F392166

General Info

Members Datasets Scaffolds Average Seq Length
294 184 588 376

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10145703|Ga0307405_101457031
Length 441
Sequence LRQSYLGLLCTKSHSRDCIGGPDLPGTHARDILTRTLLQINCKGMRNRADNLLRRSTEERSKTSLRELSLLFLKLGTIGFGGPAAHIAMMEDEVVRRRRWLTHDEFLDLLGATNLIPGPNSTEMAIHIGHRRAGWKGLVVAGISFILPAVLIVMAFAWAYVRYGSIPEVKGVLYGVKPVIIAIVLQALWSLGRAAIKTKLLAVIATAAVILTFLGLHELLVLLGGGLLXXXVRSILRTIKGQQSLLSPISASPLIAFLQSTTTSAATASFSLGLLFLFFLKVGAVLYGSGYVLLAFIRADLVERWHWLTETQLLDAIAVGQVTPGPVFTTATFVGYVLGGTKGAAVATVGIFLPAFIFVAASGPLVPRIRRSPIAGAFLDGVNAAALALMVFVTYQLGRAAIMDFTTIALAVISGAILFSFRLNSAWLVLGGGIAGWFLYR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
160 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
161 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
164 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
165 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
182 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
183 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
184 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0.34
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10145703 3300031731 Bacteria 1658
2 JGI24751J29686_10000138 3300002459 Bacteria 36181
3 rootL2_10347597 3300003322 Bacteria 1410
4 rootH1_10067423 3300003323 Bacteria 11974
5 rootH1_10207443 3300003323 Bacteria 2611
6 Ga0065712_10000602 3300005290 Bacteria 10673
7 Ga0065715_10012612 3300005293 Bacteria 2619
8 Ga0065715_10104205 3300005293 Bacteria 2980
9 Ga0065715_10114613 3300005293 Bacteria 2444
10 Ga0065707_10164663 3300005295 Unclassified 1533
11 Ga0070658_10079344 3300005327 Bacteria 2695
12 Ga0070683_100051184 3300005329 Bacteria 3824
13 Ga0070690_100001975 3300005330 Bacteria 10926
14 Ga0070670_100000229 3300005331 Bacteria 51545
15 Ga0070670_100105579 3300005331 Bacteria 2427
16 Ga0070670_100285727 3300005331 Bacteria 1441
17 Ga0068869_100101369 3300005334 Bacteria 2178
18 Ga0068869_100133375 3300005334 Bacteria 1911
19 Ga0070680_100067260 3300005336 Bacteria 2939
20 Ga0068868_100053409 3300005338 Bacteria 3183
21 Ga0068868_100231427 3300005338 Bacteria 1550
22 Ga0070689_100001525 3300005340 Bacteria 14757
23 Ga0070689_100086754 3300005340 Bacteria 2462
24 Ga0070692_10012048 3300005345 Bacteria 3989
25 Ga0070669_100027205 3300005353 Bacteria 4116
26 Ga0070675_100043666 3300005354 Bacteria 3664
27 Ga0070688_100003233 3300005365 Bacteria 8353
28 Ga0070667_100017192 3300005367 Bacteria 5990
29 Ga0070703_10000105 3300005406 Bacteria 43523
30 Ga0070709_10065653 3300005434 Bacteria 2324
31 Ga0070705_100054015 3300005440 Bacteria 2354
32 Ga0070700_100002824 3300005441 Bacteria 8911
33 Ga0070700_100124336 3300005441 Bacteria 1733
34 Ga0070694_100023114 3300005444 Bacteria 3994
35 Ga0070694_100084856 3300005444 Bacteria 2210
36 Ga0068867_100089348 3300005459 Bacteria 2336
37 Ga0070685_10069029 3300005466 Bacteria 2089
38 Ga0070707_100000149 3300005468 Bacteria 67234
