_38_448 | 125 |
| 266 | 3300053125 | Ga0500618_000158 | Ga0500618_000158_10707_11117 | 125 |
| 267 | 3300053130 | Ga0500642_0092207 | Ga0500642_0092207_115_525 | 125 |
| 268 | 3300053136 | Ga0500559_0437406 | Ga0500559_0437406_85_495 | 125 |
| 269 | 3300053138 | Ga0500564_187082 | Ga0500564_187082_118_528 | 125 |
| 270 | 3300053156 | Ga0500622_0001415 | Ga0500622_0001415_10851_11261 | 125 |
| 271 | 3300053157 | Ga0500624_001066 | Ga0500624_001066_303_713 | 125 |
| 272 | 3300053161 | Ga0500634_0154689 | Ga0500634_0154689_427_837 | 125 |
| 273 | 3300001904 | JGI24736J21556_1006452 | JGI24736J21556_10064522 | 126 |
| 274 | 3300001979 | JGI24740J21852_10056375 | JGI24740J21852_100563751 | 126 |
| 275 | 3300001990 | JGI24737J22298_10020687 | JGI24737J22298_100206872 | 126 |
| 276 | 3300002067 | JGI24735J21928_10018273 | JGI24735J21928_100182732 | 126 |
| 277 | 3300005366 | Ga0070659_100002141 | Ga0070659_1000021412 | 126 |
| 278 | 3300005563 | Ga0068855_100147120 | Ga0068855_1001471203 | 126 |
| 279 | 3300005577 | Ga0068857_100013637 | Ga0068857_1000136372 | 126 |
| 280 | 3300005616 | Ga0068852_100387930 | Ga0068852_1003879302 | 126 |
| 281 | 3300013100 | Ga0157373_10024378 | Ga0157373_100243782 | 126 |
| 282 | 3300013102 | Ga0157371_10000135 | Ga0157371_1000013582 | 126 |
| 283 | 3300013104 | Ga0157370_10038243 | Ga0157370_100382433 | 126 |
| 284 | 3300013105 | Ga0157369_10140408 | Ga0157369_101404082 | 126 |
| 285 | 3300013307 | Ga0157372_10000061 | Ga0157372_1000006171 | 126 |
| 286 | 3300020070 | Ga0206356_11776924 | Ga0206356_117769242 | 126 |
| 287 | 3300020078 | Ga0206352_11210051 | Ga0206352_112100511 | 126 |
| 288 | 3300025231 | Ga0207427_109945 | Ga0207427_1099452 | 126 |
| 289 | 3300025261 | Ga0209233_1002044 | Ga0209233_10020446 | 126 |
| 290 | 3300025904 | Ga0207647_10000105 | Ga0207647_100001053 | 126 |
| 291 | 3300025932 | Ga0207690_10240360 | Ga0207690_102403602 | 126 |
| 292 | 3300025949 | Ga0207667_10163998 | Ga0207667_101639983 | 126 |
| 293 | 3300026116 | Ga0207674_10023125 | Ga0207674_100231257 | 126 |
| 294 | 3300037418 | Ga0395900_0147124 | Ga0395900_0147124_1404_1817 | 126 |
| 295 | 3300037471 | Ga0395905_0652400 | Ga0395905_0652400_418_831 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.7883 | 30 | 105 |
| 1gqy-assembly1.cif.gz_A | murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp | 0.7607 | 35 | 72 |
| 8ewa-assembly1.cif.gz_B | crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13644923 | 0.7561 | 35 | 74 |
| 8egn-assembly1.cif.gz_B | crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13643701 | 0.745 | 35 | 74 |
| 1w3s-assembly1.cif.gz_A | the crystal structure of reco from deinococcus radiodurans. | 0.743 | 30 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7883 | 30 | 105 | 2.40.50.140 |
| af_Q9VYW3_3_112_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7788 | 25 | 102 | 2.40.50.140 |
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7385 | 13 | 101 | 2.40.50.140 |
| 3f8tA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7377 | 18 | 103 | 2.40.50.140 |
| 4gopA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7285 | 16 | 102 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3GID9-F1-model_v4 | deleted | 0.9791 | 15 | 91 |
|
| AF-A0A291QX18-F1-model_v4 | Cytochrome C biogenesis protein | 0.9727 | 16 | 108 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A520BP89-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9492 | 14 | 108 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A350C4S6-F1-model_v4 | Cytochrome C biogenesis protein | 0.9489 | 16 | 110 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A7V5VXL4-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9483 | 17 | 98 |
GO:0005886
GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar