F392101

General Info

Members Datasets Scaffolds Average Seq Length
294 178 588 262

Family's Representative Sequence

Representative Sequence 3300020078|Ga0206352_10635221|Ga0206352_106352211
Length 297
Sequence MESPFRADVVKDKAALVTGGGSGICFEIAAQLARHGAQVAIMGRRREVLDKAVAALRSQGLRAVGFDGDVRNQEDAARVLAATVAHFGKLDILVNGAAGNFLASPEDLTPKGFRTVLEIDTLGTYTMCYEALKYLKKGGPGKGPSTGGLIINISATLHYSASWYQIHVSAAKAGVDSITRSLALEWGTDYDIRVNGIAPGPIQDTPGLRKLAPEEMSKGLREMMPLFKFGEKRDIAMAALYLASDAGKYVNGTTLVVDGGLWLSHPRHIPKEEVRELSKVVEKKVRASGVGVTSSKL

Samples

Sample ID Description Type Environment
1 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
177 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
178 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 1.36
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 18.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206352_10635221 3300020078 Eukaryota 1052
2 Ga0065704_10111920 3300005289 Bacteria 1945
3 Ga0065715_10375603 3300005293 Unclassified 915
4 Ga0070658_10017632 3300005327 Bacteria 5711
5 Ga0070676_10135091 3300005328 Bacteria 1564
6 Ga0070683_100608048 3300005329 Bacteria 1046
7 Ga0070670_100031781 3300005331 Bacteria 4546
8 Ga0070670_100047133 3300005331 Bacteria 3707
9 Ga0070670_100068088 3300005331 Unclassified 3055
10 Ga0070677_10038012 3300005333 Bacteria 1881
11 Ga0068869_100044723 3300005334 Bacteria 3185
12 Ga0068869_100385647 3300005334 Bacteria 1149
13 Ga0070680_100244473 3300005336 Bacteria 1517
14 Ga0070682_100003337 3300005337 Bacteria 8898
15 Ga0070689_100009879 3300005340 Bacteria 6786
16 Ga0070689_100041291 3300005340 Bacteria 3541
17 Ga0070671_100049099 3300005355 Unclassified 3511
18 Ga0070671_100051758 3300005355 Bacteria 3416
19 Ga0070671_100058746 3300005355 Bacteria 3201
20 Ga0070671_100072440 3300005355 Bacteria 2877
21 Ga0070674_100294124 3300005356 Bacteria 1292
22 Ga0070673_100529215 3300005364 Bacteria 1069
23 Ga0070688_100037524 3300005365 Unclassified 2953
24 Ga0070659_100007620 3300005366 Bacteria 7868
25 Ga0070667_100332308 3300005367 Bacteria 1373
26 Ga0070701_10054648 3300005438 Bacteria 2083
27 Ga0070708_100337467 3300005445 Bacteria 1420
28 Ga0070663_100215185 3300005455 Bacteria 1506
29 Ga0070678_100002505 3300005456 Bacteria 10075
30 Ga0070662_100495476 3300005457 Bacteria 1019
31 Ga0070662_100503098 3300005457 Bacteria 1011
32 Ga0070681_10003907 3300005458 Bacteria 14046
33 Ga0070681_10006349 3300005458 Bacteria 11491
34 Ga0068867_100293219 3300005459 Unclassified 1338
35 Ga0070706_100043081 3300005467 Unclassified 4170
36 Ga0070707_100102172 3300005468 Bacteria 2778
37 Ga0070698_100004975 3300005471 Bacteria 14561
38 Ga0070698_100050630 3300005471 Bacteria 4233
39 Ga0070679_100032037 3300005530 Bacteria 5197
40 Ga0070679_100207711 3300005530 Bacteria 1922
41 Ga0070679_100253134 3300005530 Bacteria 1717
42 Ga0070679_100305158 3300005530 Bacteria 1542
43 Ga0070684_100204072 3300005535 Bacteria 1801
44 Ga0070684_100262306 3300005535 Bacteria 1581
45 Ga0070684_100354681 3300005535 Bacteria 1349
46 Ga0068853_100019664 3300005539 Bacteria 5605
47 Ga0068853_100028522 3300005539 Bacteria 4696
48 Ga0068853_100146118 3300005539 Bacteria 2125
49 Ga0068853_100172289 3300005539 Bacteria 1959
50 Ga0068853_100392147 3300005539 Bacteria 1298
51 Ga0070672_100048902 3300005543 Bacteria 3288
52 Ga0070672_100268598 3300005543 Bacteria 1440
53 Ga0070696_100280875 3300005546 Bacteria 1269
54 Ga0070704_100398603 3300005549 Bacteria 1174
55 Ga0068855_100006489 3300005563 Bacteria 14224
56 Ga0070664_100017054 3300005564 Bacteria 5961
57 Ga0070664_100058532 3300005564 Bacteria 3277
58 Ga0068857_100084367 3300005577 Unclassified 2839
59 Ga0068857_100094704 3300005577 Bacteria 2674
60 Ga0068857_100137438 3300005577 Bacteria 2207
61 Ga0068857_100145819 3300005577 Bacteria 2142
62 Ga0068854_100027163 3300005578 Bacteria 3942
63 Ga0068852_100615592 3300005616 Archaea 1091
64 Ga0068859_100048660 3300005617 Bacteria 4258
65 Ga0068859_100128709 3300005617 Unclassified 2602
66 Ga0068864_100061567 3300005618 Bacteria 3251
67 Ga0068864_100095055 3300005618 Unclassified 2635
68 Ga0068864_100420392 3300005618 Bacteria 1273
69 Ga0068864_100527176 3300005618 Unclassified 1139
70 Ga0068861_100397443 3300005719 Unclassified 1222
71 Ga0068861_100550187 3300005719 Unclassified 1052
72 Ga0068861_100558379 3300005719 Unclassified 1044
73 Ga0068870_10207732 3300005840 Bacteria 1191
74 Ga0068863_100387090 3300005841 Bacteria 1366
75 Ga0068858_100064453 3300005842 Bacteria 3391
76 Ga0068858_100163637 3300005842 Unclassified 2095
77 Ga0068862_100277184 3300005844 Unclassified 1536
78 Ga0081539_10046880 3300005985 Unclassified 2473
79 Ga0070717_10012858 3300006028 Bacteria 6393
80 Ga0097621_100482550 3300006237 Bacteria 1120
81 Ga0097621_100506847 3300006237 Unclassified 1094
82 Ga0068871_100080068 3300006358 Bacteria 2704
83 Ga0068871_100203102 3300006358 Bacteria 1712
84 Ga0068871_100219503 3300006358 Bacteria 1647
85 Ga0075428_100001461 3300006844 Bacteria 25275
86 Ga0075430_100440595 3300006846 Bacteria 1075
87 Ga0075431_100147781 3300006847 Bacteria 2421
88 Ga0075429_100122918 3300006880 Bacteria 2269
89 Ga0097620_100048660 3300006931 Bacteria 4258
90 Ga0097620_100128712 3300006931 Unclassified 2602
91 Ga0105240_10015853 3300009093 Bacteria 10224
92 Ga0111539_10099632 3300009094 Bacteria 3412
93 Ga0111539_10229955 3300009094 Bacteria 2159
94 Ga0105245_10000109 3300009098 Bacteria 79725
95 Ga0105245_10708507 3300009098 Bacteria 1040
96 Ga0114129_10009236 3300009147 Bacteria 14064
97 Ga0105243_10306552 3300009148 Unclassified 1441
98 Ga0105243_10377413 3300009148 Bacteria 1310
99 Ga0105241_10415530 3300009174 Unclassified 1183
100 Ga0105242_10035486 3300009176 Unclassified 3999
101 Ga0105242_10112882 3300009176 Bacteria 2320
102 Ga0105242_10632267 3300009176 Bacteria 1038
103 Ga0105248_10019615 3300009177 Bacteria 7484
104 Ga0105248_10071260 3300009177 Bacteria 3904
105 Ga0105248_10529242 3300009177 Unclassified 1329
106 Ga0105237_10030686 3300009545 Bacteria 5458
107 Ga0105249_10014373 3300009553 Bacteria 6999
108 Ga0105249_10097849 3300009553 Bacteria 2755
109 Ga0105249_10108298 3300009553 Bacteria 2623
110 Ga0105239_10181344 3300010375 Bacteria 2356
111 Ga0105239_10975517 3300010375 Unclassified 974
112 Ga0157373_10083297 3300013100 Unclassified 2254
113 Ga0157370_10149479 3300013104 Bacteria 2174
114 Ga0157370_10266426 3300013104 Bacteria 1583
115 Ga0157370_10374865 3300013104 Unclassified 1311
116 Ga0157369_10108904 3300013105 Bacteria 2946
117 Ga0157369_10342897 3300013105 Bacteria 1552
118 Ga0157374_10002646 3300013296 Bacteria 15081
119 Ga0157374_10546992 3300013296 Unclassified 1165
120 Ga0163162_10123549 3300013306 Unclassified 2694
121 Ga0163162_10195786 3300013306 Bacteria 2150
122 Ga0163162_10899836 3300013306 Bacteria 998
123 Ga0157372_10033658 3300013307 Bacteria 5631
124 Ga0157372_10102747 3300013307 Bacteria 3265
125 Ga0157372_10437762 3300013307 Bacteria 1524
126 Ga0157372_10473660 3300013307 Bacteria 1460
127 Ga0157375_10070249 3300013308 Bacteria 3511
128 Ga0163163_10664133 3300014325 Bacteria 1106
129 Ga0157380_10002784 3300014326 Bacteria 11883
130 Ga0157380_10754672 3300014326 Bacteria 985
131 Ga0157376_10124242 3300014969 Bacteria 2292
132 Ga0157376_10304402 3300014969 Bacteria 1510
133 Ga0163161_10000346 3300017792 Bacteria 39215
134 Ga0206350_10020050 3300020080 Eukaryota 1311
135 Ga0206354_10292290 3300020081 Eukaryota 1450
136 Ga0213872_10113596 3300021361 Bacteria 1201
137 Ga0224712_10098927 3300022467 Eukaryota 1234
138 Ga0207656_10106230 3300025321 Unclassified 1292
139 Ga0207688_10183795 3300025901 Bacteria 1248
140 Ga0207645_10085043 3300025907 Unclassified 2031
141 Ga0207643_10142957 3300025908 Bacteria 1430
142 Ga0207705_10012221 3300025909 Bacteria 6205
143 Ga0207684_10128337 3300025910 Bacteria 2176
144 Ga0207654_10203336 3300025911 Unclassified 1305
145 Ga0207707_10002236 3300025912 Bacteria 17492
146 Ga0207695_10130956 3300025913 Unclassified 2466
147 Ga0207695_10482386 3300025913 Bacteria 1122
148 Ga0207671_10110827 3300025914 Bacteria 2088
149 Ga0207652_10040081 3300025921 Bacteria 3977
150 Ga0207650_10094930 3300025925 Bacteria 2286
151 Ga0207650_10113390 3300025925 Bacteria 2101
152 Ga0207650_10231015 3300025925 Bacteria 1492
153 Ga0207659_10064015 3300025926 Bacteria 2660
154 Ga0207687_10000200 3300025927 Bacteria 40532
155 Ga0207644_10053160 3300025931 Unclassified 2914
156 Ga0207644_10147247 3300025931 Unclassified 1819
157 Ga0207706_10369713 3300025933 Bacteria 1245
158 Ga0207686_10082855 3300025934 Bacteria 2098
159 Ga0207709_10005354 3300025935 Bacteria 7301
160 Ga0207670_10009211 3300025936 Bacteria 5617
161 Ga0207670_10026761 3300025936 Unclassified 3639
162 Ga0207691_10008000 3300025940 Bacteria 10166
163 Ga0207691_10028852 3300025940 Bacteria 5193
164 Ga0207691_10191832 3300025940 Bacteria 1782
165 Ga0207661_10694138 3300025944 Unclassified 936
166 Ga0207679_10128201 3300025945 Bacteria 2031
167 Ga0207679_10320806 3300025945 Unclassified 1341
168 Ga0207679_10419735 3300025945 Unclassified 1180
169 Ga0207712_10001590 3300025961 Bacteria 15286
170 Ga0207712_10022921 3300025961 Bacteria 4117
171 Ga0207640_10039786 3300025981 Unclassified 2979
172 Ga0207703_10115693 3300026035 Unclassified 2295
173 Ga0207703_10124373 3300026035 Unclassified 2218
174 Ga0207639_10431067 3300026041 Bacteria 1194
175 Ga0207678_10085336 3300026067 Bacteria 2699
176 Ga0207641_10106205 3300026088 Unclassified 2481
177 Ga0207641_10137221 3300026088 Bacteria 2203
178 Ga0207648_10189601 3300026089 Unclassified 1821
179 Ga0207676_10118382 3300026095 Bacteria 2229
180 Ga0207676_10136347 3300026095 Bacteria 2094
181 Ga0207676_10312634 3300026095 Bacteria 1439
182 Ga0207676_10326887 3300026095 Bacteria 1410
183 Ga0207674_10029592 3300026116 Bacteria 5766
184 Ga0207674_10061428 3300026116 Unclassified 3797
185 Ga0207674_10147263 3300026116 Bacteria 2313
186 Ga0207674_10215066 3300026116 Bacteria 1871
187 Ga0207675_100407665 3300026118 Bacteria 1340
188 Ga0207675_100542535 3300026118 Bacteria 1161
189 Ga0207683_10003975 3300026121 Bacteria 12820
190 Ga0207698_10582591 3300026142 Archaea 1101
191 Ga0268266_10000954 3300028379 Bacteria 36886
192 Ga0268265_10057931 3300028380 Unclassified 2955
193 Ga0268265_10181625 3300028380 Bacteria 1808
194 Ga0268265_10274026 3300028380 Bacteria 1507
195 Ga0268265_10458504 3300028380 Unclassified 1192
196 Ga0268264_10008109 3300028381 Bacteria 8735
197 Ga0268264_10326319 3300028381 Unclassified 1453
198 Ga0268264_10450831 3300028381 Unclassified 1246
199 Ga0265338_10135456 3300028800 Bacteria 1937
200 Ga0307509_10004839 3300031507 Bacteria 19133
201 Ga0307408_100164754 3300031548 Bacteria 1764
202 Ga0307408_100166874 3300031548 Bacteria 1754
203 Ga0307508_10019247 3300031616 Bacteria 6206
204 Ga0307516_10360214 3300031730 Bacteria 1119
205 Ga0307405_10039793 3300031731 Unclassified 2844
206 Ga0307405_10043065 3300031731 Bacteria 2751
207 Ga0307405_10072445 3300031731 Bacteria 2221
208 Ga0307405_10075337 3300031731 Bacteria 2185
209 Ga0307405_10232852 3300031731 Bacteria 1359
210 Ga0307405_10304600 3300031731 Unclassified 1210
211 Ga0307413_10009109 3300031824 Bacteria 4731
212 Ga0307413_10065885 3300031824 Bacteria 2257
213 Ga0307413_10173075 3300031824 Bacteria 1530
214 Ga0307410_10000661 3300031852 Bacteria 14256
215 Ga0307410_10006779 3300031852 Bacteria 6212
216 Ga0307410_10145862 3300031852 Bacteria 1756
217 Ga0307410_10445602 3300031852 Archaea 1055
218 Ga0307406_10048143 3300031901 Bacteria 2691
219 Ga0307406_10053286 3300031901 Bacteria 2576
220 Ga0307406_10056463 3300031901 Bacteria 2514
221 Ga0307406_10068304 3300031901 Bacteria 2320
222 Ga0307407_10001259 3300031903 Bacteria 9017
223 Ga0307407_10086713 3300031903 Bacteria 1908
224 Ga0307412_10046360 3300031911 Bacteria 2848
225 Ga0307412_10063865 3300031911 Bacteria 2486
226 Ga0307412_10186956 3300031911 Bacteria 1563
227 Ga0307409_100002063 3300031995 Bacteria 10328
228 Ga0307409_100015590 3300031995 Bacteria 4994
229 Ga0307409_100036479 3300031995 Bacteria 3614
230 Ga0307409_100049984 3300031995 Bacteria 3191
231 Ga0307409_100091184 3300031995 Bacteria 2497
232 Ga0307409_100226593 3300031995 Bacteria 1691
233 Ga0307416_100011442 3300032002 Bacteria 5919
234 Ga0307416_100095760 3300032002 Bacteria 2564
235 Ga0307416_100224584 3300032002 Bacteria 1804
236 Ga0307414_10007305 3300032004 Bacteria 6207
237 Ga0307414_10108332 3300032004 Bacteria 2107
238 Ga0307414_10379407 3300032004 Bacteria 1222
239 Ga0307414_10473456 3300032004 Unclassified 1103
240 Ga0307411_10012456 3300032005 Bacteria 4642
241 Ga0307411_10023100 3300032005 Bacteria 3676
242 Ga0307411_10083701 3300032005 Bacteria 2204
243 Ga0307411_10222392 3300032005 Unclassified 1466
244 Ga0307415_100108150 3300032126 Bacteria 2056
245 Ga0307415_100109363 3300032126 Bacteria 2047
246 Ga0307415_100123522 3300032126 Bacteria 1946
247 Ga0307415_100405205 3300032126 Bacteria 1165
248 Ga0307507_10071345 3300033179 Bacteria 3142
249 Ga0373943_0029588 3300035170 Bacteria 2588
250 Ga0373927_0019031 3300035695 Bacteria 4504
251 Ga0373937_0603691 3300036401 Unclassified 1042
252 Ga0373925_0023664 3300037068 Bacteria 4482
253 Ga0395899_0005726 3300037312 Bacteria 9645
254 Ga0395900_0090744 3300037418 Bacteria 3140
255 Ga0395898_0029003 3300037466 Bacteria 5546
256 Ga0395905_0028789 3300037471 Bacteria 5234
257 Ga0395905_0185316 3300037471 Bacteria 1954
258 Ga0395901_0035118 3300038443 Bacteria 5180
259 Ga0395901_0462152 3300038443 Unclassified 1297
260 Ga0436365_1497300 3300039437 Bacteria 6540
261 Ga0436361_0438866 3300039447 Bacteria 1545
262 Ga0439465_0113513 3300041413 Bacteria 945
263 Ga0451577_0019003 3300042876 Bacteria 6325
264 Ga0453683_0051650 3300044673 Bacteria 2575
265 Ga0495603_0047996 3300046455 Bacteria 2542
266 Ga0495638_0222559 3300046460 Bacteria 1054
267 Ga0495641_0080343 3300046461 Bacteria 1461
268 Ga0495650_0019518 3300046471 Bacteria 3333
269 Ga0495580_0097481 3300046472 Bacteria 2045
270 Ga0495594_0101526 3300046499 Bacteria 1618
271 Ga0495598_0002936 3300046537 Bacteria 3576
272 Ga0495668_0006388 3300046616 Bacteria 7725
273 Ga0495686_0012479 3300047472 Bacteria 5941
274 Ga0496108_0718423 3300048911 Bacteria 866
275 Ga0496109_0713100 3300048912 Unclassified 941
276 Ga0496110_0105958 3300048913 Bacteria 2523
277 Ga0496110_0359864 3300048913 Bacteria 1326
278 Ga0496112_0375190 3300048915 Bacteria 1364
279 Ga0501070_0065961 3300049586 Bacteria 2997
280 Ga0501072_0019571 3300049588 Bacteria 5235
281 Ga0501074_0619303 3300049590 Bacteria 765
282 Ga0501257_013618 3300049686 Bacteria 1866
283 Ga0501225_0008602 3300049705 Unclassified 2925
284 Ga0501081_0132781 3300049743 Bacteria 1780
