F392100

General Info

Members Datasets Scaffolds Average Seq Length
294 159 294 145

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10857062|Ga0163161_108570621
Length 180
Sequence LTGIPNSRHNFFCIQSIDFTRCFDTFSALFSSLVMKTYLPKVNLEQRKWHVIDADGAVLGRLAVQVADVLRGKNKPVFTPHLDAGDFVVVINAEKVRVTGKKETEKLFMSYSGWKGGEKYTSVAQVRAKNSEKLITHAVKGMVPKNRLGRVLMTKLKVYKGADHPHQAQQPDAVTTARRS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.34
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10480403 3300005290 Unclassified 661
2 Ga0070658_11062302 3300005327 Bacteria 704
3 Ga0070676_11052424 3300005328 Bacteria 613
4 Ga0070690_100191115 3300005330 Bacteria 1419
5 Ga0070670_100639689 3300005331 Bacteria 954
6 Ga0068869_100289199 3300005334 Unclassified 1320
7 Ga0070689_100444076 3300005340 Unclassified 1103
8 Ga0070691_10073701 3300005341 Bacteria 1660
9 Ga0070675_100300512 3300005354 Bacteria 1414
10 Ga0070675_100514827 3300005354 Bacteria 1079
11 Ga0070675_101653775 3300005354 Bacteria 591
12 Ga0070674_101412756 3300005356 Bacteria 623
13 Ga0070688_100278815 3300005365 Bacteria 1200
14 Ga0070688_100297235 3300005365 Bacteria 1166
15 Ga0070688_100455485 3300005365 Unclassified 957
16 Ga0070709_11120423 3300005434 Bacteria 630
17 Ga0070711_100001752 3300005439 Bacteria 12061
18 Ga0070700_100220592 3300005441 Bacteria 1343
19 Ga0070694_101535205 3300005444 Bacteria 564
20 Ga0070694_101886722 3300005444 Unclassified 510
21 Ga0070681_10243845 3300005458 Bacteria 1710
22 Ga0070681_10936806 3300005458 Bacteria 785
23 Ga0068867_100150709 3300005459 Bacteria 1826
24 Ga0068867_100618431 3300005459 Bacteria 947
25 Ga0070685_10036609 3300005466 Bacteria 2775
26 Ga0070685_10368714 3300005466 Bacteria 986
27 Ga0070698_100419190 3300005471 Unclassified 1273
28 Ga0070684_101384659 3300005535 Bacteria 662
29 Ga0070686_100060882 3300005544 Bacteria 2437
30 Ga0070686_100182454 3300005544 Bacteria 1492
31 Ga0070686_100197127 3300005544 Bacteria 1441
32 Ga0070686_101023443 3300005544 Bacteria 678
33 Ga0070695_101374088 3300005545 Unclassified 585
34 Ga0070665_100055519 3300005548 Bacteria 3972
35 Ga0068855_100017598 3300005563 Bacteria 8594
36 Ga0068855_101061434 3300005563 Bacteria 848
37 Ga0068855_101766971 3300005563 Bacteria 629
38 Ga0068857_101046130 3300005577 Bacteria 787
39 Ga0068857_101047144 3300005577 Bacteria 786
40 Ga0068857_101261299 3300005577 Bacteria 716
41 Ga0068856_100000080 3300005614 Bacteria 90679
42 Ga0068856_100127776 3300005614 Bacteria 2545
43 Ga0068856_100457322 3300005614 Bacteria 1297
44 Ga0068852_102356003 3300005616 Unclassified 553
45 Ga0068859_100061829 3300005617 Bacteria 3774
46 Ga0068859_100246729 3300005617 Unclassified 1875
47 Ga0068859_100505322 3300005617 Unclassified 1304
48 Ga0068859_101872060 3300005617 Bacteria 662
49 Ga0068864_101030165 3300005618 Bacteria 817
50 Ga0068864_101288712 3300005618 Bacteria 731
51 Ga0068864_101716014 3300005618 Unclassified 633
52 Ga0068864_101802898 3300005618 Bacteria 617
53 Ga0068866_10895855 3300005718 Unclassified 624
54 Ga0068863_100072633 3300005841 Bacteria 3255
55 Ga0068863_100316995 3300005841 Bacteria 1514
56 Ga0068863_100421231 3300005841 Bacteria 1308
57 Ga0068863_100533050 3300005841 Bacteria 1158
58 Ga0068863_100710910 3300005841 Bacteria 999
59 Ga0097621_101907829 3300006237 Bacteria 567
60 Ga0075428_100000468 3300006844 Bacteria 40623
61 Ga0075428_100319655 3300006844 Bacteria 1668
62 Ga0075428_101697157 3300006844 Bacteria 659
63 Ga0075430_100101133 3300006846 Unclassified 2407
64 Ga0075430_100422043 3300006846 Bacteria 1101
65 Ga0075431_100060540 3300006847 Bacteria 3906
66 Ga0075431_100187787 3300006847 Bacteria 2118
67 Ga0075433_10202087 3300006852 Bacteria 1767
68 Ga0075433_10664809 3300006852 Bacteria 913
69 Ga0075433_11049865 3300006852 Unclassified 709
70 Ga0075434_100580745 3300006871 Bacteria 1140
71 Ga0097620_100061830 3300006931 Bacteria 3774
72 Ga0097620_100246733 3300006931 Unclassified 1875
73 Ga0097620_100505340 3300006931 Unclassified 1304
74 Ga0097620_101872093 3300006931 Bacteria 662
75 Ga0111539_10002816 3300009094 Bacteria 23104
76 Ga0111539_10575747 3300009094 Unclassified 1311
77 Ga0111539_11908886 3300009094 Bacteria 689
78 Ga0111539_11944710 3300009094 Bacteria 682