39 Ga0070707_100004190 3300005468 Bacteria 13516
40 Ga0070707_100020128 3300005468 Bacteria 6293
41 Ga0070698_100043361 3300005471 Unclassified 4612
42 Ga0070699_100159450 3300005518 Unclassified 1996
43 Ga0070679_100181278 3300005530 Unclassified 2078
44 Ga0070684_100281417 3300005535 Bacteria 1524
45 Ga0068853_100018556 3300005539 Bacteria 5759
46 Ga0070686_100001473 3300005544 Bacteria 13267
47 Ga0070686_100014354 3300005544 Bacteria 4566
48 Ga0070693_100007635 3300005547 Bacteria 5295
49 Ga0070704_100004807 3300005549 Bacteria 7826
50 Ga0070704_100029196 3300005549 Bacteria 3679
51 Ga0070704_100040953 3300005549 Bacteria 3193
52 Ga0070704_100085406 3300005549 Bacteria 2336
53 Ga0068855_100025990 3300005563 Bacteria 7005
54 Ga0068855_100361529 3300005563 Bacteria 1597
55 Ga0068855_100428452 3300005563 Bacteria 1446
56 Ga0070664_100007097 3300005564 Bacteria 9037
57 Ga0070664_100315708 3300005564 Bacteria 1415
58 Ga0068857_100002797 3300005577 Bacteria 14344
59 Ga0070702_100046370 3300005615 Bacteria 2463
60 Ga0068859_100009933 3300005617 Bacteria 9603
61 Ga0068859_100050271 3300005617 Bacteria 4188
62 Ga0068859_100058319 3300005617 Bacteria 3889
63 Ga0068859_100159582 3300005617 Bacteria 2334
64 Ga0068859_100277941 3300005617 Bacteria 1767
65 Ga0068864_100000821 3300005618 Bacteria 26145
66 Ga0068864_100011481 3300005618 Bacteria 7315
67 Ga0068864_100070977 3300005618 Bacteria 3032
68 Ga0068864_100176042 3300005618 Unclassified 1953
69 Ga0068851_10068245 3300005834 Bacteria 1835
70 Ga0068870_10054777 3300005840 Bacteria 2123
71 Ga0068863_100087988 3300005841 Bacteria 2944
72 Ga0068858_100158348 3300005842 Bacteria 2132
73 Ga0068860_100017750 3300005843 Bacteria 6933
74 Ga0068860_100022653 3300005843 Bacteria 6072
75 Ga0068860_100061684 3300005843 Bacteria 3562
76 Ga0068860_100113279 3300005843 Bacteria 2593
77 Ga0068860_100332629 3300005843 Bacteria 1492
78 Ga0068862_100137201 3300005844 Bacteria 2169
79 Ga0081455_10022996 3300005937 Bacteria 5811
80 Ga0081455_10025250 3300005937 Bacteria 5489
81 Ga0081455_10025980 3300005937 Bacteria 5395
82 Ga0097621_100002113 3300006237 Bacteria 13603
83 Ga0075430_100026580 3300006846 Bacteria 4921
84 Ga0075431_100001331 3300006847 Bacteria 22561
85 Ga0075431_100005310 3300006847 Bacteria 12702
86 Ga0075431_100045656 3300006847 Bacteria 4516
87 Ga0075431_100050051 3300006847 Bacteria 4308
88 Ga0075431_100172775 3300006847 Unclassified 2220
89 Ga0075433_10003289 3300006852 Bacteria 12482
90 Ga0075433_10005948 3300006852 Bacteria 9607
91 Ga0075433_10050589 3300006852 Bacteria 3617
92 Ga0075434_100005722 3300006871 Bacteria 11346
93 Ga0075434_100011094 3300006871 Bacteria 8480
94 Ga0075434_100070104 3300006871 Bacteria 3496
95 Ga0075434_100118399 3300006871 Bacteria 2662
96 Ga0075429_100086666 3300006880 Bacteria 2729
97 Ga0075429_100087267 3300006880 Bacteria 2719
98 Ga0075436_100011612 3300006914 Bacteria 6044
99 Ga0097620_100009932 3300006931 Bacteria 9603
100 Ga0097620_100050269 3300006931 Bacteria 4188
101 Ga0097620_100058319 3300006931 Bacteria 3889
102 Ga0097620_100159582 3300006931 Bacteria 2334
103 Ga0097620_100277967 3300006931 Bacteria 1767
104 Ga0075435_100004334 3300007076 Bacteria 9759
105 Ga0075435_100016253 3300007076 Bacteria 5611
106 Ga0105250_10054622 3300009092 Bacteria 1602
107 Ga0105240_10082253 3300009093 Bacteria 3955
108 Ga0105240_10206730 3300009093 Bacteria 2297
109 Ga0111539_10047062 3300009094 Bacteria 5157
110 Ga0111539_10243549 3300009094 Unclassified 2093
111 Ga0105245_10042169 3300009098 Bacteria 4071
112 Ga0105245_10119990 3300009098 Bacteria 2455
113 Ga0105247_10011552 3300009101 Bacteria 5319
114 Ga0114129_10063515 3300009147 Bacteria 5155
115 Ga0114129_10296963 3300009147 Bacteria 2154
116 Ga0105243_10056105 3300009148 Bacteria 3131
117 Ga0105241_10189393 3300009174 Bacteria 1712
118 Ga0105248_10041931 3300009177 Bacteria 5132
119 Ga0105248_10092996 3300009177 Bacteria 3395
120 Ga0105248_10312891 3300009177 Bacteria 1769
121 Ga0105237_10022318 3300009545 Bacteria 6495
122 Ga0105238_10000757 3300009551 Bacteria 33583
123 Ga0105249_10029705 3300009553 Bacteria 4937
124 Ga0105249_10110894 3300009553 Bacteria 2593
125 Ga0105239_10006512 3300010375 Bacteria 13537
126 Ga0157373_10008015 3300013100 Bacteria 7854
127 Ga0157374_10049743 3300013296 Bacteria 3894
128 Ga0157374_10322608 3300013296 Bacteria 1531
129 Ga0157374_10389641 3300013296 Bacteria 1389
130 Ga0157378_10011212 3300013297 Bacteria 7841
131 Ga0157378_10186299 3300013297 Bacteria 1955
132 Ga0163162_10005550 3300013306 Bacteria 12198
133 Ga0163162_10012485 3300013306 Bacteria 8299
134 Ga0163162_10021675 3300013306 Bacteria 6329
135 Ga0163162_10031640 3300013306 Bacteria 5248
136 Ga0163162_10065665 3300013306 Bacteria 3676
137 Ga0157372_10003940 3300013307 Bacteria 15946
138 Ga0157372_10061061 3300013307 Bacteria 4219
139 Ga0157372_10079057 3300013307 Bacteria 3718
140 Ga0157375_10083866 3300013308 Bacteria 3233
141 Ga0157375_10089959 3300013308 Bacteria 3127
142 Ga0157375_10199022 3300013308 Bacteria 2159
143 Ga0157375_10296528 3300013308 Bacteria 1780
144 Ga0163163_10000426 3300014325 Bacteria 38868
145 Ga0163163_10002932 3300014325 Bacteria 14434
146 Ga0163163_10003488 3300014325 Bacteria 13350
147 Ga0163163_10006119 3300014325 Bacteria 10479
148 Ga0163163_10026077 3300014325 Bacteria 5581
149 Ga0163163_10092826 3300014325 Bacteria 3034
150 Ga0157380_10106015 3300014326 Bacteria 2351
151 Ga0157380_10144362 3300014326 Bacteria 2049
152 Ga0157380_10190433 3300014326 Bacteria 1810
153 Ga0157379_10150019 3300014968 Bacteria 2103
154 Ga0157376_10037135 3300014969 Bacteria 3951
155 Ga0163161_10021180 3300017792 Bacteria 4571
156 Ga0213876_10000048 3300021384 Bacteria 146449
157 Ga0209050_1003245 3300025298 Bacteria 12254
158 Ga0207656_10024478 3300025321 Bacteria 2442
159 Ga0207653_10000031 3300025885 Bacteria 111372
