F392052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 176 | 283 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10258247|Ga0105241_102582471 |
| Length | 288 |
| Sequence | LRRGDSNDRARAAFGCGAEVHRRATALIAEDEPLLAQALRAELASAWAQLEVLATVGDGASAVTQALALRPDVLFFDIRMPGQSGLEAAAELADEWPHDQPFPALVFVTAYDQYAVQAFETQAVDYVLKPVQPARLRKTVAKVQDALAKRTQGASDIEATLGQLRNLLGQVAEPAPGTAQGPLKMLQVSVGTSIRMVPVEDVVYFEAADKYVRVLTAGHEYLIRTPLKELLPQLDAQRFWQVHRGTVVRADAIDSVTRDEAGKLHLVLRGRAEKLAVSRLYAHLFKAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 2 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 3 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 4 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 5 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 6 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 7 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 8 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 9 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 10 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 11 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 49 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 74 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 75 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 77 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 78 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 79 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 82 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 83 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 84 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 89 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 90 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 91 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 92 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 93 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 94 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 95 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 96 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 97 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 98 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 99 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 100 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 102 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 106 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 167 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 174 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0 |
| Isolates | 3.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.16 |
| Nodule | 1.7 |
| Rhizoplane | 1.7 |
| Rhizosphere | 80.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055524_1000167 | 3300003775 | Bacteria | 75234 |
| 2 | Ga0055530_10005234 | 3300003791 | Bacteria | 6267 |
| 3 | Ga0055530_10046531 | 3300003791 | Bacteria | 1029 |
| 4 | Ga0055540_1000014 | 3300003792 | Bacteria | 234171 |
| 5 | Ga0055531_10000680 | 3300003794 | Bacteria | 29030 |
| 6 | Ga0055531_10008397 | 3300003794 | Bacteria | 5456 |
| 7 | Ga0065165_1001101 | 3300005262 | Bacteria | 32096 |
| 8 | Ga0070680_100074317 | 3300005336 | Bacteria | 2797 |
| 9 | Ga0070680_100081050 | 3300005336 | Bacteria | 2677 |
| 10 | Ga0068868_100005025 | 3300005338 | Bacteria | 9289 |
| 11 | Ga0070692_10000899 | 3300005345 | Bacteria | 10074 |
| 12 | Ga0070667_100230800 | 3300005367 | Bacteria | 1650 |
| 13 | Ga0070678_100025052 | 3300005456 | Bacteria | 4006 |
| 14 | Ga0070662_100008945 | 3300005457 | Bacteria | 6528 |
| 15 | Ga0070681_10024294 | 3300005458 | Bacteria | 6101 |
| 16 | Ga0070679_100011916 | 3300005530 | Bacteria | 8298 |
| 17 | Ga0070679_100404720 | 3300005530 | Bacteria | 1310 |
| 18 | Ga0068853_100487891 | 3300005539 | Bacteria | 1162 |
| 19 | Ga0068855_100055029 | 3300005563 | Bacteria | 4674 |
| 20 | Ga0068855_100099052 | 3300005563 | Bacteria | 3358 |
| 21 | Ga0068855_100272859 | 3300005563 | Bacteria | 1880 |
| 22 | Ga0068854_100011664 | 3300005578 | Bacteria | 5732 |
| 23 | Ga0068856_100354185 | 3300005614 | Bacteria | 1486 |
| 24 | Ga0068852_100292464 | 3300005616 | Bacteria | 1574 |
| 25 | Ga0068863_100251603 | 3300005841 | Bacteria | 1707 |
| 26 | Ga0075365_10006848 | 3300006038 | Bacteria | 6321 |
| 27 | Ga0075365_10086185 | 3300006038 | Bacteria | 2134 |
| 28 | Ga0075362_10003218 | 3300006177 | Bacteria | 5659 |
| 29 | Ga0075367_10003292 | 3300006178 | Bacteria | 7661 |
| 30 | Ga0075370_10093180 | 3300006353 | Bacteria | 1739 |
| 31 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 32 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 33 | Ga0105250_10001577 | 3300009092 | Bacteria | 12251 |
| 34 | Ga0105240_10013081 | 3300009093 | Bacteria | 11422 |
| 35 | Ga0105240_10238515 | 3300009093 | Bacteria | 2109 |
| 36 | Ga0105240_10345020 | 3300009093 | Bacteria | 1691 |
| 37 | Ga0105243_10007802 | 3300009148 | Bacteria | 8229 |
| 38 | Ga0105241_10258247 | 3300009174 | Bacteria | 1480 |
| 39 | Ga0105237_10002223 | 3300009545 | Bacteria | 24276 |
| 40 | Ga0105238_10164074 | 3300009551 | Bacteria | 2197 |
| 41 | Ga0105238_10213730 | 3300009551 | Bacteria | 1905 |
| 42 | Ga0105239_10000470 | 3300010375 | Bacteria | 59011 |
| 43 | Ga0157370_10004980 | 3300013104 | Bacteria | 15033 |
| 44 | Ga0157378_10098921 | 3300013297 | Bacteria | 2661 |
| 45 | Ga0163163_10018794 | 3300014325 | Bacteria | 6479 |
| 46 | Ga0157376_10001128 | 3300014969 | Bacteria | 17513 |
| 47 | Ga0182007_10017465 | 3300015262 | Bacteria | 2620 |
| 48 | Ga0213872_10000008 | 3300021361 | Bacteria | 226283 |
| 49 | Ga0209675_1007750 | 3300025291 | Bacteria | 4053 |
| 50 | Ga0209050_1001450 | 3300025298 | Bacteria | 25477 |
| 51 | Ga0209050_1009152 | 3300025298 | Bacteria | 5128 |
| 52 | Ga0209256_1000356 | 3300025299 | Bacteria | 74710 |
| 53 | Ga0209051_1000035 | 3300025303 | Bacteria | 346999 |
| 54 | Ga0209051_1000346 | 3300025303 | Bacteria | 69226 |
| 55 | Ga0209257_1000212 | 3300025304 | Bacteria | 138478 |
| 56 | Ga0209257_1000396 | 3300025304 | Bacteria | 86000 |
| 57 | Ga0207684_10062095 | 3300025910 | Bacteria | 3173 |
| 58 | Ga0207654_10126411 | 3300025911 | Bacteria | 1612 |
| 59 | Ga0207707_10001618 | 3300025912 | Bacteria | 20756 |
| 60 | Ga0207695_10013685 | 3300025913 | Bacteria | 9657 |
| 61 | Ga0207671_10002553 | 3300025914 | Bacteria | 19340 |
| 62 | Ga0207660_10055261 | 3300025917 | Bacteria | 2836 |
| 63 | Ga0207649_10177735 | 3300025920 | Bacteria | 1488 |
| 64 | Ga0207652_10160831 | 3300025921 | Bacteria | 2013 |
| 65 | Ga0207694_10067457 | 3300025924 | Bacteria | 2792 |
| 66 | Ga0207694_10286375 | 3300025924 | Bacteria | 1354 |
| 67 | Ga0207706_10000638 | 3300025933 | Bacteria | 37216 |
| 68 | Ga0207709_10000032 | 3300025935 | Bacteria | 324478 |
| 69 | Ga0207689_10378874 | 3300025942 | Bacteria | 1178 |
| 70 | Ga0207661_10106409 | 3300025944 | Bacteria | 2365 |
| 71 | Ga0207667_10181503 | 3300025949 | Bacteria | 2161 |
| 72 | Ga0207640_10014490 | 3300025981 | Bacteria | 4541 |
| 73 | Ga0207677_10002674 | 3300026023 | Bacteria | 9390 |
| 74 | Ga0207677_10015061 | 3300026023 | Bacteria | 4535 |
| 75 | Ga0207639_10428698 | 3300026041 | Bacteria | 1197 |
| 76 | Ga0207702_10151551 | 3300026078 | Bacteria | 2109 |
| 77 | Ga0207641_10554167 | 3300026088 | Bacteria | 1121 |
| 78 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 79 | Ga0209281_1000182 | 3300027111 | Bacteria | 145698 |
| 80 | Ga0307515_10022377 | 3300028794 | Bacteria | 11141 |
| 81 | Ga0307515_10051947 | 3300028794 | Bacteria | 6095 |
| 82 | Ga0307515_10053672 | 3300028794 | Bacteria | 5939 |
| 83 | Ga0265316_10062038 | 3300031344 | Bacteria | 2902 |
| 84 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 85 | Ga0307513_10012951 | 3300031456 | Bacteria | 10255 |
| 86 | Ga0307509_10034145 | 3300031507 | Bacteria | 5590 |
| 87 | Ga0307514_10001372 | 3300031649 | Bacteria | 30729 |
| 88 | Ga0307514_10047056 | 3300031649 | Bacteria | 3369 |
| 89 | Ga0265314_10003235 | 3300031711 | Bacteria | 15924 |
| 90 | Ga0265314_10058294 | 3300031711 | Bacteria | 2647 |
| 91 | Ga0265342_10181884 | 3300031712 | Bacteria | 1151 |
| 92 | Ga0307516_10002245 | 3300031730 | Bacteria | 26096 |
| 93 | Ga0307516_10039030 | 3300031730 | Bacteria | 4734 |
| 94 | Ga0307507_10047881 | 3300033179 | Bacteria | 4168 |
| 95 | Ga0373928_0039949 | 3300035084 | Bacteria | 1074 |
| 96 | Ga0373932_0005627 | 3300035112 | Bacteria | 2947 |
| 97 | Ga0373931_0015586 | 3300035691 | Bacteria | 3731 |
| 98 | Ga0395899_0174805 | 3300037312 | Bacteria | 1511 |
| 99 | Ga0395900_0026816 | 3300037418 | Bacteria | 5896 |
| 100 | Ga0395900_0144255 | 3300037418 | Bacteria | 2436 |
| 101 | Ga0395900_0186570 | 3300037418 | Bacteria | 2105 |
| 102 | Ga0395900_0459591 | 3300037418 | Bacteria | 1228 |
| 103 | Ga0395905_0000125 | 3300037471 | Bacteria | 126341 |
| 104 | Ga0395905_0000416 | 3300037471 | Bacteria | 59735 |
| 105 | Ga0395905_0010269 | 3300037471 | Bacteria | 9117 |
| 106 | Ga0395905_0060780 | 3300037471 | Bacteria | 3533 |
| 107 | Ga0395905_0065322 | 3300037471 | Bacteria | 3406 |
| 108 | Ga0395905_0065437 | 3300037471 | Bacteria | 3403 |
| 109 | Ga0395905_0118253 | 3300037471 | Bacteria | 2491 |
| 110 | Ga0395901_0044264 | 3300038443 | Bacteria | 4617 |
| 111 | Ga0395901_0068189 | 3300038443 | Bacteria | 3706 |
| 112 | Ga0395901_0430812 | 3300038443 | Bacteria | 1351 |
| 113 | Ga0436361_0071320 | 3300039447 | Bacteria | 6752 |
| 114 | Ga0436361_1054342 | 3300039447 | Bacteria | 9826 |
| 115 | Ga0450919_005397 | 3300042121 | Bacteria | 1536 |
| 116 | Ga0450898_037990 | 3300042134 | Bacteria | 903 |
| 117 | Ga0450918_005571 | 3300042531 | Bacteria | 2258 |
| 118 | Ga0451577_0110323 | 3300042876 | Bacteria | 2461 |
| 119 | Ga0451577_0308991 | 3300042876 | Bacteria | 1433 |
| 120 | Ga0466969_0002120 | 3300044656 | Bacteria | 10582 |
| 121 | Ga0466972_0002127 | 3300044658 | Bacteria | 9728 |
| 122 | Ga0466972_0007487 | 3300044658 | Bacteria | 5485 |
| 123 | Ga0466989_0157495 | 3300044663 | Bacteria | 1365 |
| 124 | Ga0466966_0035950 | 3300044684 | Bacteria | 3199 |
| 125 | Ga0466961_0002983 | 3300044693 | Bacteria | 10508 |
| 126 | Ga0466961_0086024 | 3300044693 | Bacteria | 1987 |
| 127 | Ga0466963_0180833 | 3300044694 | Bacteria | 1472 |
| 128 | Ga0453684_0272627 | 3300044712 | Bacteria | 1933 |
| 129 | Ga0466971_0089423 | 3300044719 | Bacteria | 1409 |
| 130 | Ga0466960_0211310 | 3300044901 | Bacteria | 1064 |
| 131 | Ga0466959_0003210 | 3300045049 | Bacteria | 10632 |
| 132 | Ga0466959_0023228 | 3300045049 | Bacteria | 4588 |
| 133 | Ga0466959_0038309 | 3300045049 | Bacteria | 3542 |
| 134 | Ga0451576_0427439 | 3300045051 | Bacteria | 1390 |
| 135 | Ga0466958_0176400 | 3300045836 | Bacteria | 1355 |