79 Ga0111539_13050529 3300009094 Bacteria 541
80 Ga0111539_13090680 3300009094 Bacteria 537
81 Ga0105245_10871923 3300009098 Bacteria 941
82 Ga0105241_10739032 3300009174 Bacteria 901
83 Ga0105242_11495421 3300009176 Unclassified 706
84 Ga0105248_10001477 3300009177 Bacteria 26157
85 Ga0105238_10349014 3300009551 Bacteria 1469
86 Ga0105238_12378343 3300009551 Bacteria 565
87 Ga0105239_13004964 3300010375 Unclassified 550
88 Ga0157374_11090599 3300013296 Unclassified 819
89 Ga0163162_10328924 3300013306 Bacteria 1661
90 Ga0163162_10401796 3300013306 Unclassified 1503
91 Ga0163162_10643847 3300013306 Bacteria 1184
92 Ga0163162_12458512 3300013306 Unclassified 599
93 Ga0157375_10000016 3300013308 Bacteria 295002
94 Ga0157375_10648008 3300013308 Bacteria 1213
95 Ga0163163_10000096 3300014325 Bacteria 93313
96 Ga0163163_10230307 3300014325 Bacteria 1902
97 Ga0163163_10273891 3300014325 Bacteria 1739
98 Ga0163163_13002141 3300014325 Bacteria 526
99 Ga0157377_10582609 3300014745 Bacteria 795
100 Ga0163161_10857062 3300017792 Bacteria 767
101 Ga0207695_10298767 3300025913 Bacteria 1502
102 Ga0207663_10001649 3300025916 Bacteria 10525
103 Ga0207694_10264285 3300025924 Bacteria 1410
104 Ga0207694_10487247 3300025924 Bacteria 1032
105 Ga0207694_10657940 3300025924 Bacteria 883
106 Ga0207694_11520098 3300025924 Bacteria 565
107 Ga0207659_10437574 3300025926 Bacteria 1099
108 Ga0207659_10793034 3300025926 Unclassified 814
109 Ga0207686_10863471 3300025934 Unclassified 728
110 Ga0207670_11039472 3300025936 Bacteria 690
111 Ga0207670_11044061 3300025936 Unclassified 689
112 Ga0207665_10489736 3300025939 Bacteria 949
113 Ga0207711_10005461 3300025941 Bacteria 10746
114 Ga0207667_10045269 3300025949 Bacteria 4661
115 Ga0207667_10669124 3300025949 Bacteria 1042
116 Ga0207651_11208421 3300025960 Bacteria 679
117 Ga0207677_10162491 3300026023 Unclassified 1737
118 Ga0207677_10792503 3300026023 Unclassified 848
119 Ga0207702_10001107 3300026078 Bacteria 27560
120 Ga0207702_10018433 3300026078 Bacteria 5775
121 Ga0207641_10042798 3300026088 Bacteria 3801
122 Ga0207641_10555463 3300026088 Bacteria 1120
123 Ga0207648_10392860 3300026089 Bacteria 1256
124 Ga0207648_12064397 3300026089 Bacteria 531
125 Ga0207676_10941627 3300026095 Bacteria 849
126 Ga0207674_10096595 3300026116 Bacteria 2939
127 Ga0207683_10085423 3300026121 Bacteria 2805
128 Ga0207428_10715928 3300027907 Bacteria 715
129 Ga0268265_11265767 3300028380 Bacteria 737
130 Ga0268264_10380295 3300028381 Unclassified 1352
131 Ga0265337_1005752 3300028556 Bacteria 4871
132 Ga0265337_1010638 3300028556 Bacteria 3211
133 Ga0265337_1014337 3300028556 Bacteria 2629
134 Ga0265337_1024597 3300028556 Bacteria 1840
135 Ga0265337_1040955 3300028556 Bacteria 1334
136 Ga0265326_10025410 3300028558 Bacteria 1689
137 Ga0265319_1006204 3300028563 Bacteria 5570
138 Ga0265319_1018987 3300028563 Bacteria 2577
139 Ga0265334_10099247 3300028573 Bacteria 1055
140 Ga0265318_10021383 3300028577 Bacteria 2597
141 Ga0265318_10025058 3300028577 Bacteria 2360
142 Ga0265323_10000140 3300028653 Bacteria 41860
143 Ga0265323_10011578 3300028653 Bacteria 3557
144 Ga0265322_10069731 3300028654 Unclassified 997
145 Ga0265322_10116748 3300028654 Bacteria 760
146 Ga0265336_10000493 3300028666 Bacteria 23115
147 Ga0265336_10052757 3300028666 Bacteria 1226
148 Ga0265338_10000616 3300028800 Bacteria 62218
149 Ga0265338_10001074 3300028800 Bacteria 45350
150 Ga0265338_10001502 3300028800 Bacteria 37738
151 Ga0265338_10001829 3300028800 Bacteria 33349
152 Ga0265338_10006138 3300028800 Bacteria 15421
153 Ga0265338_10011262 3300028800 Bacteria 10354
154 Ga0265338_10028836 3300028800 Bacteria 5523
155 Ga0265338_10030886 3300028800 Bacteria 5264
156 Ga0265338_10032913 3300028800 Bacteria 5045
157 Ga0265338_10075148 3300028800 Bacteria 2869
158 Ga0265338_10142119 3300028800 Bacteria 1879
159 Ga0265338_10349156 3300028800 Bacteria 1064
160 Ga0265338_10478992 3300028800 Bacteria 878
161 Ga0265324_10000188 3300029957 Bacteria 47481
162 Ga0265324_10010515 3300029957 Bacteria 3562
163 Ga0265324_10018332 3300029957 Bacteria 2533
164 Ga0265775_101901 3300030762 Bacteria 1044
165 Ga0265332_10102720 3300031238 Bacteria 1205
166 Ga0265320_10000551 3300031240 Bacteria 28889
167 Ga0265320_10001912 3300031240 Bacteria 14716
168 Ga0265320_10003300 3300031240 Bacteria 10889
169 Ga0265320_10075083 3300031240 Bacteria 1586
170 Ga0265320_10081405 3300031240 Bacteria 1511
171 Ga0265320_10256104 3300031240 Bacteria 776
172 Ga0265340_10001551 3300031247 Bacteria 13183
173 Ga0265340_10014133 3300031247 Bacteria 4179
174 Ga0265340_10338889 3300031247 Unclassified 665
175 Ga0265339_10006711 3300031249 Bacteria 7518
176 Ga0265339_10037622 3300031249 Bacteria 2704
177 Ga0265339_10155029 3300031249 Bacteria 1156
178 Ga0265331_10035614 3300031250 Bacteria 2448
179 Ga0265327_10001590 3300031251 Bacteria 27697
180 Ga0265316_10015764 3300031344 Bacteria 6591
181 Ga0265316_10023632 3300031344 Bacteria 5160
182 Ga0265316_10078327 3300031344 Bacteria 2537
183 Ga0265316_10164052 3300031344 Bacteria 1660
184 Ga0265316_11012059 3300031344 Bacteria 578
185 Ga0265314_10028259 3300031711 Bacteria 4184
186 Ga0265314_10028902 3300031711 Bacteria 4126
187 Ga0265342_10088684 3300031712 Unclassified 1776
188 Ga0265342_10106430 3300031712 Bacteria 1592
189 Ga0265342_10288530 3300031712 Bacteria 867
190 Ga0265342_10388475 3300031712 Bacteria 722
191 Ga0316576_10090220 3300031727 Bacteria 2283
192 Ga0316578_10041644 3300031728 Bacteria 2661
193 Ga0316577_10073439 3300031733 Bacteria 1910
194 Ga0307409_100774457 3300031995 Bacteria 965
195 Ga0307415_100938442 3300032126 Bacteria 800
196 Ga0373928_0000207 3300035084 Bacteria 11337
197 Ga0373940_0023551 3300035088 Bacteria 1590
198 Ga0373944_0004231 3300035089 Bacteria 3731
199 Ga0373944_0055295 3300035089 Bacteria 1260
200 Ga0373949_0019311 3300035090 Bacteria 1551
201 Ga0373951_0022062 3300035091 Bacteria 1464
202 Ga0373951_0046063 3300035091 Bacteria 1062
203 Ga0373932_0000004 3300035112 Bacteria 412176
204 Ga0373939_0034980 3300035114 Bacteria 1477
205 Ga0373943_0539025 3300035170 Bacteria 684
206 Ga0373946_0103434 3300035171 Bacteria 1280
207 Ga0373942_0074698 3300035207 Bacteria 996
208 Ga0373962_0000015 3300035242 Bacteria 48259
209 Ga0316574_0105872 3300035398 Bacteria 1802
210 Ga0373931_0000036 3300035691 Bacteria 79351
211 Ga0373931_0564499 3300035691 Bacteria 741
212 Ga0373935_0139808 3300035692 Bacteria 1635
213 Ga0373927_0214284 3300035695 Bacteria 1265
214 Ga0373927_1063796 3300035695 Bacteria 534
215 Ga0373937_0108904 3300036401 Unclassified 2576
216 Ga0373937_0355205 3300036401 Bacteria 1389
217 Ga0316584_0498419 3300036712 Bacteria 856
218 Ga0373925_0000522 3300037068 Bacteria 38320
219 Ga0395900_0105522 3300037418 Bacteria 2895
220 Ga0395905_0054252 3300037471 Bacteria 3751
221 Ga0436364_0120890 3300037853 Bacteria 531
222 Ga0436361_1126292 3300039447 Bacteria 541
223 Ga0451849_0248645 3300041505 Bacteria 833
224 Ga0439435_0264848 3300042436 Unclassified 582
225 Ga0451577_0032935 3300042876 Bacteria 4671
226 Ga0451577_0129060 3300042876 Bacteria 2267
227 Ga0451577_0487919 3300042876 Bacteria 1119
228 Ga0451577_1452568 3300042876 Bacteria 607
229 Ga0453684_0000532 3300044712 Bacteria 145255
230 Ga0453684_0447349 3300044712 Bacteria 1439
231 Ga0451576_0053341 3300045051 Bacteria 4236
232 Ga0451576_0067046 3300045051 Bacteria 3736
233 Ga0451576_0106187 3300045051 Bacteria 2922
234 Ga0451576_0172178 3300045051 Unclassified 2260
235 Ga0451576_0550221 3300045051 Bacteria 1212
236 Ga0451576_0578542 3300045051 Bacteria 1180
237 Ga0451576_0702080 3300045051 Bacteria 1063
238 Ga0495592_0000080 3300046454 Bacteria 84061
239 Ga0495662_0005683 3300046476 Bacteria 6234
240 Ga0495664_0389488 3300046477 Bacteria 837
241 Ga0495594_0403911 3300046499 Bacteria 777
242 Ga0495618_0065751 3300046514 Bacteria 2304
243 Ga0495628_0000510 3300046516 Bacteria 35585
244 Ga0495630_0000022 3300046517 Bacteria 172932
245 Ga0495630_0190481 3300046517 Bacteria 1565
246 Ga0495630_0340223 3300046517 Bacteria 1148
247 Ga0495630_0569343 3300046517 Bacteria 869
248 Ga0495630_0574649 3300046517 Bacteria 864
249 Ga0495666_0007144 3300046526 Bacteria 5610
250 Ga0495652_0146195 3300046529 Bacteria 1853
251 Ga0495640_0044332 3300046533 Bacteria 3093
252 Ga0495586_0000222 3300046535 Bacteria 37841
253 Ga0495586_0000350 3300046535 Bacteria 28890
254 Ga0495586_0029349 3300046535 Bacteria 2943
255 Ga0495586_0141416 3300046535 Bacteria 1351
256 Ga0495587_0051551 3300046536 Bacteria 2433
257 Ga0495645_0008548 3300046543 Bacteria 7150
258 Ga0495645_0124085 3300046543 Bacteria 1816
259 Ga0495645_0438272 3300046543 Bacteria 826
260 Ga0495667_0448295 3300046559 Bacteria 811
261 Ga0495634_0046952 3300046642 Bacteria 2912
262 Ga0495599_0010278 3300046678 Bacteria 5727
263 Ga0495599_0300448 3300046678 Bacteria 969
264 Ga0495599_0716525 3300046678 Bacteria 576
265 Ga0495646_0411162 3300046680 Bacteria 702
266 Ga0495647_0192577 3300046681 Bacteria 891
267 Ga0495658_0004634 3300046683 Bacteria 6761
268 Ga0495658_0365115 3300046683 Bacteria 918
269 Ga0495658_1074265 3300046683 Unclassified 513
270 Ga0495613_0225296 3300046689 Bacteria 1315
271 Ga0495624_0012647 3300046690 Bacteria 5764
272 Ga0495624_0505746 3300046690 Bacteria 723
273 Ga0495581_0093223 3300047315 Bacteria 1748
274 Ga0495581_0159848 3300047315 Bacteria 1317
275 Ga0495674_0000401 3300047319 Bacteria 38833
276 Ga0495674_0090628 3300047319 Bacteria 2612
277 Ga0495674_1056038 3300047319 Unclassified 620
278 Ga0495684_0351796 3300047471 Bacteria 1046
279 Ga0496106_1160864 3300048909 Bacteria 603
280 Ga0501298_079568 3300049521 Bacteria 719
281 Ga0501047_0439281 3300049581 Bacteria 1135
282 Ga0501070_0937851 3300049586 Bacteria 674
283 Ga0501035_0022602 3300049822 Bacteria 5777
284 nmdc:mga09592_114705_c1 3300050508 Bacteria 2312
285 nmdc:mga0qj67_234532_c1 3300050509 Bacteria 1489
286 nmdc:mga06r32_141428_c1 3300050510 Bacteria 2383
287 nmdc:mga06r32_152851_c1 3300050510 Bacteria 2287
288 nmdc:mga08y16_13869_c1 3300050511 Bacteria 8479
289 nmdc:mga08y16_1985947_c1 3300050511 Unclassified 531
290 nmdc:mga08y16_364236_c1 3300050511 Bacteria 1484
291 nmdc:mga08y16_882117_c1 3300050511 Unclassified 882
292 nmdc:mga0a205_805894_c1 3300050515 Bacteria 787
293 Ga0495601_0661605 3300053077 Bacteria 668
294 Ga0590071_111060 3300059421 Unclassified 696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028563 Ga0265319_1006204 Ga0265319_10062041 141
2 3300028577 Ga0265318_10021383 Ga0265318_100213833 141
3 3300031240 Ga0265320_10003300 Ga0265320_100033005 141
4 3300005328 Ga0070676_11052424 Ga0070676_110524241 143
5 3300005354 Ga0070675_100514827 Ga0070675_1005148271 143
6 3300005356 Ga0070674_101412756 Ga0070674_1014127561 143
7 3300009094 Ga0111539_13090680 Ga0111539_130906801 143
8 3300005290 Ga0065712_10480403 Ga0065712_104804031 144
9 3300005327 Ga0070658_11062302 Ga0070658_110623022 144
10 3300005330 Ga0070690_100191115 Ga0070690_1001911152 144
11 3300005331 Ga0070670_100639689 Ga0070670_1006396892 144
12 3300005334 Ga0068869_100289199 Ga0068869_1002891992 144
13 3300005340 Ga0070689_100444076 Ga0070689_1004440762 144
14 3300005341 Ga0070691_10073701 Ga0070691_100737013 144
15 3300005354 Ga0070675_100300512 Ga0070675_1003005122 144
16 3300005354 Ga0070675_101653775 Ga0070675_1016537751 144
17 3300005365 Ga0070688_100278815 Ga0070688_1002788151 144
18 3300005365 Ga0070688_100297235 Ga0070688_1002972352 144
19 3300005365 Ga0070688_100455485 Ga0070688_1004554852 144
20 3300005434 Ga0070709_11120423 Ga0070709_111204231 144
21 3300005439 Ga0070711_100001752 Ga0070711_10000175212 144
22 3300005441 Ga0070700_100220592 Ga0070700_1002205922 144
23 3300005444 Ga0070694_101535205 Ga0070694_1015352051 144
24 3300005444 Ga0070694_101886722 Ga0070694_1018867221 144
25 3300005458 Ga0070681_10243845 Ga0070681_102438452 144
26 3300005458 Ga0070681_10936806 Ga0070681_109368061 144
27 3300005459 Ga0068867_100150709 Ga0068867_1001507092 144
28 3300005459 Ga0068867_100618431 Ga0068867_1006184311 144
29 3300005466 Ga0070685_10036609 Ga0070685_100366093 144
30 3300005466 Ga0070685_10368714 Ga0070685_103687142 144
31 3300005471 Ga0070698_100419190 Ga0070698_1004191901 144
32 3300005535 Ga0070684_101384659 Ga0070684_1013846592 144
33 3300005544 Ga0070686_100060882 Ga0070686_1000608824 144
34 3300005544 Ga0070686_100182454 Ga0070686_1001824542 144
35 3300005544 Ga0070686_100197127 Ga0070686_1001971272 144
36 3300005544 Ga0070686_101023443 Ga0070686_1010234432 144
37 3300005545 Ga0070695_101374088 Ga0070695_1013740881 144
38 3300005548 Ga0070665_100055519 Ga0070665_1000555196 144
39 3300005563 Ga0068855_100017598 Ga0068855_1000175985 144
40 3300005563 Ga0068855_101061434 Ga0068855_1010614342 144
41 3300005563 Ga0068855_101766971 Ga0068855_1017669712 144
42 3300005577 Ga0068857_101046130 Ga0068857_1010461302 144
43 3300005577 Ga0068857_101047144 Ga0068857_1010471441 144
44 3300005577 Ga0068857_101261299 Ga0068857_1012612992 144
45 3300005614 Ga0068856_100000080 Ga0068856_10000008029 144
46 3300005614 Ga0068856_100127776 Ga0068856_1001277762 144
47 3300005614 Ga0068856_100457322 Ga0068856_1004573222 144
48 3300005616 Ga0068852_102356003 Ga0068852_1023560031 144
49 3300005617 Ga0068859_100061829 Ga0068859_1000618293 144
50 3300005617 Ga0068859_100246729 Ga0068859_1002467293 144
51 3300005617 Ga0068859_100505322 Ga0068859_1005053222 144
52 3300005617 Ga0068859_101872060 Ga0068859_1018720601 144
53 3300005618 Ga0068864_101030165 Ga0068864_1010301651 144
54 3300005618 Ga0068864_101288712 Ga0068864_1012887121 144
55 3300005618 Ga0068864_101716014 Ga0068864_1017160141 144
56 3300005618 Ga0068864_101802898 Ga0068864_1018028981 144
57 3300005718 Ga0068866_10895855 Ga0068866_108958552 144
58 3300005841 Ga0068863_100072633 Ga0068863_1000726334 144
59 3300005841 Ga0068863_100316995 Ga0068863_1003169953 144
60 3300005841 Ga0068863_100421231 Ga0068863_1004212312 144
61 3300005841 Ga0068863_100533050 Ga0068863_1005330502 144
62 3300005841 Ga0068863_100710910 Ga0068863_1007109101 144
63 3300006237 Ga0097621_101907829 Ga0097621_1019078292 144
64 3300006844 Ga0075428_100000468 Ga0075428_10000046829 144
65 3300006844 Ga0075428_100319655 Ga0075428_1003196553 144
66 3300006844 Ga0075428_101697157 Ga0075428_1016971571 144
67 3300006846 Ga0075430_100101133 Ga0075430_1001011331 144
68 3300006846 Ga0075430_100422043 Ga0075430_1004220432 144
69 3300006847 Ga0075431_100060540 Ga0075431_1000605404 144
70 3300006847 Ga0075431_100187787 Ga0075431_1001877871 144
71 3300006852 Ga0075433_10202087 Ga0075433_102020873 144
72 3300006852 Ga0075433_10664809 Ga0075433_106648092 144
73 3300006852 Ga0075433_11049865 Ga0075433_110498651 144
74 3300006871 Ga0075434_100580745 Ga0075434_1005807453 144
75 3300006931 Ga0097620_100061830 Ga0097620_1000618303 144
76 3300006931 Ga0097620_100246733 Ga0097620_1002467333 144
77 3300006931 Ga0097620_100505340 Ga0097620_1005053402 144
78 3300006931 Ga0097620_101872093 Ga0097620_1018720931 144
79 3300009094 Ga0111539_10002816 Ga0111539_1000281615 144
80 3300009094 Ga0111539_10575747 Ga0111539_105757472 144
81 3300009094 Ga0111539_11908886 Ga0111539_119088862 144
82 3300009094 Ga0111539_11944710 Ga0111539_119447101 144
83 3300009094 Ga0111539_13050529 Ga0111539_130505291 144
84 3300009098 Ga0105245_10871923 Ga0105245_108719232 144
85 3300009174 Ga0105241_10739032 Ga0105241_107390321 144
86 3300009176 Ga0105242_11495421 Ga0105242_114954212 144
87 3300009177 Ga0105248_10001477 Ga0105248_1000147716 144
88 3300009551 Ga0105238_10349014 Ga0105238_103490142 144
89 3300009551 Ga0105238_12378343 Ga0105238_123783431 144
90 3300010375 Ga0105239_13004964 Ga0105239_130049641 144
91 3300013296 Ga0157374_11090599 Ga0157374_110905992 144
92 3300013306 Ga0163162_10328924 Ga0163162_103289243 144
93 3300013306 Ga0163162_10401796 Ga0163162_104017963 144
94 3300013306 Ga0163162_10643847 Ga0163162_106438472 144
95 3300013306 Ga0163162_12458512 Ga0163162_124585121 144
96 3300013308 Ga0157375_10000016 Ga0157375_10000016166 144
97 3300013308 Ga0157375_10648008 Ga0157375_106480082 144
98 3300014325 Ga0163163_10000096 Ga0163163_1000009627 144
99 3300014325 Ga0163163_10230307 Ga0163163_102303072 144
100 3300014325 Ga0163163_10273891 Ga0163163_102738913 144
101 3300014325 Ga0163163_13002141 Ga0163163_130021411 144
102 3300014745 Ga0157377_10582609 Ga0157377_105826092 144
103 3300017792 Ga0163161_10857062 Ga0163161_108570621 144
104 3300025913 Ga0207695_10298767 Ga0207695_102987672 144
105 3300025916 Ga0207663_10001649 Ga0207663_100016492 144
106 3300025924 Ga0207694_10264285 Ga0207694_102642852 144
107 3300025924 Ga0207694_10487247 Ga0207694_104872472 144
108 3300025924 Ga0207694_10657940 Ga0207694_106579402 144
109 3300025924 Ga0207694_11520098 Ga0207694_115200981 144
110 3300025926 Ga0207659_10437574 Ga0207659_104375742 144
111 3300025926 Ga0207659_10793034 Ga0207659_107930341 144
112 3300025934 Ga0207686_10863471 Ga0207686_108634712 144
113 3300025936 Ga0207670_11039472 Ga0207670_110394722 144
114 3300025936 Ga0207670_11044061 Ga0207670_110440612 144
115 3300025939 Ga0207665_10489736 Ga0207665_104897362 144
116 3300025941 Ga0207711_10005461 Ga0207711_1000546116 144
117 3300025949 Ga0207667_10045269 Ga0207667_100452693 144
118 3300025949 Ga0207667_10669124 Ga0207667_106691242 144
119 3300025960 Ga0207651_11208421 Ga0207651_112084212 144
120 3300026023 Ga0207677_10162491 Ga0207677_101624913 144
121 3300026023 Ga0207677_10792503 Ga0207677_107925032 144
122 3300026078 Ga0207702_10001107 Ga0207702_100011072 144
123 3300026078 Ga0207702_10018433 Ga0207702_100184334 144
124 3300026088 Ga0207641_10042798 Ga0207641_100427982 144
125 3300026088 Ga0207641_10555463 Ga0207641_105554631 144
126 3300026089 Ga0207648_10392860 Ga0207648_103928602 144
127 3300026089 Ga0207648_12064397 Ga0207648_120643971 144
128 3300026095 Ga0207676_10941627 Ga0207676_109416271 144
129 3300026116 Ga0207674_10096595 Ga0207674_100965954 144
130 3300026121 Ga0207683_10085423 Ga0207683_100854233 144
131 3300027907 Ga0207428_10715928 Ga0207428_107159282 144
132 3300028380 Ga0268265_11265767 Ga0268265_112657672 144
133 3300028381 Ga0268264_10380295 Ga0268264_103802952 144
134 3300028556 Ga0265337_1005752 Ga0265337_10057523 144
135 3300028556 Ga0265337_1010638 Ga0265337_10106383 144
136 3300028556 Ga0265337_1014337 Ga0265337_10143374 144
137 3300028556 Ga0265337_1024597 Ga0265337_10245972 144
138 3300028556 Ga0265337_1040955 Ga0265337_10409552 144
139 3300028558 Ga0265326_10025410 Ga0265326_100254103 144
140 3300028563 Ga0265319_1018987 Ga0265319_10189872 144
141 3300028573 Ga0265334_10099247 Ga0265334_100992471 144
142 3300028577 Ga0265318_10025058 Ga0265318_100250583 144
143 3300028653 Ga0265323_10000140 Ga0265323_1000014023 144
144 3300028653 Ga0265323_10011578 Ga0265323_100115783 144
145 3300028654 Ga0265322_10069731 Ga0265322_100697311 144
146 3300028654 Ga0265322_10116748 Ga0265322_101167482 144
147 3300028666 Ga0265336_10000493 Ga0265336_100004938 144
148 3300028666 Ga0265336_10052757 Ga0265336_100527573 144
149 3300028800 Ga0265338_10000616 Ga0265338_1000061622 144
150 3300028800 Ga0265338_10001074 Ga0265338_1000107444 144
151 3300028800 Ga0265338_10001502 Ga0265338_1000150217 144
152 3300028800 Ga0265338_10001829 Ga0265338_1000182919 144
153 3300028800 Ga0265338_10006138 Ga0265338_1000613811 144
154 3300028800 Ga0265338_10011262 Ga0265338_100112622 144
155 3300028800 Ga0265338_10028836 Ga0265338_100288365 144
156 3300028800 Ga0265338_10030886 Ga0265338_100308868 144
157 3300028800 Ga0265338_10032913 Ga0265338_100329131 144
158 3300028800 Ga0265338_10075148 Ga0265338_100751482 144
159 3300028800 Ga0265338_10142119 Ga0265338_101421192 144
160 3300028800 Ga0265338_10349156 Ga0265338_103491561 144
161 3300028800 Ga0265338_10478992 Ga0265338_104789921 144
162 3300029957 Ga0265324_10000188 Ga0265324_1000018816 144
163 3300029957 Ga0265324_10010515 Ga0265324_100105152 144
164 3300029957 Ga0265324_10018332 Ga0265324_100183324 144
165 3300030762 Ga0265775_101901 Ga0265775_1019012 144
166 3300031238 Ga0265332_10102720 Ga0265332_101027203 144
167 3300031240 Ga0265320_10000551 Ga0265320_1000055120 144
168 3300031240 Ga0265320_10001912 Ga0265320_100019122 144
169 3300031240 Ga0265320_10075083 Ga0265320_100750833 144
170 3300031240 Ga0265320_10081405 Ga0265320_100814051 144
171 3300031240 Ga0265320_10256104 Ga0265320_102561042 144
172 3300031247 Ga0265340_10001551 Ga0265340_100015512 144
173 3300031247 Ga0265340_10014133 Ga0265340_100141335 144
174 3300031247 Ga0265340_10338889 Ga0265340_103388892 144
175 3300031249 Ga0265339_10006711 Ga0265339_1000671112 144
176 3300031249 Ga0265339_10037622 Ga0265339_100376222 144
177 3300031249 Ga0265339_10155029 Ga0265339_101550292 144
178 3300031250 Ga0265331_10035614 Ga0265331_100356142 144
179 3300031251 Ga0265327_10001590 Ga0265327_1000159014 144
180 3300031344 Ga0265316_10015764 Ga0265316_100157642 144
181 3300031344 Ga0265316_10023632 Ga0265316_100236325 144
182 3300031344 Ga0265316_10078327 Ga0265316_100783273 144
183 3300031344 Ga0265316_10164052 Ga0265316_101640523 144
184 3300031344 Ga0265316_11012059 Ga0265316_110120591 144
185 3300031711 Ga0265314_10028259 Ga0265314_100282593 144
186 3300031711 Ga0265314_10028902 Ga0265314_100289023 144
187 3300031712 Ga0265342_10088684 Ga0265342_100886842 144
188 3300031712 Ga0265342_10106430 Ga0265342_101064302 144
189 3300031712 Ga0265342_10288530 Ga0265342_102885301 144
190 3300031712 Ga0265342_10388475 Ga0265342_103884752 144
191 3300031727 Ga0316576_10090220 Ga0316576_100902202 144
192 3300031728 Ga0316578_10041644 Ga0316578_100416443 144
193 3300031733 Ga0316577_10073439 Ga0316577_100734393 144
194 3300031995 Ga0307409_100774457 Ga0307409_1007744571 144
195 3300032126 Ga0307415_100938442 Ga0307415_1009384422 144
196 3300035084 Ga0373928_0000207 Ga0373928_0000207_10389_10823 144
197 3300035088 Ga0373940_0023551 Ga0373940_0023551_731_1165 144
198 3300035089 Ga0373944_0004231 Ga0373944_0004231_454_888 144
199 3300035089 Ga0373944_0055295 Ga0373944_0055295_152_586 144
200 3300035090 Ga0373949_0019311 Ga0373949_0019311_510_944 144
201 3300035091 Ga0373951_0022062 Ga0373951_0022062_698_1132 144
202 3300035091 Ga0373951_0046063 Ga0373951_0046063_165_599 144
203 3300035112 Ga0373932_0000004 Ga0373932_0000004_268585_269019 144
204 3300035114 Ga0373939_0034980 Ga0373939_0034980_91_525 144
205 3300035170 Ga0373943_0539025 Ga0373943_0539025_234_668 144
206 3300035171 Ga0373946_0103434 Ga0373946_0103434_735_1169 144
207 3300035207 Ga0373942_0074698 Ga0373942_0074698_45_479 144
208 3300035242 Ga0373962_0000015 Ga0373962_0000015_36765_37199 144
209 3300035398 Ga0316574_0105872 Ga0316574_0105872_858_1292 144
210 3300035691 Ga0373931_0000036 Ga0373931_0000036_78431_78865 144
211 3300035691 Ga0373931_0564499 Ga0373931_0564499_46_480 144
212 3300035692 Ga0373935_0139808 Ga0373935_0139808_245_679 144
213 3300035695 Ga0373927_0214284 Ga0373927_0214284_677_1111 144
214 3300035695 Ga0373927_1063796 Ga0373927_1063796_35_469 144
215 3300036401 Ga0373937_0108904 Ga0373937_0108904_500_934 144
216 3300036401 Ga0373937_0355205 Ga0373937_0355205_833_1267 144
217 3300036712 Ga0316584_0498419 Ga0316584_0498419_268_702 144
218 3300037068 Ga0373925_0000522 Ga0373925_0000522_32834_33268 144
219 3300037418 Ga0395900_0105522 Ga0395900_0105522_539_973 144
220 3300037471 Ga0395905_0054252 Ga0395905_0054252_2579_3013 144
221 3300037853 Ga0436364_0120890 Ga0436364_0120890_34_468 144
222 3300039447 Ga0436361_1126292 Ga0436361_1126292_26_460 144
223 3300041505 Ga0451849_0248645 Ga0451849_0248645_197_631 144
224 3300042436 Ga0439435_0264848 Ga0439435_0264848_86_520 144
225 3300042876 Ga0451577_0032935 Ga0451577_0032935_1691_2125 144
226 3300042876 Ga0451577_0129060 Ga0451577_0129060_507_941 144
227 3300042876 Ga0451577_0487919 Ga0451577_0487919_16_450 144
228 3300042876 Ga0451577_1452568 Ga0451577_1452568_101_535 144
229 3300044712 Ga0453684_0000532 Ga0453684_0000532_90385_90819 144
230 3300044712 Ga0453684_0447349 Ga0453684_0447349_451_885 144
231 3300045051 Ga0451576_0053341 Ga0451576_0053341_3095_3529 144
232 3300045051 Ga0451576_0067046 Ga0451576_0067046_2253_2687 144
233 3300045051 Ga0451576_0106187 Ga0451576_0106187_1758_2285 144
234 3300045051 Ga0451576_0172178 Ga0451576_0172178_719_1153 144
235 3300045051 Ga0451576_0550221 Ga0451576_0550221_617_1051 144
236 3300045051 Ga0451576_0578542 Ga0451576_0578542_542_976 144
237 3300045051 Ga0451576_0702080 Ga0451576_0702080_531_965 144
238 3300046454 Ga0495592_0000080 Ga0495592_0000080_7171_7605 144
239 3300046476 Ga0495662_0005683 Ga0495662_0005683_4285_4719 144
240 3300046477 Ga0495664_0389488 Ga0495664_0389488_356_790 144
241 3300046499 Ga0495594_0403911 Ga0495594_0403911_151_585 144
242 3300046514 Ga0495618_0065751 Ga0495618_0065751_239_673 144
243 3300046516 Ga0495628_0000510 Ga0495628_0000510_18395_18829 144
244 3300046517 Ga0495630_0000022 Ga0495630_0000022_21881_22321 144
245 3300046517 Ga0495630_0190481 Ga0495630_0190481_583_1017 144
246 3300046517 Ga0495630_0340223 Ga0495630_0340223_448_882 144
247 3300046517 Ga0495630_0569343 Ga0495630_0569343_67_501 144
248 3300046517 Ga0495630_0574649 Ga0495630_0574649_249_683 144
249 3300046526 Ga0495666_0007144 Ga0495666_0007144_2204_2644 144
250 3300046529 Ga0495652_0146195 Ga0495652_0146195_947_1381 144
251 3300046533 Ga0495640_0044332 Ga0495640_0044332_2411_2845 144
252 3300046535 Ga0495586_0000222 Ga0495586_0000222_16206_16646 144
253 3300046535 Ga0495586_0000350 Ga0495586_0000350_21351_21785 144
254 3300046535 Ga0495586_0029349 Ga0495586_0029349_1932_2366 144
255 3300046535 Ga0495586_0141416 Ga0495586_0141416_393_827 144
256 3300046536 Ga0495587_0051551 Ga0495587_0051551_1043_1477 144
257 3300046543 Ga0495645_0008548 Ga0495645_0008548_6638_7072 144
258 3300046543 Ga0495645_0124085 Ga0495645_0124085_697_1131 144
259 3300046543 Ga0495645_0438272 Ga0495645_0438272_113_547 144
260 3300046559 Ga0495667_0448295 Ga0495667_0448295_343_777 144
261 3300046642 Ga0495634_0046952 Ga0495634_0046952_2452_2892 144
262 3300046678 Ga0495599_0010278 Ga0495599_0010278_1919_2353 144
263 3300046678 Ga0495599_0300448 Ga0495599_0300448_169_603 144
264 3300046678 Ga0495599_0716525 Ga0495599_0716525_118_552 144
265 3300046680 Ga0495646_0411162 Ga0495646_0411162_134_568 144
266 3300046681 Ga0495647_0192577 Ga0495647_0192577_441_881 144
267 3300046683 Ga0495658_0004634 Ga0495658_0004634_5518_5952 144
268 3300046683 Ga0495658_0365115 Ga0495658_0365115_194_634 144
269 3300046683 Ga0495658_1074265 Ga0495658_1074265_55_489 144
270 3300046689 Ga0495613_0225296 Ga0495613_0225296_471_947 144
271 3300046690 Ga0495624_0012647 Ga0495624_0012647_2194_2628 144
272 3300046690 Ga0495624_0505746 Ga0495624_0505746_189_629 144
273 3300047315 Ga0495581_0093223 Ga0495581_0093223_743_1177 144
274 3300047315 Ga0495581_0159848 Ga0495581_0159848_444_884 144
275 3300047319 Ga0495674_0000401 Ga0495674_0000401_31116_31556 144
276 3300047319 Ga0495674_0090628 Ga0495674_0090628_2045_2479 144
277 3300047319 Ga0495674_1056038 Ga0495674_1056038_95_529 144
278 3300047471 Ga0495684_0351796 Ga0495684_0351796_384_818 144
279 3300048909 Ga0496106_1160864 Ga0496106_1160864_93_527 144
280 3300049521 Ga0501298_079568 Ga0501298_079568_140_574 144
281 3300049581 Ga0501047_0439281 Ga0501047_0439281_50_484 144
282 3300049586 Ga0501070_0937851 Ga0501070_0937851_82_516 144
283 3300049822 Ga0501035_0022602 Ga0501035_0022602_274_708 144
284 3300050508 nmdc:mga09592_114705_c1 nmdc:mga09592_114705_c1_860_1294 144
285 3300050509 nmdc:mga0qj67_234532_c1 nmdc:mga0qj67_234532_c1_244_678 144
286 3300050510 nmdc:mga06r32_141428_c1 nmdc:mga06r32_141428_c1_1115_1549 144
287 3300050510 nmdc:mga06r32_152851_c1 nmdc:mga06r32_152851_c1_1198_1632 144
288 3300050511 nmdc:mga08y16_13869_c1 nmdc:mga08y16_13869_c1_6154_6588 144
289 3300050511 nmdc:mga08y16_1985947_c1 nmdc:mga08y16_1985947_c1_75_509 144
290 3300050511 nmdc:mga08y16_364236_c1 nmdc:mga08y16_364236_c1_98_532 144
291 3300050511 nmdc:mga08y16_882117_c1 nmdc:mga08y16_882117_c1_172_606 144
292 3300050515 nmdc:mga0a205_805894_c1 nmdc:mga0a205_805894_c1_43_477 144
293 3300053077 Ga0495601_0661605 Ga0495601_0661605_204_638 144
294 3300059421 Ga0590071_111060 Ga0590071_111060_217_651 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

47

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_N 39s large subunit of the porcine mitochondrial ribosome 0.9511 13 144
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9438 12 143
7nql-assembly1.cif.gz_BN 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.9397 12 144
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9388 3 140
7a5h-assembly1.cif.gz_K structure of the split human mitoribosomal large subunit with rescue factors mtrf-r and mtres1 0.9372 12 144
ID Description Score Start End Superfamily
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.968 13 144 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9676 13 144 3.90.1180.10
af_Q95QL2_7_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9444 13 144 3.90.1180.10
af_Q5XFW4_1_178_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9436 13 144 3.90.1180.10
af_Q9VJ38_1_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9427 13 144 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A836QTA4-F1-model_v4 Large ribosomal subunit protein uL13 0.9794 12 140 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904
AF-A0A7E4S108-F1-model_v4 deleted 0.9793 12 140
AF-A0A4P5XTX5-F1-model_v4 deleted 0.977 14 140
AF-A0A1F6LAI9-F1-model_v4 Large ribosomal subunit protein uL13 0.9768 13 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A847F5J7-F1-model_v4 Large ribosomal subunit protein uL13 0.9765 13 141 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.31 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map