160 Ga0207710_10002265 3300025900 Bacteria 9006
161 Ga0207680_10115466 3300025903 Bacteria 1748
162 Ga0207699_10004694 3300025906 Bacteria 6526
163 Ga0207705_10061788 3300025909 Bacteria 2706
164 Ga0207707_10041677 3300025912 Bacteria 4009
165 Ga0207671_10010596 3300025914 Bacteria 7589
166 Ga0207660_10063585 3300025917 Bacteria 2661
167 Ga0207652_10146604 3300025921 Unclassified 2113
168 Ga0207646_10000020 3300025922 Bacteria 272909
169 Ga0207646_10000227 3300025922 Bacteria 77131
170 Ga0207646_10183284 3300025922 Unclassified 1891
171 Ga0207694_10000644 3300025924 Bacteria 31507
172 Ga0207650_10000061 3300025925 Bacteria 149822
173 Ga0207650_10215269 3300025925 Bacteria 1544
174 Ga0207687_10028188 3300025927 Bacteria 3772
175 Ga0207687_10078744 3300025927 Bacteria 2374
176 Ga0207644_10042875 3300025931 Bacteria 3209
177 Ga0207709_10058832 3300025935 Bacteria 2390
178 Ga0207670_10001029 3300025936 Bacteria 14740
179 Ga0207711_10217642 3300025941 Bacteria 1746
180 Ga0207689_10159513 3300025942 Bacteria 1859
181 Ga0207661_10010207 3300025944 Bacteria 6752
182 Ga0207679_10021671 3300025945 Bacteria 4361
183 Ga0207679_10193441 3300025945 Bacteria 1693
184 Ga0207667_10087223 3300025949 Bacteria 3229
185 Ga0207667_10306820 3300025949 Bacteria 1621
186 Ga0207712_10001222 3300025961 Bacteria 17735
187 Ga0207712_10105339 3300025961 Bacteria 2104
188 Ga0207712_10302212 3300025961 Unclassified 1314
189 Ga0207658_10166483 3300025986 Bacteria 1811
190 Ga0207677_10202290 3300026023 Bacteria 1580
191 Ga0207703_10169619 3300026035 Bacteria 1918
192 Ga0207639_10225773 3300026041 Bacteria 1620
193 Ga0207708_10024455 3300026075 Unclassified 4569
194 Ga0207708_10028068 3300026075 Bacteria 4261
195 Ga0207708_10146336 3300026075 Bacteria 1857
196 Ga0207641_10155878 3300026088 Bacteria 2072
197 Ga0207641_10410588 3300026088 Unclassified 1302
198 Ga0207648_10226617 3300026089 Bacteria 1662
199 Ga0207676_10079892 3300026095 Bacteria 2653
200 Ga0207676_10080410 3300026095 Bacteria 2645
201 Ga0207676_10103222 3300026095 Unclassified 2369
202 Ga0207676_10300422 3300026095 Bacteria 1465
203 Ga0207674_10000713 3300026116 Bacteria 43458
204 Ga0207674_10019781 3300026116 Bacteria 7286
205 Ga0268265_10310120 3300028380 Unclassified 1424
206 Ga0268264_10022089 3300028381 Bacteria 5193
207 Ga0268264_10058410 3300028381 Bacteria 3230
208 Ga0268264_10113370 3300028381 Bacteria 2378
209 Ga0268264_10162879 3300028381 Bacteria 2011
210 Ga0265760_10005643 3300031090 Bacteria 3582
211 Ga0265320_10000392 3300031240 Bacteria 35392
212 Ga0265331_10012959 3300031250 Bacteria 4495
213 Ga0265327_10039666 3300031251 Bacteria 2555
214 Ga0307509_10011646 3300031507 Bacteria 10625
215 Ga0307408_100007033 3300031548 Bacteria 7441
216 Ga0265342_10020276 3300031712 Bacteria 4269
217 Ga0307406_10013277 3300031901 Bacteria 4715
218 Ga0307407_10132622 3300031903 Bacteria 1596
219 Ga0307409_100304525 3300031995 Bacteria 1484
220 Ga0307414_10217181 3300032004 Bacteria 1567
