F392285

General Info

Members Datasets Scaffolds Average Seq Length
294 173 589 196

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_027622|Ga0495687_027622_608_1285
Length 225
Sequence MVEDPALVAGSSHTYADRTLPQRHTMLPMAQDNGELDSLVRKRIRALRVAQGWSLEELAARARVSQSTLSRIENGRRRLALDQLVTLARALDTSLDQLVETAADDVVSHPMIDAAHGLMRWPIKAEPGMTVVRQRMTDPPPDNPSRLRAHPGREWLVVLSGTASLLLGNRRLRIETNQAAEFPTMLPHAIGAEGGPCEILGIFDRDARRGHQRGEDVGKANRPSP

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
15 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
20 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
21 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
22 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
23 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
24 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
25 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
26 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
27 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
28 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
29 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
30 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
31 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
32 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
33 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
34 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
35 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
36 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
37 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
38 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
39 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
40 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
41 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
42 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
43 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
44 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
45 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
46 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
47 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
48 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
49 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
50 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
51 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
52 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
53 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
58 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
61 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
65 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
66 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
67 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
68 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
73 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
74 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
75 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
76 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
129 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
130 2643221578 Streptomyces sp. Root63 Isolate Unclassified
131 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
132 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
133 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
134 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
135 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
136 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
137 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
138 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
139 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
140 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
141 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
142 2808606448 Streptomyces sp. 193411 Isolate Unclassified
143 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
144 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
145 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
146 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
147 2862574272 Streptomyces sp. AcE210 Isolate Nodule
148 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
149 2867369537 Streptomyces sp. Z26 Isolate Unclassified
150 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
151 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
152 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
153 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
154 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
155 2891562705 Microbispora tritici MT50 Isolate Unclassified
156 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
157 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
158 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
159 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
160 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
161 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
162 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
163 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
164 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
165 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
166 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
167 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
168 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
169 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
170 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
171 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
172 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
173 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0.34
Isolates 15.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0.34
Rhizoplane 0
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_027622 3300047443 Bacteria 2653
2 rootL2_10050078 3300003322 Bacteria 5245
3 rootH1_10026394 3300003316 Bacteria 2161
4 rootH1_10026394 3300003323 Bacteria 11193
5 Ga0006562J51391_1081766 3300003578 Bacteria 2190
6 Ga0070674_100084094 3300005356 Bacteria 2281
7 Ga0070714_100138984 3300005435 Bacteria 2178
8 Ga0081455_10297314 3300005937 Bacteria 1160
9 Ga0081538_10023710 3300005981 Bacteria 4401
10 Ga0075428_100344928 3300006844 Bacteria 1599
11 Ga0105033_105160 3300009986 Bacteria 1121
12 Ga0182008_10001094 3300014497 Bacteria 18695
13 Ga0207664_10676599 3300025929 Bacteria 928
14 Ga0207669_10019104 3300025937 Bacteria 3560
15 Ga0316176_1028947 3300030732 Bacteria 1154
16 Ga0316181_1062712 3300030744 Bacteria 920
17 Ga0307513_10016190 3300031456 Bacteria 9007
18 Ga0307513_10119116 3300031456 Bacteria 2612
19 Ga0307408_100399523 3300031548 Bacteria 1180
20 Ga0307413_10378333 3300031824 Bacteria 1102
21 Ga0307416_101132582 3300032002 Bacteria 887
22 Ga0307414_10115361 3300032004 Bacteria 2054
23 Ga0307411_10441476 3300032005 Bacteria 1086
24 Ga0373925_0032111 3300037068 Bacteria 3862
25 Ga0451841_0011076 3300041498 Bacteria 1003
26 Ga0466969_0001657 3300044656 Bacteria 11933
27 Ga0466961_0006413 3300044693 Bacteria 7471
28 Ga0466961_0022290 3300044693 Bacteria 4074
29 Ga0466963_0094005 3300044694 Bacteria 2045
30 Ga0466971_0015004 3300044719 Bacteria 3408
31 Ga0466970_0003927 3300044765 Bacteria 7284
32 Ga0466959_0004275 3300045049 Bacteria 9523
33 Ga0466958_0023356 3300045836 Bacteria 3629
34 Ga0466967_0241700 3300045976 Bacteria 1722
35 Ga0495592_0009969 3300046454 Bacteria 7154
36 Ga0495592_0017442 3300046454 Bacteria 5455
37 Ga0495603_0000269 3300046455 Bacteria 27503
38 Ga0495603_0020671 3300046455 Bacteria 3987
39 Ga0495603_0020856 3300046455 Bacteria 3967
40 Ga0495603_0076830 3300046455 Bacteria 1959
41 Ga0495603_0107575 3300046455 Bacteria 1627
42 Ga0495629_0000773 3300046459 Bacteria 25837
43 Ga0495629_0006860 3300046459 Bacteria 8408
44 Ga0495629_0030686 3300046459 Bacteria 3809
45 Ga0495629_0034443 3300046459 Bacteria 3580
46 Ga0495651_0023149 3300046462 Bacteria 4832
47 Ga0495653_0046009 3300046463 Bacteria 3379
48 Ga0495605_0001395 3300046474 Bacteria 15898
49 Ga0495662_0000478 3300046476 Bacteria 18151
50 Ga0495662_0044991 3300046476 Bacteria 2131
51 Ga0495664_0034950 3300046477 Bacteria 2957
52 Ga0495664_0298702 3300046477 Bacteria 972
53 Ga0495594_0017181 3300046499 Bacteria 3819
54 Ga0495594_0232184 3300046499 Bacteria 1051
55 Ga0495594_0357698 3300046499 Bacteria 831
56 Ga0495607_0246478 3300046501 Bacteria 862
57 Ga0495583_0031844 3300046506 Bacteria 2551
58 Ga0495583_0047543 3300046506 Bacteria 1972
59 Ga0495606_0002438 3300046507 Bacteria 21620
60 Ga0495606_0067323 3300046507 Bacteria 2268
61 Ga0495608_0016250 3300046511 Bacteria 5148
62 Ga0495610_0123576 3300046512 Bacteria 1131
63 Ga0495616_0013918 3300046513 Bacteria 4520
64 Ga0495620_0020747 3300046515 Bacteria 3202
65 Ga0495620_0046154 3300046515 Bacteria 1882
66 Ga0495628_0029128 3300046516 Bacteria 4480
67 Ga0495628_0057859 3300046516 Bacteria 3049
68 Ga0495628_0155555 3300046516 Bacteria 1739
69 Ga0495628_0185787 3300046516 Bacteria 1571
70 Ga0495630_0060977 3300046517 Bacteria 2832
71 Ga0495631_0002604 3300046518 Bacteria 10084
72 Ga0495631_0103549 3300046518 Bacteria 1224
73 Ga0495643_0001987 3300046522 Bacteria 17114
74 Ga0495648_0056392 3300046524 Bacteria 2364
75 Ga0495666_0003996 3300046526 Bacteria 7457
76 Ga0495666_0064544 3300046526 Bacteria 1747
77 Ga0495652_0208752 3300046529 Bacteria 1476
78 Ga0495665_0035577 3300046531 Bacteria 2660
79 Ga0495640_0004523 3300046533 Bacteria 11090
80 Ga0495640_0010651 3300046533 Bacteria 7094
81 Ga0495640_0013219 3300046533 Bacteria 6277
82 Ga0495597_0131511 3300046542 Bacteria 1037
83 Ga0495622_0006187 3300046557 Bacteria 5559
84 Ga0495622_0108131 3300046557 Bacteria 1273
85 Ga0495667_0017881 3300046559 Bacteria 4789
86 Ga0495668_0011661 3300046616 Bacteria 5252
87 Ga0495668_0115146 3300046616 Bacteria 1470
88 Ga0495634_0111887 3300046642 Bacteria 1755
89 Ga0495634_0318887 3300046642 Bacteria 936
90 Ga0495625_0027575 3300046660 Bacteria 4273
91 Ga0495635_0010935 3300046663 Bacteria 6364
92 Ga0495661_0081921 3300046665 Bacteria 1859
93 Ga0495661_0086293 3300046665 Bacteria 1797
94 Ga0495657_0005601 3300046675 Bacteria 9910
95 Ga0495657_0006227 3300046675 Bacteria 9354
96 Ga0495599_0051932 3300046678 Bacteria 2568
97 Ga0495599_0171923 3300046678 Bacteria 1337
98 Ga0495623_0014472 3300046679 Bacteria 5106
99 Ga0495623_0031941 3300046679 Bacteria 3385
100 Ga0495646_0000915 3300046680 Bacteria 16761
101 Ga0495613_0004618 3300046689 Bacteria 10339
102 Ga0495613_0017056 3300046689 Bacteria 5406
103 Ga0495613_0031619 3300046689 Bacteria 3931
104 Ga0495613_0041247 3300046689 Bacteria 3418
105 Ga0495624_0010768 3300046690 Bacteria 6304
106 Ga0495670_0170862 3300046691 Bacteria 1145
107 Ga0495649_0118457 3300046694 Bacteria 1401
108 Ga0495589_0024943 3300046794 Bacteria 3036
109 Ga0495589_0063809 3300046794 Bacteria 1806
110 Ga0495600_0040336 3300046809 Bacteria 3040
111 Ga0495660_0041303 3300046810 Bacteria 2554
112 Ga0495660_0045829 3300046810 Bacteria 2399
113 Ga0495581_0089719 3300047315 Bacteria 1783
114 Ga0495604_0000185 3300047317 Bacteria 55651
115 Ga0495604_0005085 3300047317 Bacteria 10412
116 Ga0495604_0005130 3300047317 Bacteria 10367
117 Ga0495604_0054638 3300047317 Bacteria 3081
118 Ga0495604_0075994 3300047317 Bacteria 2527
119 Ga0495636_0192654 3300047318 Bacteria 928
120 Ga0495636_0267644 3300047318 Bacteria 794
121 Ga0495674_0072744 3300047319 Bacteria 2964
122 Ga0495674_0087336 3300047319 Bacteria 2669
123 Ga0495676_0003953 3300047321 Bacteria 13491
124 Ga0495676_0026092 3300047321 Bacteria 5034
125 Ga0495676_0045283 3300047321 Bacteria 3582
126 Ga0495676_0082680 3300047321 Bacteria 2429
127 Ga0495680_0035681 3300047322 Bacteria 4003
128 Ga0495687_064839 3300047443 Bacteria 1489
129 Ga0495675_0031389 3300047444 Bacteria 3391
130 Ga0495685_000922 3300047447 Bacteria 8910
131 Ga0495685_003452 3300047447 Bacteria 5050
132 Ga0495685_005537 3300047447 Bacteria 4123
133 Ga0495684_0061595 3300047471 Bacteria 2854
134 Ga0495686_0023541 3300047472 Bacteria 4061
135 Ga0495593_0036172 3300047673 Bacteria 2678
136 Ga0495593_0155792 3300047673 Bacteria 1154
137 Ga0495602_0301333 3300048088 Bacteria 1173
138 Ga0495614_0010104 3300048089 Bacteria 4166
139 Ga0495614_0351138 3300048089 Bacteria 687
140 Ga0496126_0244349 3300048929 Bacteria 1498
141 Ga0495678_018628 3300049459 Bacteria 3117
142 Ga0501031_0006775 3300049568 Bacteria 7475
143 Ga0501031_0014154 3300049568 Bacteria 5190
144 Ga0501031_0014595 3300049568 Bacteria 5108
145 Ga0501031_0195141 3300049568 Bacteria 1322
146 Ga0501032_0001525 3300049569 Bacteria 18459
147 Ga0501032_0006075 3300049569 Bacteria 8897
148 Ga0501032_0019196 3300049569 Bacteria 4783
149 Ga0501032_0031492 3300049569 Bacteria 3636
150 Ga0501032_0096128 3300049569 Bacteria 1964
151 Ga0501032_0228401 3300049569 Bacteria 1210
152 Ga0501033_0004102 3300049570 Bacteria 11740
153 Ga0501033_0005395 3300049570 Bacteria 10132
154 Ga0501033_0058598 3300049570 Bacteria 2844
155 Ga0501033_0077030 3300049570 Bacteria 2447
156 Ga0501033_0132220 3300049570 Bacteria 1807
157 Ga0501034_0004749 3300049571 Bacteria 15041
158 Ga0501034_0012425 3300049571 Bacteria 8794
159 Ga0501034_0028637 3300049571 Bacteria 5669
160 Ga0501034_0191593 3300049571 Bacteria 2006
161 Ga0501034_0236081 3300049571 Bacteria 1776
162 Ga0501036_0007960 3300049572 Bacteria 8674
163 Ga0501036_0014197 3300049572 Bacteria 6626
164 Ga0501036_0025072 3300049572 Bacteria 5029
165 Ga0501036_0025823 3300049572 Bacteria 4957
166 Ga0501036_0098773 3300049572 Bacteria 2468
167 Ga0501036_0363404 3300049572 Bacteria 1208
168 Ga0501036_0445673 3300049572 Bacteria 1079
169 Ga0501037_0003715 3300049573 Bacteria 11080
170 Ga0501037_0004734 3300049573 Bacteria 9890
171 Ga0501037_0020681 3300049573 Bacteria 4859
172 Ga0501037_0044548 3300049573 Bacteria 3258
173 Ga0501037_0086628 3300049573 Bacteria 2267
174 Ga0501038_0000223 3300049574 Bacteria 48354
175 Ga0501038_0034470 3300049574 Bacteria 4450
176 Ga0501038_0057302 3300049574 Bacteria 3345
177 Ga0501038_0136367 3300049574 Bacteria 2010
178 Ga0501038_0155567 3300049574 Bacteria 1862
179 Ga0501038_0232612 3300049574 Bacteria 1466
180 Ga0501038_0599865 3300049574 Bacteria 833
181 Ga0501039_0073987 3300049575 Bacteria 2647
182 Ga0501039_0102517 3300049575 Bacteria 2234
183 Ga0501040_0124452 3300049576 Bacteria 1810
184 Ga0501041_0001283 3300049577 Bacteria 13824
185 Ga0501042_0009601 3300049578 Bacteria 6456
186 Ga0501042_0021573 3300049578 Bacteria 4491
187 Ga0501042_0037129 3300049578 Bacteria 3457
188 Ga0501043_0000513 3300049579 Bacteria 34841
189 Ga0501043_0002672 3300049579 Bacteria 14954
190 Ga0501043_0044167 3300049579 Bacteria 3503
191 Ga0501043_0116340 3300049579 Bacteria 2098
192 Ga0501043_0248005 3300049579 Bacteria 1372
193 Ga0501046_0018357 3300049580 Bacteria 5821
194 Ga0501046_0065526 3300049580 Bacteria 2833
195 Ga0501046_0132665 3300049580 Bacteria 1888
196 Ga0501046_0275077 3300049580 Bacteria 1234
197 Ga0501047_0000433 3300049581 Bacteria 46523
198 Ga0501047_0015466 3300049581 Bacteria 7271
199 Ga0501047_0017322 3300049581 Bacteria 6899
200 Ga0501047_0025738 3300049581 Bacteria 5658
201 Ga0501047_0088709 3300049581 Bacteria 2969
202 Ga0501047_0526477 3300049581 Bacteria 1007
203 Ga0501048_0005335 3300049582 Bacteria 9783
204 Ga0501048_0006472 3300049582 Bacteria 8902
205 Ga0501048_0401188 3300049582 Bacteria 980
206 Ga0501067_0037494 3300049583 Bacteria 2692
207 Ga0501068_0010403 3300049584 Bacteria 5227
208 Ga0501069_0288119 3300049585 Bacteria 962
209 Ga0501070_0045325 3300049586 Bacteria 3657
210 Ga0501070_0329665 3300049586 Bacteria 1241
211 Ga0501070_0488328 3300049586 Bacteria 990
212 Ga0501072_0000482 3300049588 Bacteria 28669
213 Ga0501073_0088472 3300049589 Bacteria 2153
214 Ga0501074_0035956 3300049590 Bacteria 3589
215 Ga0501077_0016336 3300049593 Bacteria 4678
216 Ga0501080_0084686 3300049742 Bacteria 2945
217 Ga0501080_0141686 3300049742 Bacteria 2222
218 Ga0501080_0507589 3300049742 Bacteria 1077
219 Ga0501083_0046178 3300049744 Bacteria 2945
220 Ga0501282_013316 3300049778 Bacteria 890
221 Ga0501035_0000624 3300049822 Bacteria 38958
222 Ga0501035_0010380 3300049822 Bacteria 8637
223 Ga0501035_0027325 3300049822 Bacteria 5215
224 Ga0501035_0031918 3300049822 Bacteria 4796
225 Ga0501035_0035131 3300049822 Bacteria 4550
226 Ga0501035_0038095 3300049822 Bacteria 4353
227 Ga0501035_0169575 3300049822 Bacteria 1886
228 Ga0501044_0004307 3300049823 Bacteria 15958
229 Ga0501044_0054047 3300049823 Bacteria 4129
230 Ga0501044_0071393 3300049823 Bacteria 3530
231 Ga0501044_0072939 3300049823 Bacteria 3489
232 Ga0501044_0074723 3300049823 Bacteria 3442
233 Ga0501044_0079279 3300049823 Bacteria 3328
234 Ga0501044_0129781 3300049823 Bacteria 2515
235 Ga0501044_0343466 3300049823 Bacteria 1413
236 Ga0501044_0908541 3300049823 Bacteria 755
237 Ga0501045_0077076 3300049824 Bacteria 2456
238 Ga0501045_0168200 3300049824 Bacteria 1633
239 Ga0501045_0218415 3300049824 Bacteria 1420
240 Ga0495601_0004999 3300053077 Bacteria 7694
241 Ga0495655_0001375 3300053083 Bacteria 3735
242 Ga0495619_0045080 3300053085 Bacteria 2896
243 Ga0495619_0202230 3300053085 Bacteria 1375
244 Ga0500573_0058547 3300053140 Bacteria 2209
245 Ga0501084_0027405 3300054114 Bacteria 4760
246 Ga0501082_0035952 3300060353 Bacteria 4268
247 Ga0466962_0002344 3300061719 Bacteria 8983
248 Ga0530510_0005361 3300061734 Bacteria 8875
249 2547412018 2547132111 Bacteria 8013147
250 2616696145 2616644814 Bacteria 11555299
251 2643903775 2643221578 Bacteria 9213798
252 2644409938 2643221673 Bacteria 9196637
253 2644443411 2643221678 Bacteria 9540101
254 2676494186 2675903060 Bacteria 10051191
255 2760303885 2758568522 Bacteria 5953541
256 2760622179 2758568621 Bacteria 5967089
257 2768647702 2767802112 Bacteria 6465194
258 2772643731 2772190715 Bacteria 6959372
259 2784592698 2784132148 Bacteria 8627943
260 2804849371 2802429296 Bacteria 7227771
261 2808846138 2808606359 Bacteria 9866990
262 2808917273 2808606375 Bacteria 9466072
263 2809236329 2808606448 Bacteria 8656184
264 2811845893 2808606982 Bacteria 7791042
265 2856742359 2856741275 Bacteria 8096094
266 2862180283 2862178590 Bacteria 8583590
267 2862292951 2862290372 Bacteria 7471434
268 2862581711 2862574272 Bacteria 10567477
269 2867350652 2867346516 Bacteria 7608576
270 2867370136 2867369537 Bacteria 6501581
271 2873158389 2873151551 Bacteria 8625867
272 2875393649 2875391855 Bacteria 7600475
273 2884694684 2884693830 Bacteria 11273186
274 2891397621 2891395885 Bacteria 9251614
275 2891557616 2891554331 Bacteria 8812224
276 2891569849 2891562705 Bacteria 8039471
277 2895447129 2895442618 Bacteria 11027144
278 2918502042 2918501144 Bacteria 8668083
279 2919474513 2919468124 Bacteria 9133025
280 2935395702 2935390628 Bacteria 7043367
281 2939589430 2939582691 Bacteria 7088898
282 2946053001 2946045630 Bacteria 8527308
283 2954727406 2954721474 Bacteria 10456478
284 2954740227 2954731030 Bacteria 10243860
285 2954740505 2954740390 Bacteria 10229294
286 2954766766 2954759201 Bacteria 9358192
287 2966605183 2966598605 Bacteria 7676064
288 8003316052 8003314358 Bacteria 10575343
289 8023626685 8023623736 Bacteria 8593882
290 8025416023 8025413630 Bacteria 7014048
291 8025537874 8025530807 Bacteria 8495698
292 8048129178 8048127548 Bacteria 11053136
293 8048131843 8048127548 Bacteria 11053136
294 8048407901 8048406513 Bacteria 8936924
295 8056580369 8056579771 Bacteria 5840325
296 Ga0495687_027622
297 rootL2_10050078
298 rootH1_10026394
299 Ga0006562J51391_1081766
300 Ga0070674_100084094
301 Ga0070714_100138984
302 Ga0081455_10297314
303 Ga0081538_10023710
304 Ga0075428_100344928
305 Ga0105033_105160
306 Ga0182008_10001094
307 Ga0207664_10676599
308 Ga0207669_10019104
309 Ga0316176_1028947
310 Ga0316181_1062712
311 Ga0307513_10016190
312 Ga0307513_10119116
313 Ga0307408_100399523
314 Ga0307413_10378333
315 Ga0307416_101132582
316 Ga0307414_10115361
317 Ga0307411_10441476
318 Ga0373925_0032111
319 Ga0451841_0011076
320 Ga0466969_0001657
321 Ga0466961_0006413
322 Ga0466961_0022290
323 Ga0466963_0094005
324 Ga0466971_0015004
325 Ga0466970_0003927
326 Ga0466959_0004275
327 Ga0466958_0023356
328 Ga0466967_0241700
329 Ga0495592_0009969
330 Ga0495592_0017442
331 Ga0495603_0000269
332 Ga0495603_0020671
333 Ga0495603_0020856
334 Ga0495603_0076830
335 Ga0495603_0107575
336 Ga0495629_0000773
337 Ga0495629_0006860
338 Ga0495629_0030686
339 Ga0495629_0034443
340 Ga0495651_0023149
341 Ga0495653_0046009
342 Ga0495605_0001395
343 Ga0495662_0000478
344 Ga0495662_0044991
345 Ga0495664_0034950
346 Ga0495664_0298702
347 Ga0495594_0017181
348 Ga0495594_0232184
349 Ga0495594_0357698
350 Ga0495607_0246478
351 Ga0495583_0031844
352 Ga0495583_0047543
353 Ga0495606_0002438
354 Ga0495606_0067323
355 Ga0495608_0016250
356 Ga0495610_0123576
357 Ga0495616_0013918
358 Ga0495620_0020747
359 Ga0495620_0046154
360 Ga0495628_0029128
361 Ga0495628_0057859
362 Ga0495628_0155555
363 Ga0495628_0185787
364 Ga0495630_0060977
365 Ga0495631_0002604
366 Ga0495631_0103549
367 Ga0495643_0001987
368 Ga0495648_0056392
369 Ga0495666_0003996
370 Ga0495666_0064544
371 Ga0495652_0208752
372 Ga0495665_0035577
373 Ga0495640_0004523
374 Ga0495640_0010651
375 Ga0495640_0013219
376 Ga0495597_0131511
377 Ga0495622_0006187
378 Ga0495622_0108131
379 Ga0495667_0017881
380 Ga0495668_0011661
381 Ga0495668_0115146
382 Ga0495634_0111887
383 Ga0495634_0318887
384 Ga0495625_0027575
385 Ga0495635_0010935
386 Ga0495661_0081921
387 Ga0495661_0086293
388 Ga0495657_0005601
389 Ga0495657_0006227
390 Ga0495599_0051932
391 Ga0495599_0171923
392 Ga0495623_0014472
393 Ga0495623_0031941
394 Ga0495646_0000915
395 Ga0495613_0004618
396 Ga0495613_0017056
397 Ga0495613_0031619
398 Ga0495613_0041247
399 Ga0495624_0010768
400 Ga0495670_0170862
401 Ga0495649_0118457
402 Ga0495589_0024943
403 Ga0495589_0063809
404 Ga0495600_0040336
405 Ga0495660_0041303
406 Ga0495660_0045829
407 Ga0495581_0089719
408 Ga0495604_0000185
409 Ga0495604_0005085
410 Ga0495604_0005130
411 Ga0495604_0054638
412 Ga0495604_0075994
413 Ga0495636_0192654
414 Ga0495636_0267644
415 Ga0495674_0072744
416 Ga0495674_0087336
417 Ga0495676_0003953
418 Ga0495676_0026092
419 Ga0495676_0045283
420 Ga0495676_0082680
421 Ga0495680_0035681
422 Ga0495687_064839
423 Ga0495675_0031389
424 Ga0495685_000922
425 Ga0495685_003452
426 Ga0495685_005537
427 Ga0495684_0061595
428 Ga0495686_0023541
429 Ga0495593_0036172
430 Ga0495593_0155792
431 Ga0495602_0301333
432 Ga0495614_0010104
433 Ga0495614_0351138
434 Ga0496126_0244349
435 Ga0495678_018628
436 Ga0501031_0006775
437 Ga0501031_0014154
438 Ga0501031_0014595
439 Ga0501031_0195141
440 Ga0501032_0001525
441 Ga0501032_0006075
442 Ga0501032_0019196
443 Ga0501032_0031492
444 Ga0501032_0096128
445 Ga0501032_0228401
446 Ga0501033_0004102
447 Ga0501033_0005395
448 Ga0501033_0058598
449 Ga0501033_0077030
450 Ga0501033_0132220
451 Ga0501034_0004749
452 Ga0501034_0012425
453 Ga0501034_0028637
454 Ga0501034_0191593
455 Ga0501034_0236081
456 Ga0501036_0007960
457 Ga0501036_0014197
458 Ga0501036_0025072
459 Ga0501036_0025823
460 Ga0501036_0098773
461 Ga0501036_0363404
462 Ga0501036_0445673
463 Ga0501037_0003715
464 Ga0501037_0004734
465 Ga0501037_0020681
466 Ga0501037_0044548
467 Ga0501037_0086628
468 Ga0501038_0000223
469 Ga0501038_0034470
470 Ga0501038_0057302
471 Ga0501038_0136367
472 Ga0501038_0155567
473 Ga0501038_0232612
474 Ga0501038_0599865
475 Ga0501039_0073987
476 Ga0501039_0102517
477 Ga0501040_0124452
478 Ga0501041_0001283
479 Ga0501042_0009601
480 Ga0501042_0021573
481 Ga0501042_0037129
482 Ga0501043_0000513
483 Ga0501043_0002672
484 Ga0501043_0044167
485 Ga0501043_0116340
486 Ga0501043_0248005
487 Ga0501046_0018357
488 Ga0501046_0065526
489 Ga0501046_0132665
490 Ga0501046_0275077
491 Ga0501047_0000433
492 Ga0501047_0015466
493 Ga0501047_0017322
494 Ga0501047_0025738
495 Ga0501047_0088709
496 Ga0501047_0526477
497 Ga0501048_0005335
498 Ga0501048_0006472
499 Ga0501048_0401188
500 Ga0501067_0037494
501 Ga0501068_0010403
502 Ga0501069_0288119
503 Ga0501070_0045325
504 Ga0501070_0329665
505 Ga0501070_0488328
506 Ga0501072_0000482
507 Ga0501073_0088472
508 Ga0501074_0035956
509 Ga0501077_0016336
510 Ga0501080_0084686
511 Ga0501080_0141686
512 Ga0501080_0507589
513 Ga0501083_0046178
514 Ga0501282_013316
515 Ga0501035_0000624
516 Ga0501035_0010380
517 Ga0501035_0027325
518 Ga0501035_0031918
519 Ga0501035_0035131
520 Ga0501035_0038095
521 Ga0501035_0169575
522 Ga0501044_0004307
523 Ga0501044_0054047
524 Ga0501044_0071393
525 Ga0501044_0072939
526 Ga0501044_0074723
527 Ga0501044_0079279
528 Ga0501044_0129781
529 Ga0501044_0343466
530 Ga0501044_0908541
531 Ga0501045_0077076
532 Ga0501045_0168200
533 Ga0501045_0218415
534 Ga0495601_0004999
535 Ga0495655_0001375
536 Ga0495619_0045080
537 Ga0495619_0202230
538 Ga0500573_0058547
539 Ga0501084_0027405
540 Ga0501082_0035952
541 Ga0466962_0002344
542 Ga0530510_0005361
543 2547412018
544 2616696145
545 2643903775
546 2644409938
547 2644443411
548 2676494186
549 2760303885
550 2760622179
551 2768647702
552 2772643731
553 2784592698
554 2804849371
555 2808846138
556 2808917273
557 2809236329
558 2811845893
559 2856742359
560 2862180283
561 2862292951
562 2862581711
563 2867350652
564 2867370136
565 2873158389
566 2875393649
567 2884694684
568 2891397621
569 2891557616
570 2891569849
571 2895447129
572 2918502042
573 2919474513
574 2935395702
575 2939589430
576 2946053001
577 2954727406
578 2954740227
579 2954740505
580 2954766766
581 2966605183
582 8003316052
583 8023626685
584 8025416023
585 8025537874
586 8048129178
587 8048131843
588 8048407901
589 8056580369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

44

98

0.98

PF13560

HTH_31

Helix-turn-helix domain

40

101

0.94

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

43

104

0.93

PF12844

HTH_19

Helix-turn-helix domain

42

103

0.92

PF07022

Phage_CI_repr

Bacteriophage CI repressor helix-turn-helix domain

42

103

0.88

PF07883

Cupin_2

Cupin domain

134

203

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9416 12 73
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9401 15 76
6rnx-assembly1.cif.gz_A crystal structure of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9381 15 76
3vk0-assembly2.cif.gz_B crystal structure of hypothetical transcription factor nhtf from neisseria 0.9361 11 81
7nrd-assembly1.cif.gz_Sh structure of the yeast gcn1 bound to a colliding stalled 80s ribosome with mbf1, a/p-trna and p/e-trna 0.9301 13 66
ID Description Score Start End Superfamily
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9416 12 73 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9375 12 73 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9358 12 73 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9295 14 76 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9293 16 67 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A652KMW9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9676 4 75 GO:0003677
GO:0003700
GO:0005829
AF-A0A7U1EAQ7-F1-model_v4 deleted 0.9545 11 81
AF-A0A6B4TAR9-F1-model_v4 deleted 0.9431 14 77
AF-A0A0K9H0S0-F1-model_v4 DNA-binding protein 0.9414 11 79 GO:0003677
AF-A0A506U366-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9381 11 79 GO:0003677
GO:0003700
GO:0005829

Map