285 Ga0501083_0032754 3300049744 Bacteria 3562
286 nmdc:mga05p37_18773_c1 3300050507 Bacteria 8355
287 nmdc:mga09592_117866_c1 3300050508 Bacteria 2279
288 nmdc:mga06r32_22610_c1 3300050510 Bacteria 5814
289 nmdc:mga08y16_248561_c1 3300050511 Bacteria 1838
290 Ga0501084_0526154 3300054114 Bacteria 1000
291 Ga0501082_0218715 3300060353 Bacteria 1657
292 2738837460 2738541299 Bacteria 4020721
293 2857611710 2857609550 Bacteria 3753890
294 3006827869 3006826541 Bacteria 4678913
295 Ga0206352_10635221
296 Ga0065704_10111920
297 Ga0065715_10375603
298 Ga0070658_10017632
299 Ga0070676_10135091
300 Ga0070683_100608048
301 Ga0070670_100031781
302 Ga0070670_100047133
303 Ga0070670_100068088
304 Ga0070677_10038012
305 Ga0068869_100044723
306 Ga0068869_100385647
307 Ga0070680_100244473
308 Ga0070682_100003337
309 Ga0070689_100009879
310 Ga0070689_100041291
311 Ga0070671_100049099
312 Ga0070671_100051758
313 Ga0070671_100058746
314 Ga0070671_100072440
315 Ga0070674_100294124
316 Ga0070673_100529215
317 Ga0070688_100037524
318 Ga0070659_100007620
319 Ga0070667_100332308
320 Ga0070701_10054648
321 Ga0070708_100337467
322 Ga0070663_100215185
323 Ga0070678_100002505
324 Ga0070662_100495476
325 Ga0070662_100503098
326 Ga0070681_10003907
327 Ga0070681_10006349
328 Ga0068867_100293219
329 Ga0070706_100043081
330 Ga0070707_100102172
331 Ga0070698_100004975
332 Ga0070698_100050630
333 Ga0070679_100032037
334 Ga0070679_100207711
335 Ga0070679_100253134
336 Ga0070679_100305158
337 Ga0070684_100204072
338 Ga0070684_100262306
339 Ga0070684_100354681
340 Ga0068853_100019664
341 Ga0068853_100028522
342 Ga0068853_100146118
343 Ga0068853_100172289
344 Ga0068853_100392147
345 Ga0070672_100048902
346 Ga0070672_100268598
347 Ga0070696_100280875
348 Ga0070704_100398603
349 Ga0068855_100006489
350 Ga0070664_100017054
351 Ga0070664_100058532
352 Ga0068857_100084367
353 Ga0068857_100094704
354 Ga0068857_100137438
355 Ga0068857_100145819
356 Ga0068854_100027163
357 Ga0068852_100615592
358 Ga0068859_100048660
359 Ga0068859_100128709
360 Ga0068864_100061567
361 Ga0068864_100095055
362 Ga0068864_100420392
363 Ga0068864_100527176
364 Ga0068861_100397443
365 Ga0068861_100550187
366 Ga0068861_100558379
367 Ga0068870_10207732
368 Ga0068863_100387090
369 Ga0068858_100064453
370 Ga0068858_100163637
371 Ga0068862_100277184
372 Ga0081539_10046880
373 Ga0070717_10012858
374 Ga0097621_100482550
375 Ga0097621_100506847
376 Ga0068871_100080068
377 Ga0068871_100203102
378 Ga0068871_100219503
379 Ga0075428_100001461
380 Ga0075430_100440595
381 Ga0075431_100147781
382 Ga0075429_100122918
383 Ga0097620_100048660
384 Ga0097620_100128712
385 Ga0105240_10015853
386 Ga0111539_10099632
387 Ga0111539_10229955
388 Ga0105245_10000109
389 Ga0105245_10708507
390 Ga0114129_10009236
391 Ga0105243_10306552
392 Ga0105243_10377413
393 Ga0105241_10415530
394 Ga0105242_10035486
395 Ga0105242_10112882
396 Ga0105242_10632267
397 Ga0105248_10019615
398 Ga0105248_10071260
399 Ga0105248_10529242
400 Ga0105237_10030686
401 Ga0105249_10014373
402 Ga0105249_10097849
403 Ga0105249_10108298
404 Ga0105239_10181344
405 Ga0105239_10975517
406 Ga0157373_10083297
407 Ga0157370_10149479
408 Ga0157370_10266426
409 Ga0157370_10374865
410 Ga0157369_10108904
411 Ga0157369_10342897
412 Ga0157374_10002646
413 Ga0157374_10546992
414 Ga0163162_10123549
415 Ga0163162_10195786
416 Ga0163162_10899836
417 Ga0157372_10033658
418 Ga0157372_10102747
419 Ga0157372_10437762
420 Ga0157372_10473660
421 Ga0157375_10070249
422 Ga0163163_10664133
423 Ga0157380_10002784
424 Ga0157380_10754672
425 Ga0157376_10124242
426 Ga0157376_10304402
427 Ga0163161_10000346
428 Ga0206350_10020050
429 Ga0206354_10292290
430 Ga0213872_10113596
431 Ga0224712_10098927
432 Ga0207656_10106230
433 Ga0207688_10183795
434 Ga0207645_10085043
435 Ga0207643_10142957
436 Ga0207705_10012221
437 Ga0207684_10128337
438 Ga0207654_10203336
439 Ga0207707_10002236
440 Ga0207695_10130956
441 Ga0207695_10482386
442 Ga0207671_10110827
443 Ga0207652_10040081
444 Ga0207650_10094930
445 Ga0207650_10113390
446 Ga0207650_10231015
447 Ga0207659_10064015
448 Ga0207687_10000200
449 Ga0207644_10053160
450 Ga0207644_10147247
451 Ga0207706_10369713
452 Ga0207686_10082855
453 Ga0207709_10005354
454 Ga0207670_10009211
455 Ga0207670_10026761
456 Ga0207691_10008000
457 Ga0207691_10028852
458 Ga0207691_10191832
459 Ga0207661_10694138
460 Ga0207679_10128201
461 Ga0207679_10320806
462 Ga0207679_10419735
463 Ga0207712_10001590
464 Ga0207712_10022921
465 Ga0207640_10039786
466 Ga0207703_10115693
467 Ga0207703_10124373
468 Ga0207639_10431067
469 Ga0207678_10085336
470 Ga0207641_10106205
471 Ga0207641_10137221
472 Ga0207648_10189601
473 Ga0207676_10118382
474 Ga0207676_10136347
475 Ga0207676_10312634
476 Ga0207676_10326887
477 Ga0207674_10029592
478 Ga0207674_10061428
479 Ga0207674_10147263
480 Ga0207674_10215066
481 Ga0207675_100407665
482 Ga0207675_100542535
483 Ga0207683_10003975
484 Ga0207698_10582591
485 Ga0268266_10000954
486 Ga0268265_10057931
487 Ga0268265_10181625
488 Ga0268265_10274026
489 Ga0268265_10458504
490 Ga0268264_10008109
491 Ga0268264_10326319
492 Ga0268264_10450831
493 Ga0265338_10135456
494 Ga0307509_10004839
495 Ga0307408_100164754
496 Ga0307408_100166874
497 Ga0307508_10019247
498 Ga0307516_10360214
499 Ga0307405_10039793
500 Ga0307405_10043065
501 Ga0307405_10072445
502 Ga0307405_10075337
503 Ga0307405_10232852
504 Ga0307405_10304600
505 Ga0307413_10009109
506 Ga0307413_10065885
507 Ga0307413_10173075
508 Ga0307410_10000661
509 Ga0307410_10006779
510 Ga0307410_10145862
511 Ga0307410_10445602
512 Ga0307406_10048143
513 Ga0307406_10053286
514 Ga0307406_10056463
515 Ga0307406_10068304
516 Ga0307407_10001259
517 Ga0307407_10086713
518 Ga0307412_10046360
519 Ga0307412_10063865
520 Ga0307412_10186956
521 Ga0307409_100002063
522 Ga0307409_100015590
523 Ga0307409_100036479
524 Ga0307409_100049984
525 Ga0307409_100091184
526 Ga0307409_100226593
527 Ga0307416_100011442
528 Ga0307416_100095760
529 Ga0307416_100224584
530 Ga0307414_10007305
531 Ga0307414_10108332
532 Ga0307414_10379407
533 Ga0307414_10473456
534 Ga0307411_10012456
535 Ga0307411_10023100
536 Ga0307411_10083701
537 Ga0307411_10222392
538 Ga0307415_100108150
539 Ga0307415_100109363
540 Ga0307415_100123522
541 Ga0307415_100405205
542 Ga0307507_10071345
543 Ga0373943_0029588
544 Ga0373927_0019031
545 Ga0373937_0603691
546 Ga0373925_0023664
547 Ga0395899_0005726
548 Ga0395900_0090744
549 Ga0395898_0029003
550 Ga0395905_0028789
551 Ga0395905_0185316
552 Ga0395901_0035118
553 Ga0395901_0462152
554 Ga0436365_1497300
555 Ga0436361_0438866
556 Ga0439465_0113513
557 Ga0451577_0019003
558 Ga0453683_0051650
559 Ga0495603_0047996
560 Ga0495638_0222559
561 Ga0495641_0080343
562 Ga0495650_0019518
563 Ga0495580_0097481
564 Ga0495594_0101526
565 Ga0495598_0002936
566 Ga0495668_0006388
567 Ga0495686_0012479
568 Ga0496108_0718423
569 Ga0496109_0713100
570 Ga0496110_0105958
571 Ga0496110_0359864
572 Ga0496112_0375190
573 Ga0501070_0065961
574 Ga0501072_0019571
575 Ga0501074_0619303
576 Ga0501257_013618
577 Ga0501225_0008602
578 Ga0501081_0132781
579 Ga0501083_0032754
580 nmdc:mga05p37_18773_c1
581 nmdc:mga09592_117866_c1
582 nmdc:mga06r32_22610_c1
583 nmdc:mga08y16_248561_c1
584 Ga0501084_0526154
585 Ga0501082_0218715
586 2738837460
587 2857611710
588 3006827869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

13

216

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

19

262

0.95

PF08659

KR

KR domain

14

128

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fc7-assembly1.cif.gz_D studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr 0.9703 5 255
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.966 11 252
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9643 11 255
4ag3-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with nadph at 1.8a resolution 0.9617 11 253
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9608 7 253
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9811 12 94 3.40.50.720
af_C0P944_2_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.965 5 255 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9647 14 60 3.40.50.720
af_Q59SL5_4_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 3 255 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 12 192 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A382NCG3-F1-model_v4 Uncharacterized protein 0.9898 6 173 GO:0005777
GO:0008670
GO:0009062
AF-A0A3C1SU17-F1-model_v4 Short-chain dehydrogenase 0.9884 5 187 GO:0005777
GO:0008670
GO:0009062
AF-A0A7C6XA81-F1-model_v4 SDR family oxidoreductase 0.9844 12 192 GO:0016491
AF-A0A0C4F328-F1-model_v4 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (EC 1.3.1.124) 0.9823 5 250 GO:0005782
GO:0008670
GO:0009062
AF-A0A7S7QSV7-F1-model_v4 Short-chain dehydrogenase 0.9789 8 255 GO:0005777
GO:0008670
GO:0009062

Map