221 Ga0307415_100016267 3300032126 Bacteria 4430
222 Ga0307510_10126667 3300033180 Bacteria 2240
223 Ga0373934_0001604 3300035086 Bacteria 8308
224 Ga0373953_0015137 3300035117 Unclassified 2788
225 Ga0373933_0003842 3300035724 Bacteria 8294
226 Ga0373933_0064717 3300035724 Bacteria 2213
227 Ga0373937_0007822 3300036401 Bacteria 9264
228 Ga0373937_0048579 3300036401 Bacteria 3885
229 Ga0395900_0124154 3300037418 Bacteria 2648
230 Ga0395905_0020026 3300037471 Bacteria 6339
231 Ga0395905_0098982 3300037471 Bacteria 2739
232 Ga0436365_0291076 3300039437 Bacteria 51877
233 Ga0439457_020463 3300042014 Bacteria 1469
234 Ga0451577_0004783 3300042876 Bacteria 14156
235 Ga0451577_0007986 3300042876 Bacteria 10332
236 Ga0453684_0015078 3300044712 Bacteria 12265
237 Ga0453684_0131389 3300044712 Bacteria 3003
238 Ga0453684_0525915 3300044712 Unclassified 1306
239 Ga0451576_0028673 3300045051 Bacteria 5960
240 Ga0451576_0046473 3300045051 Bacteria 4571
241 Ga0451576_0166666 3300045051 Bacteria 2299
242 Ga0495580_0007444 3300046472 Bacteria 8800
243 Ga0495662_0131408 3300046476 Unclassified 1231
244 Ga0495628_0023134 3300046516 Bacteria 5103
245 Ga0495630_0011144 3300046517 Bacteria 6507
246 Ga0495645_0000061 3300046543 Bacteria 79047
247 Ga0495623_0002934 3300046679 Bacteria 11220
248 Ga0495581_0062220 3300047315 Unclassified 2156
249 Ga0495684_0005529 3300047471 Bacteria 9845
250 Ga0495684_0022833 3300047471 Unclassified 4812
251 Ga0495684_0214366 3300047471 Unclassified 1414
252 Ga0495686_0011707 3300047472 Bacteria 6177
253 Ga0496106_0036893 3300048909 Bacteria 3656
254 Ga0496109_0000026 3300048912 Bacteria 171405
255 Ga0501298_004813 3300049521 Bacteria 2144
256 Ga0501034_0003366 3300049571 Bacteria 18254
257 Ga0501038_0003957 3300049574 Bacteria 13763
258 Ga0501039_0159751 3300049575 Bacteria 1771
259 Ga0501047_0015274 3300049581 Bacteria 7314
260 Ga0501198_000522 3300049649 Bacteria 4757
261 Ga0501206_003429 3300049653 Bacteria 2013
262 Ga0501216_003389 3300049660 Bacteria 2318
263 Ga0501217_001980 3300049661 Bacteria 3947
264 Ga0501227_000461 3300049665 Bacteria 8652
265 Ga0501240_000279 3300049673 Bacteria 3925
266 Ga0501243_002377 3300049675 Bacteria 2751
267 Ga0501249_000054 3300049679 Bacteria 43438
268 Ga0501257_009704 3300049686 Bacteria 2177
269 Ga0501225_0003358 3300049705 Bacteria 4861
270 Ga0501234_000827 3300049707 Bacteria 4857
271 Ga0501035_0000088 3300049822 Bacteria 112836
272 Ga0501044_0478403 3300049823 Bacteria 1149
273 Ga0501204_004999 3300049850 Bacteria 1440
274 nmdc:mga09592_116800_c1 3300050508 Bacteria 2290
275 nmdc:mga09592_304705_c1 3300050508 Bacteria 1381
276 nmdc:mga0qj67_104793_c1 3300050509 Bacteria 2282
277 nmdc:mga0qj67_206475_c1 3300050509 Bacteria 1595
278 nmdc:mga06r32_23274_c1 3300050510 Bacteria 5730
279 nmdc:mga06r32_25435_c1 3300050510 Bacteria 5508
280 nmdc:mga06r32_709_c1 3300050510 Bacteria 29152
281 nmdc:mga06r32_91441_c1 3300050510 Bacteria 2974
282 nmdc:mga0n895_108697_c1 3300050512 Bacteria 2788
283 nmdc:mga0n895_1437_c2 3300050512 Bacteria 16947
284 nmdc:mga0n895_2294_c1 3300050512 Bacteria 14862
285 nmdc:mga08x19_16491_c1 3300050514 Unclassified 4506
286 nmdc:mga0a205_1455_c1 3300050515 Bacteria 20180
287 nmdc:mga0a205_14889_c1 3300050515 Bacteria 7257
288 nmdc:mga0a205_57836_c1 3300050515 Bacteria 3744
289 Ga0495595_0009539 3300053084 Unclassified 4019
290 Ga0500594_0027204 3300053118 Bacteria 1479
291 2588218283 2585428184 Bacteria 4978681
292 2919196140 2919191525 Bacteria 5765973
293 2919685925 2919683626 Bacteria 5534354
294 8056441078 8056440228 Bacteria 4946504
295 Ga0307405_10145703
296 JGI24751J29686_10000138
297 rootL2_10347597
298 rootH1_10067423
299 rootH1_10207443
300 Ga0065712_10000602
301 Ga0065715_10012612
302 Ga0065715_10104205
303 Ga0065715_10114613
304 Ga0065707_10164663
305 Ga0070658_10079344
306 Ga0070683_100051184
307 Ga0070690_100001975
308 Ga0070670_100000229
309 Ga0070670_100105579
310 Ga0070670_100285727
311 Ga0068869_100101369
312 Ga0068869_100133375
313 Ga0070680_100067260
314 Ga0068868_100053409
315 Ga0068868_100231427
316 Ga0070689_100001525
317 Ga0070689_100086754
318 Ga0070692_10012048
319 Ga0070669_100027205
320 Ga0070675_100043666
321 Ga0070688_100003233
322 Ga0070667_100017192
323 Ga0070703_10000105
324 Ga0070709_10065653
325 Ga0070705_100054015
326 Ga0070700_100002824
327 Ga0070700_100124336
328 Ga0070694_100023114
329 Ga0070694_100084856
330 Ga0068867_100089348
331 Ga0070685_10069029
332 Ga0070707_100000149
333 Ga0070707_100004190
334 Ga0070707_100020128
335 Ga0070698_100043361
336 Ga0070699_100159450
337 Ga0070679_100181278
338 Ga0070684_100281417
339 Ga0068853_100018556
340 Ga0070686_100001473
341 Ga0070686_100014354
342 Ga0070693_100007635
343 Ga0070704_100004807
344 Ga0070704_100029196
345 Ga0070704_100040953
346 Ga0070704_100085406
347 Ga0068855_100025990
348 Ga0068855_100361529
349 Ga0068855_100428452
350 Ga0070664_100007097
351 Ga0070664_100315708
352 Ga0068857_100002797
353 Ga0070702_100046370
354 Ga0068859_100009933
355 Ga0068859_100050271
356 Ga0068859_100058319
357 Ga0068859_100159582
358 Ga0068859_100277941
359 Ga0068864_100000821
360 Ga0068864_100011481
361 Ga0068864_100070977
362 Ga0068864_100176042
363 Ga0068851_10068245
364 Ga0068870_10054777
365 Ga0068863_100087988
366 Ga0068858_100158348
367 Ga0068860_100017750
368 Ga0068860_100022653
369 Ga0068860_100061684
370 Ga0068860_100113279
371 Ga0068860_100332629
372 Ga0068862_100137201
373 Ga0081455_10022996
374 Ga0081455_10025250
375 Ga0081455_10025980
376 Ga0097621_100002113
377 Ga0075430_100026580
378 Ga0075431_100001331
379 Ga0075431_100005310
380 Ga0075431_100045656
381 Ga0075431_100050051
382 Ga0075431_100172775
383 Ga0075433_10003289
384 Ga0075433_10005948
385 Ga0075433_10050589
386 Ga0075434_100005722
387 Ga0075434_100011094
388 Ga0075434_100070104
389 Ga0075434_100118399
390 Ga0075429_100086666
391 Ga0075429_100087267
392 Ga0075436_100011612
393 Ga0097620_100009932
394 Ga0097620_100050269
395 Ga0097620_100058319
396 Ga0097620_100159582
397 Ga0097620_100277967
398 Ga0075435_100004334
399 Ga0075435_100016253
400 Ga0105250_10054622
401 Ga0105240_10082253
402 Ga0105240_10206730
403 Ga0111539_10047062
404 Ga0111539_10243549
405 Ga0105245_10042169
406 Ga0105245_10119990
407 Ga0105247_10011552
408 Ga0114129_10063515
409 Ga0114129_10296963
410 Ga0105243_10056105
411 Ga0105241_10189393
412 Ga0105248_10041931
413 Ga0105248_10092996
414 Ga0105248_10312891
415 Ga0105237_10022318
416 Ga0105238_10000757
417 Ga0105249_10029705
418 Ga0105249_10110894
419 Ga0105239_10006512
420 Ga0157373_10008015
421 Ga0157374_10049743
422 Ga0157374_10322608
423 Ga0157374_10389641
424 Ga0157378_10011212
425 Ga0157378_10186299
426 Ga0163162_10005550
427 Ga0163162_10012485
428 Ga0163162_10021675
429 Ga0163162_10031640
430 Ga0163162_10065665
431 Ga0157372_10003940
432 Ga0157372_10061061
433 Ga0157372_10079057
434 Ga0157375_10083866
435 Ga0157375_10089959
436 Ga0157375_10199022
437 Ga0157375_10296528
438 Ga0163163_10000426
439 Ga0163163_10002932
440 Ga0163163_10003488
441 Ga0163163_10006119
442 Ga0163163_10026077
443 Ga0163163_10092826
444 Ga0157380_10106015
445 Ga0157380_10144362
446 Ga0157380_10190433
447 Ga0157379_10150019
448 Ga0157376_10037135
449 Ga0163161_10021180
450 Ga0213876_10000048
451 Ga0209050_1003245
452 Ga0207656_10024478
453 Ga0207653_10000031
454 Ga0207710_10002265
455 Ga0207680_10115466
456 Ga0207699_10004694
457 Ga0207705_10061788
458 Ga0207707_10041677
459 Ga0207671_10010596
460 Ga0207660_10063585
461 Ga0207652_10146604
462 Ga0207646_10000020
463 Ga0207646_10000227
464 Ga0207646_10183284
465 Ga0207694_10000644
466 Ga0207650_10000061
467 Ga0207650_10215269
468 Ga0207687_10028188
469 Ga0207687_10078744
470 Ga0207644_10042875
471 Ga0207709_10058832
472 Ga0207670_10001029
473 Ga0207711_10217642
474 Ga0207689_10159513
475 Ga0207661_10010207
476 Ga0207679_10021671
477 Ga0207679_10193441
478 Ga0207667_10087223
479 Ga0207667_10306820
480 Ga0207712_10001222
481 Ga0207712_10105339
482 Ga0207712_10302212
483 Ga0207658_10166483
484 Ga0207677_10202290
485 Ga0207703_10169619
486 Ga0207639_10225773
487 Ga0207708_10024455
488 Ga0207708_10028068
489 Ga0207708_10146336
490 Ga0207641_10155878
491 Ga0207641_10410588
492 Ga0207648_10226617
493 Ga0207676_10079892
494 Ga0207676_10080410
495 Ga0207676_10103222
496 Ga0207676_10300422
497 Ga0207674_10000713
498 Ga0207674_10019781
499 Ga0268265_10310120
500 Ga0268264_10022089
501 Ga0268264_10058410
502 Ga0268264_10113370
503 Ga0268264_10162879
504 Ga0265760_10005643
505 Ga0265320_10000392
506 Ga0265331_10012959
507 Ga0265327_10039666
508 Ga0307509_10011646
509 Ga0307408_100007033
510 Ga0265342_10020276
511 Ga0307406_10013277
512 Ga0307407_10132622
513 Ga0307409_100304525
514 Ga0307414_10217181
515 Ga0307415_100016267
516 Ga0307510_10126667
517 Ga0373934_0001604
518 Ga0373953_0015137
519 Ga0373933_0003842
520 Ga0373933_0064717
521 Ga0373937_0007822
522 Ga0373937_0048579
523 Ga0395900_0124154
524 Ga0395905_0020026
525 Ga0395905_0098982
526 Ga0436365_0291076
527 Ga0439457_020463
528 Ga0451577_0004783
529 Ga0451577_0007986
530 Ga0453684_0015078
531 Ga0453684_0131389
532 Ga0453684_0525915
533 Ga0451576_0028673
534 Ga0451576_0046473
535 Ga0451576_0166666
536 Ga0495580_0007444
537 Ga0495662_0131408
538 Ga0495628_0023134
539 Ga0495630_0011144
540 Ga0495645_0000061
541 Ga0495623_0002934
542 Ga0495581_0062220
543 Ga0495684_0005529
544 Ga0495684_0022833
545 Ga0495684_0214366
546 Ga0495686_0011707
547 Ga0496106_0036893
548 Ga0496109_0000026
549 Ga0501298_004813
550 Ga0501034_0003366
551 Ga0501038_0003957
552 Ga0501039_0159751
553 Ga0501047_0015274
554 Ga0501198_000522
555 Ga0501206_003429
556 Ga0501216_003389
557 Ga0501217_001980
558 Ga0501227_000461
559 Ga0501240_000279
560 Ga0501243_002377
561 Ga0501249_000054
562 Ga0501257_009704
563 Ga0501225_0003358
564 Ga0501234_000827
565 Ga0501035_0000088
566 Ga0501044_0478403
567 Ga0501204_004999
568 nmdc:mga09592_116800_c1
569 nmdc:mga09592_304705_c1
570 nmdc:mga0qj67_104793_c1
571 nmdc:mga0qj67_206475_c1
572 nmdc:mga06r32_23274_c1
573 nmdc:mga06r32_25435_c1
574 nmdc:mga06r32_709_c1
575 nmdc:mga06r32_91441_c1
576 nmdc:mga0n895_108697_c1
577 nmdc:mga0n895_1437_c2
578 nmdc:mga0n895_2294_c1
579 nmdc:mga08x19_16491_c1
580 nmdc:mga0a205_1455_c1
581 nmdc:mga0a205_14889_c1
582 nmdc:mga0a205_57836_c1
583 Ga0495595_0009539
584 Ga0500594_0027204
585 2588218283
586 2919196140
587 2919685925
588 8056441078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

273

437

0.98

PF02417

Chromate_transp

Chromate transporter

66

230

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3923 71 372
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3869 71 372
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.3818 14 380
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.3695 14 380
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.3367 71 372
ID Description Score Start End Superfamily
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3651 10 381 1.20.1740.10
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3638 55 341 1.20.1250.20
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3601 10 381 1.20.1740.10
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3599 16 345 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3503 16 345 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A350BN84-F1-model_v4 Chromate transporter 0.9492 74 380 GO:0005886
GO:0015109
AF-A0A1F9FU68-F1-model_v4 Chromate transporter 0.9409 13 380 GO:0005886
GO:0015109
AF-A0A7V6SU87-F1-model_v4 Chromate efflux transporter 0.937 9 379 GO:0005886
GO:0015109
AF-K9Q624-F1-model_v4 Chromate transporter, chromate ion transporter (CHR) family 0.9368 14 379 GO:0005886
GO:0015109
AF-A0A350BN84-F1-model_v4 Chromate transporter 0.9344 74 380 GO:0005886
GO:0015109

Map