| 136 | Ga0466967_0537273 | 3300045976 | Bacteria | 1150 |
| 137 | Ga0495617_000009 | 3300046452 | Bacteria | 312936 |
| 138 | Ga0495627_000119 | 3300046453 | Bacteria | 99048 |
| 139 | Ga0495590_0000008 | 3300046457 | Bacteria | 330520 |
| 140 | Ga0495591_000043 | 3300046458 | Bacteria | 148885 |
| 141 | Ga0495591_007411 | 3300046458 | Bacteria | 4669 |
| 142 | Ga0495650_0000322 | 3300046471 | Bacteria | 85802 |
| 143 | Ga0495650_0014985 | 3300046471 | Bacteria | 4000 |
| 144 | Ga0495582_0009097 | 3300046473 | Bacteria | 5478 |
| 145 | Ga0495605_0000024 | 3300046474 | Bacteria | 236016 |
| 146 | Ga0495605_0002967 | 3300046474 | Bacteria | 10272 |
| 147 | Ga0495605_0005221 | 3300046474 | Bacteria | 7574 |
| 148 | Ga0495605_0061035 | 3300046474 | Bacteria | 1805 |
| 149 | Ga0495584_0000025 | 3300046491 | Bacteria | 116731 |
| 150 | Ga0495584_0016042 | 3300046491 | Bacteria | 3822 |
| 151 | Ga0495584_0020946 | 3300046491 | Bacteria | 3319 |
| 152 | Ga0495585_0002372 | 3300046492 | Bacteria | 13521 |
| 153 | Ga0495585_0009095 | 3300046492 | Bacteria | 5982 |
| 154 | Ga0495585_0062652 | 3300046492 | Bacteria | 2042 |
| 155 | Ga0495585_0066840 | 3300046492 | Bacteria | 1967 |
| 156 | Ga0495585_0153489 | 3300046492 | Bacteria | 1199 |
| 157 | Ga0495594_0130866 | 3300046499 | Bacteria | 1421 |
| 158 | Ga0495596_0001710 | 3300046500 | Bacteria | 12345 |
| 159 | Ga0495596_0003383 | 3300046500 | Bacteria | 8103 |
| 160 | Ga0495596_0018322 | 3300046500 | Bacteria | 2886 |
| 161 | Ga0495596_0018372 | 3300046500 | Bacteria | 2882 |
| 162 | Ga0495596_0026321 | 3300046500 | Bacteria | 2345 |
| 163 | Ga0495596_0058902 | 3300046500 | Bacteria | 1497 |
| 164 | Ga0495607_0004723 | 3300046501 | Bacteria | 9964 |
| 165 | Ga0495607_0009729 | 3300046501 | Bacteria | 6489 |
| 166 | Ga0495607_0033015 | 3300046501 | Bacteria | 3152 |
| 167 | Ga0495607_0048889 | 3300046501 | Bacteria | 2470 |
| 168 | Ga0495583_0000512 | 3300046506 | Bacteria | 55428 |
| 169 | Ga0495583_0005751 | 3300046506 | Bacteria | 8302 |
| 170 | Ga0495583_0039459 | 3300046506 | Bacteria | 2224 |
| 171 | Ga0495606_0007381 | 3300046507 | Bacteria | 9862 |
| 172 | Ga0495606_0099741 | 3300046507 | Bacteria | 1770 |
| 173 | Ga0495610_0002865 | 3300046512 | Bacteria | 14003 |
| 174 | Ga0495616_0004298 | 3300046513 | Bacteria | 8997 |
| 175 | Ga0495616_0020104 | 3300046513 | Bacteria | 3637 |
| 176 | Ga0495616_0123254 | 3300046513 | Bacteria | 1194 |
| 177 | Ga0495630_0066319 | 3300046517 | Bacteria | 2713 |
| 178 | Ga0495631_0005117 | 3300046518 | Bacteria | 6910 |
| 179 | Ga0495631_0015919 | 3300046518 | Bacteria | 3593 |
| 180 | Ga0495631_0067091 | 3300046518 | Bacteria | 1552 |
| 181 | Ga0495631_0165991 | 3300046518 | Bacteria | 947 |
| 182 | Ga0495632_0000012 | 3300046519 | Bacteria | 264389 |
| 183 | Ga0495632_0010024 | 3300046519 | Bacteria | 5648 |
| 184 | Ga0495637_0000009 | 3300046520 | Bacteria | 402028 |
| 185 | Ga0495637_0008124 | 3300046520 | Bacteria | 5166 |
| 186 | Ga0495643_0030613 | 3300046522 | Bacteria | 3003 |
| 187 | Ga0495644_0001939 | 3300046523 | Bacteria | 8314 |
| 188 | Ga0495644_0016228 | 3300046523 | Bacteria | 2851 |
| 189 | Ga0495644_0017701 | 3300046523 | Bacteria | 2722 |
| 190 | Ga0495644_0017850 | 3300046523 | Bacteria | 2710 |
| 191 | Ga0495644_0020150 | 3300046523 | Bacteria | 2545 |
| 192 | Ga0495648_0000475 | 3300046524 | Bacteria | 43147 |
| 193 | Ga0495648_0021701 | 3300046524 | Bacteria | 4443 |
| 194 | Ga0495663_0036439 | 3300046525 | Bacteria | 1481 |
| 195 | Ga0495642_0000638 | 3300046528 | