F392431

General Info

Members Datasets Scaffolds Average Seq Length
295 164 288 126

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10153934|rootH1_101539342
Length 136
Sequence MKKSAIFGLVVIAVAIAVIISTFRSASSYVSFKEAALSNDELQVIGHLDKQKELYYDATKDANYFSFYMTDNKGEERKVVITSTKPEDFEPSQQIVVTGKMVNNEFHASKILMKCPSKYTQDKLETTEVSAKKAEI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
152 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
164 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 2.37
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0
Rhizoplane 1.02
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006452 3300001904 Bacteria 1973
2 JGI24741J21665_1016410 3300001915 Bacteria 1208
3 JGI24740J21852_10056375 3300001979 Bacteria 1101
4 JGI24739J22299_10018147 3300001989 Bacteria 2532
5 JGI24739J22299_10096446 3300001989 Bacteria 896
6 JGI24739J22299_10143728 3300001989 Bacteria 707
7 JGI24737J22298_10002813 3300001990 Bacteria 6162
8 JGI24737J22298_10020687 3300001990 Bacteria 2099
9 JGI24735J21928_10000006 3300002067 Bacteria 339303
10 JGI24735J21928_10018273 3300002067 Bacteria 2162
11 JGI25162J39368_1000046 3300002737 Bacteria 169695
12 JGI25157J39369_1005637 3300002741 Bacteria 2009
13 rootH1_10043432 3300003316 Bacteria 19858
14 rootH1_10043432 3300003323 Bacteria 7287
15 rootH1_10104088 3300003316 Bacteria 2279
16 rootH1_10153934 3300003316 Bacteria 2866
17 rootH2_10230231 3300003320 Bacteria 1431
18 rootL2_10080111 3300003322 Bacteria 2451
19 rootL2_10150880 3300003322 Bacteria 1736
20 rootL2_10150881 3300003322 Bacteria 3313
21 rootH1_10046058 3300003323 Bacteria 2423
22 rootH1_10149021 3300003323 Bacteria 2675
23 Ga0058861_11794555 3300004800 Bacteria 1142
24 Ga0058862_12311791 3300004803 Bacteria 1472
25 Ga0065714_10067151 3300005288 Bacteria 5835
26 Ga0065714_10137189 3300005288 Bacteria 1200
27 Ga0065714_10162470 3300005288 Bacteria 1038
28 Ga0070658_10862263 3300005327 Bacteria 787
29 Ga0070683_100620116 3300005329 Bacteria 1035
30 Ga0070680_100038285 3300005336 Bacteria 3878
31 Ga0070660_100019467 3300005339 Bacteria 4975
32 Ga0070675_101276649 3300005354 Bacteria 676
33 Ga0070673_102087172 3300005364 Bacteria 538
34 Ga0070659_100000675 3300005366 Bacteria 24835
35 Ga0070659_100002141 3300005366 Bacteria 14074
36 Ga0070714_100100624 3300005435 Bacteria 2546
37 Ga0070713_100427913 3300005436 Bacteria 1240
38 Ga0070663_100260943 3300005455 Bacteria 1374
39 Ga0070678_100816794 3300005456 Bacteria 847
40 Ga0070681_10009041 3300005458 Bacteria 9790
41 Ga0070679_100003041 3300005530 Bacteria 15325
42 Ga0070679_100578912 3300005530 Bacteria 1066
43 Ga0070684_100088361 3300005535 Bacteria 2753
44 Ga0068853_100338770 3300005539 Bacteria 1397
45 Ga0070665_100583231 3300005548 Bacteria 1131
46 Ga0068855_100000139 3300005563 Bacteria 92537
47 Ga0068855_100003439 3300005563 Bacteria 19374
48 Ga0068855_100015802 3300005563 Bacteria 9083
49 Ga0068855_100147120 3300005563 Bacteria 2681
50 Ga0068855_100181548 3300005563 Bacteria 2379
51 Ga0068855_100528662 3300005563 Bacteria 1279
52 Ga0068855_100556004 3300005563 Bacteria 1242
53 Ga0068857_100013637 3300005577 Bacteria 7082
54 Ga0068857_100457933 3300005577 Bacteria 1193
55 Ga0068854_100303517 3300005578 Bacteria 1292
56 Ga0068856_100000935 3300005614 Bacteria 31259
57 Ga0068856_100005544 3300005614 Bacteria 12432
58 Ga0068856_100013420 3300005614 Bacteria 7932
59 Ga0068856_100046870 3300005614 Bacteria 4258
60 Ga0068856_100186861 3300005614 Bacteria 2086
61 Ga0068856_100348974 3300005614 Unclassified 1498
62 Ga0068856_102200889 3300005614 Bacteria 560
63 Ga0068852_100049032 3300005616 Bacteria 3611
64 Ga0068852_100387930 3300005616 Bacteria 1371
65 Ga0068852_101791695 3300005616 Bacteria 636
66 Ga0068852_102051176 3300005616 Bacteria 594
67 Ga0068852_102330950 3300005616 Bacteria 556
68 Ga0068866_10330982 3300005718 Bacteria 961
69 Ga0068858_100147907 3300005842 Bacteria 2207
70 Ga0075366_10000042 3300006195 Bacteria 45313
71 Ga0075366_10001607 3300006195 Bacteria 11320
72 Ga0075366_10134441 3300006195 Bacteria 1493
73 Ga0097621_100910646 3300006237 Bacteria 819
74 Ga0068871_101064537 3300006358 Bacteria 755
75 Ga0105240_10049267 3300009093 Bacteria 5319
76 Ga0105240_10050570 3300009093 Bacteria 5238
77 Ga0105240_10056706 3300009093 Bacteria 4900
78 Ga0105240_10164679 3300009093 Bacteria 2631
79 Ga0105240_10489973 3300009093 Bacteria 1369
80 Ga0105240_10536715 3300009093 Bacteria 1296
81 Ga0105240_10739132 3300009093 Bacteria 1071
82 Ga0105241_12367964 3300009174 Bacteria 529
83 Ga0105237_10120732 3300009545 Bacteria 2615
84 Ga0105237_10769393 3300009545 Bacteria 970
85 Ga0105238_11096602 3300009551 Bacteria 819
86 Ga0105238_11207506 3300009551 Bacteria 781
87 Ga0105239_10000002 3300010375 Bacteria 610298
88 Ga0105239_10000228 3300010375 Bacteria 82820
89 Ga0105239_10001327 3300010375 Bacteria 33331
90 Ga0105239_10002117 3300010375 Bacteria 25632
91 Ga0105239_10193614 3300010375 Bacteria 2276
92 Ga0105239_10215976 3300010375 Bacteria 2150
93 Ga0157373_10000249 3300013100 Bacteria 44077
94 Ga0157373_10024378 3300013100 Bacteria 4383
95 Ga0157371_10000135 3300013102 Bacteria 107607
96 Ga0157371_10013676 3300013102 Bacteria 6157
97 Ga0157371_10053592 3300013102 Bacteria 2864
98 Ga0157370_10038243 3300013104 Bacteria 4642
99 Ga0157370_10343772 3300013104 Bacteria 1375
100 Ga0157370_11236788 3300013104 Bacteria 673
101 Ga0157370_11397523 3300013104 Bacteria 630
102 Ga0157370_11573641 3300013104 Bacteria 591
103 Ga0157370_11682479 3300013104 Bacteria 570
104 Ga0157369_10000475 3300013105 Bacteria 53219
105 Ga0157369_10057193 3300013105 Bacteria 4208
106 Ga0157369_10140408 3300013105 Bacteria 2557
107 Ga0157374_10308203 3300013296 Bacteria 1567
108 Ga0157374_10421200 3300013296 Bacteria 1334
109 Ga0157374_10738348 3300013296 Bacteria 999
110 Ga0157374_10827104 3300013296 Bacteria 942
111 Ga0157378_10030113 3300013297 Bacteria 4795
112 Ga0157378_10336387 3300013297 Bacteria 1471
113 Ga0163162_10008274 3300013306 Bacteria 10151
114 Ga0163162_11048826 3300013306 Bacteria 923
115 Ga0157372_10000017 3300013307 Bacteria 219543
116 Ga0157372_10000061 3300013307 Bacteria 119814
117 Ga0157372_10002801 3300013307 Bacteria 18838
118 Ga0157372_10004976 3300013307 Bacteria 14115
119 Ga0157372_11772951 3300013307 Bacteria 710
120 Ga0157375_12104791 3300013308 Bacteria 671
121 Ga0163161_10062579 3300017792 Bacteria 2711
122 Ga0206356_11776924 3300020070 Bacteria 529
123 Ga0206349_1057602 3300020075 Bacteria 607
124 Ga0206351_10227588 3300020077 Bacteria 597
125 Ga0206352_10073269 3300020078 Bacteria 750
126 Ga0206352_11210051 3300020078 Bacteria 562
127 Ga0207427_109945 3300025231 Bacteria 1005
128 Ga0209437_100070 3300025233 Bacteria 306718
129 Ga0209026_1000279 3300025250 Bacteria 59283
130 Ga0209026_1003603 3300025250 Bacteria 4984
131 Ga0209129_1014047 3300025258 Bacteria 1725
132 Ga0209233_1002044 3300025261 Bacteria 7647
133 Ga0209233_1045806 3300025261 Bacteria 918
134 Ga0209455_1006195 3300025272 Bacteria 3568
135 Ga0207647_10000105 3300025904 Bacteria 65502
136 Ga0207647_10062362 3300025904 Bacteria 2272
137 Ga0207705_10000112 3300025909 Bacteria 90821
138 Ga0207654_10016650 3300025911 Bacteria 3830
139 Ga0207707_10010429 3300025912 Bacteria 8063
140 Ga0207695_10117544 3300025913 Bacteria 2631
141 Ga0207695_10460572 3300025913 Bacteria 1154
142 Ga0207695_10477317 3300025913 Bacteria 1129
143 Ga0207695_10586075 3300025913 Bacteria 996
144 Ga0207695_10611596 3300025913 Bacteria 971
145 Ga0207671_10005430 3300025914 Bacteria 11736
146 Ga0207671_10056716 3300025914 Bacteria 2903
147 Ga0207671_10559220 3300025914 Bacteria 912
148 Ga0207660_10017609 3300025917 Bacteria 4750
149 Ga0207657_10029017 3300025919 Bacteria 5042
150 Ga0207649_10561955 3300025920 Bacteria 874
151 Ga0207652_10014447 3300025921 Bacteria 6397
152 Ga0207652_10976279 3300025921 Bacteria 745
153 Ga0207664_10153036 3300025929 Bacteria 1961
154 Ga0207664_11784559 3300025929 Unclassified 538
155 Ga0207690_10000439 3300025932 Bacteria 27079
156 Ga0207690_10240360 3300025932 Bacteria 1394
157 Ga0207689_10351007 3300025942 Bacteria 1226
158 Ga0207689_10840070 3300025942 Bacteria 775
159 Ga0207667_10000033 3300025949 Bacteria 314353
160 Ga0207667_10000045 3300025949 Bacteria 246053
161 Ga0207667_10006792 3300025949 Bacteria 13818
162 Ga0207667_10009137 3300025949 Bacteria 11708
163 Ga0207667_10163998 3300025949 Bacteria 2285
164 Ga0207667_11367727 3300025949 Bacteria 682
165 Ga0207667_11391532 3300025949 Bacteria 675
166 Ga0207640_10276300 3300025981 Bacteria 1317
167 Ga0207703_10141339 3300026035 Bacteria 2090
168 Ga0207639_10383592 3300026041 Bacteria 1263
169 Ga0207678_10199135 3300026067 Bacteria 1712
170 Ga0207702_10021058 3300026078 Bacteria 5396
171 Ga0207702_10031438 3300026078 Bacteria 4424
172 Ga0207702_10033727 3300026078 Bacteria 4277
173 Ga0207702_10193921 3300026078 Bacteria 1879
174 Ga0207702_10206928 3300026078 Bacteria 1822
175 Ga0207702_10369418 3300026078 Unclassified 1377
176 Ga0207674_10023125 3300026116 Bacteria 6664
177 Ga0207674_11667486 3300026116 Bacteria 606
178 Ga0207683_11495887 3300026121 Bacteria 623
179 Ga0207698_10037306 3300026142 Bacteria 3578
180 Ga0207698_11166838 3300026142 Bacteria 784
181 Ga0207698_11580853 3300026142 Bacteria 671
182 Ga0207698_11652964 3300026142 Bacteria 656
183 Ga0207698_11702248 3300026142 Unclassified 646
184 Ga0307515_10064528 3300028794 Bacteria 5118
185 Ga0307515_10242008 3300028794 Bacteria 1573
186 Ga0265338_10018889 3300028800 Bacteria 7350
187 Ga0307512_10236339 3300030522 Bacteria 931
188 Ga0265327_10002033 3300031251 Bacteria 22765
189 Ga0307513_10963898 3300031456 Bacteria 562
190 Ga0307509_10148207 3300031507 Bacteria 2268
191 Ga0307508_10316389 3300031616 Bacteria 1153
192 Ga0307516_10525606 3300031730 Bacteria 837
193 Ga0307507_10000023 3300033179 Bacteria 212423
194 Ga0395899_0000382 3300037312 Bacteria 52888
195 Ga0395899_0024608 3300037312 Bacteria 4551
196 Ga0395900_0000506 3300037418 Bacteria 54890
197 Ga0395900_0010229 3300037418 Bacteria 9595
198 Ga0395900_0147124 3300037418 Bacteria 2409
199 Ga0395898_0484773 3300037466 Bacteria 1176
200 Ga0395905_0000003 3300037471 Bacteria 1347396
201 Ga0395905_0000379 3300037471 Bacteria 63171
202 Ga0395905_0652400 3300037471 Bacteria 954
203 Ga0395901_0001923 3300038443 Bacteria 21386
204 Ga0451800_1204128 3300041459 Bacteria 1032
205 Ga0451806_780729 3300041462 Bacteria 882
206 Ga0451839_1037602 3300041496 Bacteria 611
207 Ga0451577_1230953 3300042876 Bacteria 667
208 Ga0466966_0003270 3300044684 Bacteria 10682
209 Ga0466961_0041500 3300044693 Bacteria 2950
210 Ga0453684_0051560 3300044712 Bacteria 5391
211 Ga0466959_0069890 3300045049 Bacteria 2544
212 Ga0466959_0221735 3300045049 Bacteria 1311
213 Ga0495629_0303303 3300046459 Bacteria 1093
214 Ga0495638_0206116 3300046460 Bacteria 1107
215 Ga0495638_0238503 3300046460 Bacteria 1008
216 Ga0495651_0193790 3300046462 Bacteria 1428
217 Ga0495651_0251897 3300046462 Bacteria 1205
218 Ga0495650_0000014 3300046471 Bacteria 581606
219 Ga0495650_0074873 3300046471 Bacteria 1319
220 Ga0495605_0199374 3300046474 Bacteria 873
221 Ga0495585_0000081 3300046492 Bacteria 99243
222 Ga0495585_0000436 3300046492 Bacteria 39946
223 Ga0495583_0077805 3300046506 Bacteria 1446
224 Ga0495606_0000020 3300046507 Bacteria 274490
225 Ga0495606_0073493 3300046507 Bacteria 2145
226 Ga0495606_0077922 3300046507 Bacteria 2068
227 Ga0495606_0659256 3300046507 Bacteria 505
228 Ga0495608_0152242 3300046511 Bacteria 1474
229 Ga0495608_0882321 3300046511 Bacteria 524
230 Ga0495610_0001403 3300046512 Bacteria 21412
231 Ga0495610_0150539 3300046512 Bacteria 993
232 Ga0495616_0010242 3300046513 Bacteria 5436
233 Ga0495616_0086078 3300046513 Bacteria 1495
234 Ga0495618_0304024 3300046514 Bacteria 991
235 Ga0495637_0074951 3300046520 Bacteria 1358
236 Ga0495648_0004976 3300046524 Bacteria 11167
237 Ga0495663_0226341 3300046525 Bacteria 659
238 Ga0495652_0158377 3300046529 Bacteria 1761
239 Ga0495652_0190214 3300046529 Bacteria 1567
240 Ga0495652_0897294 3300046529 Bacteria 585
241 Ga0495609_0011195 3300046538 Bacteria 4280
242 Ga0495609_0077546 3300046538 Bacteria 1455
243 Ga0495609_0106212 3300046538 Bacteria 1214
244 Ga0495622_0033844 3300046557 Bacteria 2385
245 Ga0495633_0000101 3300046558 Bacteria 116147
246 Ga0495633_0010759 3300046558 Bacteria 4976
247 Ga0495668_0000010 3300046616 Bacteria 487308
248 Ga0495625_0000009 3300046660 Bacteria 404954
249 Ga0495625_0000374 3300046660 Bacteria 68566
250 Ga0495625_0000893 3300046660 Bacteria 40260
251 Ga0495625_0021094 3300046660 Bacteria 5021
252 Ga0495625_0045813 3300046660 Bacteria 3159
253 Ga0495625_0134055 3300046660 Bacteria 1675
254 Ga0495625_0186428 3300046660 Bacteria 1377
255 Ga0495661_0001043 3300046665 Bacteria 24580
256 Ga0495661_0012768 3300046665 Bacteria 5668
257 Ga0495661_0151421 3300046665 Bacteria 1253
258 Ga0495588_0669550 3300046674 Bacteria 543
259 Ga0495658_0131152 3300046683 Bacteria 1525
260 Ga0495649_0000172 3300046694 Bacteria 56537
261 Ga0495660_0005166 3300046810 Bacteria 7844
262 Ga0495687_011686 3300047443 Bacteria 4697
263 Ga0495685_040273 3300047447 Bacteria 1598
264 Ga0495686_0001273 3300047472 Bacteria 28543
265 Ga0495686_0001934 3300047472 Bacteria 20630
266 Ga0495686_0013412 3300047472 Bacteria 5685
267 Ga0495686_0017005 3300047472 Bacteria 4912
268 Ga0495686_0265619 3300047472 Bacteria 959
269 Ga0495626_0383308 3300048091 Bacteria 545
270 Ga0495678_022372 3300049459 Bacteria 2765
271 Ga0495682_0120236 3300049460 Bacteria 940
272 Ga0501293_024637 3300049516 Unclassified 611
273 Ga0501238_017938 3300049671 Bacteria 988
274 nmdc:mga0k408_130323_c1 3300050493 Bacteria 1493
275 nmdc:mga0k408_19858_c1 3300050493 Bacteria 3760
276 nmdc:mga0k408_1998_c1 3300050493 Bacteria 10944
277 nmdc:mga0k408_2055_c1 3300050493 Bacteria 10764
278 nmdc:mga07m45_56066_c1 3300050496 Bacteria 2227
279 Ga0500635_0004316 3300053080 Bacteria 3655
280 Ga0500578_0762962 3300053086 Unclassified 515
281 Ga0500618_000158 3300053125 Bacteria 56115
282 Ga0500642_0092207 3300053130 Bacteria 1401
283 Ga0500559_0437406 3300053136 Bacteria 606
284 Ga0500564_187082 3300053138 Bacteria 859
285 Ga0500616_0401096 3300053153 Bacteria 548
286 Ga0500622_0001415 3300053156 Bacteria 19325
287 Ga0500624_001066 3300053157 Bacteria 5315
288 Ga0500634_0154689 3300053161 Bacteria 1067

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10150880 rootL2_101508802 109
2 3300046506 Ga0495583_0077805 Ga0495583_0077805_1016_1426 115
3 3300046512 Ga0495610_0150539 Ga0495610_0150539_74_484 115
4 3300001989 JGI24739J22299_10143728 JGI24739J22299_101437281 116
5 3300005435 Ga0070714_100100624 Ga0070714_1001006242 116
6 3300005436 Ga0070713_100427913 Ga0070713_1004279132 116
7 3300005563 Ga0068855_100015802 Ga0068855_1000158028 116
8 3300009093 Ga0105240_10489973 Ga0105240_104899734 116
9 3300010375 Ga0105239_10193614 Ga0105239_101936142 116
10 3300013104 Ga0157370_11682479 Ga0157370_116824791 116
11 3300013297 Ga0157378_10336387 Ga0157378_103363871 116
12 3300025261 Ga0209233_1045806 Ga0209233_10458062 116
13 3300025909 Ga0207705_10000112 Ga0207705_1000011238 116
14 3300025929 Ga0207664_10153036 Ga0207664_101530363 116
15 3300025949 Ga0207667_10009137 Ga0207667_1000913714 116
16 3300026142 Ga0207698_11702248 Ga0207698_117022482 116
17 3300031251 Ga0265327_10002033 Ga0265327_1000203316 116
18 3300049516 Ga0501293_024637 Ga0501293_024637_190_576 116
19 3300053153 Ga0500616_0401096 Ga0500616_0401096_57_443 116
20 3300013296 Ga0157374_10308203 Ga0157374_103082032 117
21 3300042876 Ga0451577_1230953 Ga0451577_1230953_61_450 117
22 3300044712 Ga0453684_0051560 Ga0453684_0051560_4628_5017 117
23 3300046492 Ga0495585_0000081 Ga0495585_0000081_2658_3068 117
24 3300046520 Ga0495637_0074951 Ga0495637_0074951_504_914 117
25 3300004800 Ga0058861_11794555 Ga0058861_117945552 118
26 3300004803 Ga0058862_12311791 Ga0058862_123117912 118
27 3300005336 Ga0070680_100038285 Ga0070680_1000382851 118
28 3300005458 Ga0070681_10009041 Ga0070681_100090413 118
29 3300005530 Ga0070679_100003041 Ga0070679_10000304112 118
30 3300025912 Ga0207707_10010429 Ga0207707_100104297 118
31 3300025917 Ga0207660_10017609 Ga0207660_100176093 118
32 3300025921 Ga0207652_10014447 Ga0207652_100144472 118
33 3300047472 Ga0495686_0017005 Ga0495686_0017005_3174_3584 118
34 3300005354 Ga0070675_101276649 Ga0070675_1012766491 119
35 3300005364 Ga0070673_102087172 Ga0070673_1020871721 119
36 3300005614 Ga0068856_100013420 Ga0068856_1000134203 119
37 3300005614 Ga0068856_102200889 Ga0068856_1022008891 119
38 3300005616 Ga0068852_100049032 Ga0068852_1000490322 119
39 3300005718 Ga0068866_10330982 Ga0068866_103309821 119
40 3300005842 Ga0068858_100147907 Ga0068858_1001479072 119
41 3300009093 Ga0105240_10164679 Ga0105240_101646792 119
42 3300013296 Ga0157374_10421200 Ga0157374_104212002 119
43 3300013296 Ga0157374_10738348 Ga0157374_107383482 119
44 3300013306 Ga0163162_11048826 Ga0163162_110488262 119
45 3300025913 Ga0207695_10117544 Ga0207695_101175442 119
46 3300026035 Ga0207703_10141339 Ga0207703_101413391 119
47 3300026078 Ga0207702_10021058 Ga0207702_100210584 119
48 3300026142 Ga0207698_10037306 Ga0207698_100373062 119
49 3300028800 Ga0265338_10018889 Ga0265338_100188897 119
50 3300037471 Ga0395905_0000003 Ga0395905_0000003_368290_368685 119
51 3300046507 Ga0495606_0073493 Ga0495606_0073493_1105_1515 119
52 3300046665 Ga0495661_0151421 Ga0495661_0151421_824_1234 119
53 3300046810 Ga0495660_0005166 Ga0495660_0005166_5693_6103 119
54 3300047447 Ga0495685_040273 Ga0495685_040273_1114_1524 119
55 3300001989 JGI24739J22299_10018147 JGI24739J22299_100181473 120
56 3300001989 JGI24739J22299_10096446 JGI24739J22299_100964461 120
57 3300001990 JGI24737J22298_10002813 JGI24737J22298_100028135 120
58 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006223 120
59 3300003316 rootH1_10043432 rootH1_100434322 120
60 3300003320 rootH2_10230231 rootH2_102302312 120
61 3300003322 rootL2_10080111 rootL2_100801112 120
62 3300005563 Ga0068855_100181548 Ga0068855_1001815482 120
63 3300009545 Ga0105237_10769393 Ga0105237_107693932 120
64 3300010375 Ga0105239_10215976 Ga0105239_102159762 120
65 3300013102 Ga0157371_10013676 Ga0157371_100136766 120
66 3300013105 Ga0157369_10057193 Ga0157369_100571932 120
67 3300013306 Ga0163162_10008274 Ga0163162_100082747 120
68 3300013307 Ga0157372_10002801 Ga0157372_1000280113 120
69 3300020078 Ga0206352_10073269 Ga0206352_100732692 120
70 3300025904 Ga0207647_10062362 Ga0207647_100623622 120
71 3300025949 Ga0207667_11367727 Ga0207667_113677271 120
72 3300044684 Ga0466966_0003270 Ga0466966_0003270_1859_2269 120
73 3300044693 Ga0466961_0041500 Ga0466961_0041500_1271_1681 120
74 3300045049 Ga0466959_0221735 Ga0466959_0221735_770_1180 120
75 3300046460 Ga0495638_0238503 Ga0495638_0238503_529_939 120
76 3300046471 Ga0495650_0000014 Ga0495650_0000014_331670_332080 120
77 3300046507 Ga0495606_0000020 Ga0495606_0000020_240822_241232 120
78 3300046512 Ga0495610_0001403 Ga0495610_0001403_1399_1809 120
79 3300046513 Ga0495616_0086078 Ga0495616_0086078_889_1299 120
80 3300046529 Ga0495652_0190214 Ga0495652_0190214_728_1138 120
81 3300046538 Ga0495609_0106212 Ga0495609_0106212_258_668 120
82 3300046558 Ga0495633_0010759 Ga0495633_0010759_1291_1701 120
83 3300046660 Ga0495625_0000009 Ga0495625_0000009_295475_295885 120
84 3300046665 Ga0495661_0012768 Ga0495661_0012768_1384_1794 120
85 3300046694 Ga0495649_0000172 Ga0495649_0000172_46592_47002 120
86 3300047443 Ga0495687_011686 Ga0495687_011686_3889_4299 120
87 3300047472 Ga0495686_0265619 Ga0495686_0265619_323_733 120
88 3300050493 nmdc:mga0k408_19858_c1 nmdc:mga0k408_19858_c1_1381_1791 120
89 3300001915 JGI24741J21665_1016410 JGI24741J21665_10164102 121
90 3300005455 Ga0070663_100260943 Ga0070663_1002609431 121
91 3300005563 Ga0068855_100003439 Ga0068855_1000034394 121
92 3300005614 Ga0068856_100046870 Ga0068856_1000468704 121
93 3300013102 Ga0157371_10053592 Ga0157371_100535922 121
94 3300013105 Ga0157369_10000475 Ga0157369_1000047529 121
95 3300013307 Ga0157372_10000017 Ga0157372_10000017180 121
96 3300020077 Ga0206351_10227588 Ga0206351_102275881 121
97 3300025949 Ga0207667_10006792 Ga0207667_1000679211 121
98 3300026067 Ga0207678_10199135 Ga0207678_101991351 121
99 3300026078 Ga0207702_10033727 Ga0207702_100337272 121
100 3300037312 Ga0395899_0000382 Ga0395899_0000382_45047_45457 121
101 iso_pu_bacteria 2599185184 2599477029 121
102 iso_pu_bacteria 2919437846 2919442344 121
103 iso_pu_bacteria 2928078545 2928078943 121
104 iso_pu_bacteria 2928147474 2928148691 121
105 iso_pu_bacteria 2932082852 2932085591 121
106 iso_pu_bacteria 2977232053 2977236859 121
107 3300050496 nmdc:mga07m45_56066_c1 nmdc:mga07m45_56066_c1_852_1262 122
108 iso_pu_bacteria 2852623160 2852624040 122
109 iso_pu_bacteria 2884933994 2884937038 122
110 3300013104 Ga0157370_10343772 Ga0157370_103437722 124
111 3300025250 Ga0209026_1003603 Ga0209026_10036033 124
112 3300026116 Ga0207674_11667486 Ga0207674_116674861 124
113 3300002737 JGI25162J39368_1000046 JGI25162J39368_100004612 125
114 3300002741 JGI25157J39369_1005637 JGI25157J39369_10056372 125
115 3300003316 rootH1_10104088 rootH1_101040884 125
116 3300003316 rootH1_10153934 rootH1_101539342 125
117 3300003322 rootL2_10150881 rootL2_101508812 125
118 3300003323 rootH1_10046058 rootH1_100460582 125
119 3300003323 rootH1_10149021 rootH1_101490212 125
120 3300005288 Ga0065714_10067151 Ga0065714_100671514 125
121 3300005288 Ga0065714_10137189 Ga0065714_101371892 125
122 3300005288 Ga0065714_10162470 Ga0065714_101624702 125
123 3300005327 Ga0070658_10862263 Ga0070658_108622631 125
124 3300005329 Ga0070683_100620116 Ga0070683_1006201162 125
125 3300005339 Ga0070660_100019467 Ga0070660_1000194672 125
126 3300005366 Ga0070659_100000675 Ga0070659_10000067516 125
127 3300005456 Ga0070678_100816794 Ga0070678_1008167941 125
128 3300005530 Ga0070679_100578912 Ga0070679_1005789122 125
129 3300005535 Ga0070684_100088361 Ga0070684_1000883614 125
130 3300005539 Ga0068853_100338770 Ga0068853_1003387702 125
131 3300005548 Ga0070665_100583231 Ga0070665_1005832312 125
132 3300005563 Ga0068855_100000139 Ga0068855_10000013941 125
133 3300005563 Ga0068855_100528662 Ga0068855_1005286622 125
134 3300005563 Ga0068855_100556004 Ga0068855_1005560042 125
135 3300005577 Ga0068857_100457933 Ga0068857_1004579332 125
136 3300005578 Ga0068854_100303517 Ga0068854_1003035172 125
137 3300005614 Ga0068856_100000935 Ga0068856_1000009354 125
138 3300005614 Ga0068856_100005544 Ga0068856_10000554411 125
139 3300005614 Ga0068856_100186861 Ga0068856_1001868612 125
140 3300005614 Ga0068856_100348974 Ga0068856_1003489743 125
141 3300005616 Ga0068852_101791695 Ga0068852_1017916951 125
142 3300005616 Ga0068852_102051176 Ga0068852_1020511761 125
143 3300005616 Ga0068852_102330950 Ga0068852_1023309501 125
144 3300006195 Ga0075366_10000042 Ga0075366_1000004239 125
145 3300006195 Ga0075366_10001607 Ga0075366_100016077 125
146 3300006195 Ga0075366_10134441 Ga0075366_101344413 125
147 3300006237 Ga0097621_100910646 Ga0097621_1009106462 125
148 3300006358 Ga0068871_101064537 Ga0068871_1010645372 125
149 3300009093 Ga0105240_10049267 Ga0105240_100492671 125
150 3300009093 Ga0105240_10050570 Ga0105240_100505703 125
151 3300009093 Ga0105240_10056706 Ga0105240_100567062 125
152 3300009093 Ga0105240_10536715 Ga0105240_105367152 125
153 3300009093 Ga0105240_10739132 Ga0105240_107391321 125
154 3300009174 Ga0105241_12367964 Ga0105241_123679641 125
155 3300009545 Ga0105237_10120732 Ga0105237_101207322 125
156 3300009551 Ga0105238_11096602 Ga0105238_110966022 125
157 3300009551 Ga0105238_11207506 Ga0105238_112075061 125
158 3300010375 Ga0105239_10000002 Ga0105239_10000002119 125
159 3300010375 Ga0105239_10000228 Ga0105239_1000022849 125
160 3300010375 Ga0105239_10001327 Ga0105239_100013273 125
161 3300010375 Ga0105239_10002117 Ga0105239_1000211720 125
162 3300013100 Ga0157373_10000249 Ga0157373_1000024917 125
163 3300013104 Ga0157370_11236788 Ga0157370_112367882 125
164 3300013104 Ga0157370_11397523 Ga0157370_113975232 125
165 3300013104 Ga0157370_11573641 Ga0157370_115736411 125
166 3300013296 Ga0157374_10827104 Ga0157374_108271042 125
167 3300013297 Ga0157378_10030113 Ga0157378_100301133 125
168 3300013307 Ga0157372_10004976 Ga0157372_100049762 125
169 3300013307 Ga0157372_11772951 Ga0157372_117729512 125
170 3300013308 Ga0157375_12104791 Ga0157375_121047911 125
171 3300017792 Ga0163161_10062579 Ga0163161_100625793 125
172 3300020075 Ga0206349_1057602 Ga0206349_10576021 125
173 3300025233 Ga0209437_100070 Ga0209437_10007085 125
174 3300025250 Ga0209026_1000279 Ga0209026_100027914 125
175 3300025258 Ga0209129_1014047 Ga0209129_10140472 125
176 3300025272 Ga0209455_1006195 Ga0209455_10061952 125
177 3300025911 Ga0207654_10016650 Ga0207654_100166502 125
178 3300025913 Ga0207695_10460572 Ga0207695_104605721 125
179 3300025913 Ga0207695_10477317 Ga0207695_104773172 125
180 3300025913 Ga0207695_10586075 Ga0207695_105860752 125
181 3300025913 Ga0207695_10611596 Ga0207695_106115961 125
182 3300025914 Ga0207671_10005430 Ga0207671_100054304 125
183 3300025914 Ga0207671_10056716 Ga0207671_100567163 125
184 3300025914 Ga0207671_10559220 Ga0207671_105592202 125
185 3300025919 Ga0207657_10029017 Ga0207657_100290174 125
186 3300025920 Ga0207649_10561955 Ga0207649_105619552 125
187 3300025921 Ga0207652_10976279 Ga0207652_109762791 125
188 3300025929 Ga0207664_11784559 Ga0207664_117845592 125
189 3300025932 Ga0207690_10000439 Ga0207690_1000043914 125
190 3300025942 Ga0207689_10351007 Ga0207689_103510072 125
191 3300025942 Ga0207689_10840070 Ga0207689_108400702 125
192 3300025949 Ga0207667_10000033 Ga0207667_1000003340 125
193 3300025949 Ga0207667_10000045 Ga0207667_1000004512 125
194 3300025949 Ga0207667_11391532 Ga0207667_113915322 125
195 3300025981 Ga0207640_10276300 Ga0207640_102763002 125
196 3300026041 Ga0207639_10383592 Ga0207639_103835922 125
197 3300026078 Ga0207702_10031438 Ga0207702_100314384 125
198 3300026078 Ga0207702_10193921 Ga0207702_101939212 125
199 3300026078 Ga0207702_10206928 Ga0207702_102069282 125
200 3300026078 Ga0207702_10369418 Ga0207702_103694183 125
201 3300026121 Ga0207683_11495887 Ga0207683_114958871 125
202 3300026142 Ga0207698_11166838 Ga0207698_111668382 125
203 3300026142 Ga0207698_11580853 Ga0207698_115808532 125
204 3300026142 Ga0207698_11652964 Ga0207698_116529641 125
205 3300028794 Ga0307515_10064528 Ga0307515_100645285 125
206 3300028794 Ga0307515_10242008 Ga0307515_102420082 125
207 3300030522 Ga0307512_10236339 Ga0307512_102363391 125
208 3300031456 Ga0307513_10963898 Ga0307513_109638981 125
209 3300031507 Ga0307509_10148207 Ga0307509_101482072 125
210 3300031616 Ga0307508_10316389 Ga0307508_103163891 125
211 3300031730 Ga0307516_10525606 Ga0307516_105256062 125
212 3300033179 Ga0307507_10000023 Ga0307507_10000023188 125
213 3300037312 Ga0395899_0024608 Ga0395899_0024608_1282_1692 125
214 3300037418 Ga0395900_0000506 Ga0395900_0000506_679_1089 125
215 3300037418 Ga0395900_0010229 Ga0395900_0010229_7330_7740 125
216 3300037466 Ga0395898_0484773 Ga0395898_0484773_506_916 125
217 3300037471 Ga0395905_0000379 Ga0395905_0000379_10151_10561 125
218 3300038443 Ga0395901_0001923 Ga0395901_0001923_1976_2386 125
219 3300041459 Ga0451800_1204128 Ga0451800_1204128_43_456 125
220 3300041462 Ga0451806_780729 Ga0451806_780729_203_616 125
221 3300041496 Ga0451839_1037602 Ga0451839_1037602_166_576 125
222 3300045049 Ga0466959_0069890 Ga0466959_0069890_1438_1848 125
223 3300046459 Ga0495629_0303303 Ga0495629_0303303_277_687 125
224 3300046460 Ga0495638_0206116 Ga0495638_0206116_467_877 125
225 3300046462 Ga0495651_0193790 Ga0495651_0193790_761_1171 125
226 3300046462 Ga0495651_0251897 Ga0495651_0251897_295_705 125
227 3300046471 Ga0495650_0074873 Ga0495650_0074873_253_663 125
228 3300046474 Ga0495605_0199374 Ga0495605_0199374_20_430 125
229 3300046492 Ga0495585_0000436 Ga0495585_0000436_2243_2653 125
230 3300046507 Ga0495606_0077922 Ga0495606_0077922_579_989 125
231 3300046507 Ga0495606_0659256 Ga0495606_0659256_21_431 125
232 3300046511 Ga0495608_0152242 Ga0495608_0152242_433_843 125
233 3300046511 Ga0495608_0882321 Ga0495608_0882321_68_478 125
234 3300046513 Ga0495616_0010242 Ga0495616_0010242_4843_5253 125
235 3300046514 Ga0495618_0304024 Ga0495618_0304024_316_726 125
236 3300046524 Ga0495648_0004976 Ga0495648_0004976_5656_6066 125
237 3300046525 Ga0495663_0226341 Ga0495663_0226341_118_528 125
238 3300046529 Ga0495652_0158377 Ga0495652_0158377_1268_1678 125
239 3300046529 Ga0495652_0897294 Ga0495652_0897294_55_465 125
240 3300046538 Ga0495609_0011195 Ga0495609_0011195_1484_1894 125
241 3300046538 Ga0495609_0077546 Ga0495609_0077546_480_890 125
242 3300046557 Ga0495622_0033844 Ga0495622_0033844_1102_1512 125
243 3300046558 Ga0495633_0000101 Ga0495633_0000101_50473_50883 125
244 3300046616 Ga0495668_0000010 Ga0495668_0000010_119874_120284 125
245 3300046660 Ga0495625_0000374 Ga0495625_0000374_5862_6272 125
246 3300046660 Ga0495625_0000893 Ga0495625_0000893_38938_39348 125
247 3300046660 Ga0495625_0021094 Ga0495625_0021094_3201_3611 125
248 3300046660 Ga0495625_0045813 Ga0495625_0045813_2698_3108 125
249 3300046660 Ga0495625_0134055 Ga0495625_0134055_944_1354 125
250 3300046660 Ga0495625_0186428 Ga0495625_0186428_956_1366 125
251 3300046665 Ga0495661_0001043 Ga0495661_0001043_12937_13347 125
252 3300046674 Ga0495588_0669550 Ga0495588_0669550_29_439 125
253 3300046683 Ga0495658_0131152 Ga0495658_0131152_432_842 125
254 3300047472 Ga0495686_0001273 Ga0495686_0001273_23985_24395 125
255 3300047472 Ga0495686_0001934 Ga0495686_0001934_1529_1939 125
256 3300047472 Ga0495686_0013412 Ga0495686_0013412_2455_2865 125
257 3300048091 Ga0495626_0383308 Ga0495626_0383308_42_452 125
258 3300049459 Ga0495678_022372 Ga0495678_022372_870_1280 125
259 3300049460 Ga0495682_0120236 Ga0495682_0120236_152_562 125
260 3300049671 Ga0501238_017938 Ga0501238_017938_497_910 125
261 3300050493 nmdc:mga0k408_130323_c1 nmdc:mga0k408_130323_c1_451_861 125
262 3300050493 nmdc:mga0k408_1998_c1 nmdc:mga0k408_1998_c1_1335_1745 125
263 3300050493 nmdc:mga0k408_2055_c1 nmdc:mga0k408_2055_c1_2720_3130 125
264 3300053080 Ga0500635_0004316 Ga0500635_0004316_1856_2266 125
265 3300053086 Ga0500578_0762962 Ga0500578_0762962_38_448 125
266 3300053125 Ga0500618_000158 Ga0500618_000158_10707_11117 125
267 3300053130 Ga0500642_0092207 Ga0500642_0092207_115_525 125
268 3300053136 Ga0500559_0437406 Ga0500559_0437406_85_495 125
269 3300053138 Ga0500564_187082 Ga0500564_187082_118_528 125
270 3300053156 Ga0500622_0001415 Ga0500622_0001415_10851_11261 125
271 3300053157 Ga0500624_001066 Ga0500624_001066_303_713 125
272 3300053161 Ga0500634_0154689 Ga0500634_0154689_427_837 125
273 3300001904 JGI24736J21556_1006452 JGI24736J21556_10064522 126
274 3300001979 JGI24740J21852_10056375 JGI24740J21852_100563751 126
275 3300001990 JGI24737J22298_10020687 JGI24737J22298_100206872 126
276 3300002067 JGI24735J21928_10018273 JGI24735J21928_100182732 126
277 3300005366 Ga0070659_100002141 Ga0070659_1000021412 126
278 3300005563 Ga0068855_100147120 Ga0068855_1001471203 126
279 3300005577 Ga0068857_100013637 Ga0068857_1000136372 126
280 3300005616 Ga0068852_100387930 Ga0068852_1003879302 126
281 3300013100 Ga0157373_10024378 Ga0157373_100243782 126
282 3300013102 Ga0157371_10000135 Ga0157371_1000013582 126
283 3300013104 Ga0157370_10038243 Ga0157370_100382433 126
284 3300013105 Ga0157369_10140408 Ga0157369_101404082 126
285 3300013307 Ga0157372_10000061 Ga0157372_1000006171 126
286 3300020070 Ga0206356_11776924 Ga0206356_117769242 126
287 3300020078 Ga0206352_11210051 Ga0206352_112100511 126
288 3300025231 Ga0207427_109945 Ga0207427_1099452 126
289 3300025261 Ga0209233_1002044 Ga0209233_10020446 126
290 3300025904 Ga0207647_10000105 Ga0207647_100001053 126
291 3300025932 Ga0207690_10240360 Ga0207690_102403602 126
292 3300025949 Ga0207667_10163998 Ga0207667_101639983 126
293 3300026116 Ga0207674_10023125 Ga0207674_100231257 126
294 3300037418 Ga0395900_0147124 Ga0395900_0147124_1404_1817 126
295 3300037471 Ga0395905_0652400 Ga0395905_0652400_418_831 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

2

122

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.7883 30 105
1gqy-assembly1.cif.gz_A murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp 0.7607 35 72
8ewa-assembly1.cif.gz_B crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13644923 0.7561 35 74
8egn-assembly1.cif.gz_B crystal structure of udp-n-acetylmuramate-l-alanine ligase (udp-n-acetylmuramoyl-l-alanine synthetase, murc) pseudomonas aeruginosa in complex with ligand az-13643701 0.745 35 74
1w3s-assembly1.cif.gz_A the crystal structure of reco from deinococcus radiodurans. 0.743 30 105
ID Description Score Start End Superfamily
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7883 30 105 2.40.50.140
af_Q9VYW3_3_112_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7788 25 102 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7385 13 101 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7377 18 103 2.40.50.140
4gopA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7285 16 102 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A4Q3GID9-F1-model_v4 deleted 0.9791 15 91
AF-A0A291QX18-F1-model_v4 Cytochrome C biogenesis protein 0.9727 16 108 GO:0005886
GO:0017004
GO:0020037
AF-A0A520BP89-F1-model_v4 Cytochrome c maturation protein CcmE 0.9492 14 108 GO:0005886
GO:0017004
GO:0020037
AF-A0A350C4S6-F1-model_v4 Cytochrome C biogenesis protein 0.9489 16 110 GO:0005886
GO:0017004
GO:0020037
AF-A0A7V5VXL4-F1-model_v4 Cytochrome c maturation protein CcmE 0.9483 17 98 GO:0005886
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
76.48 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map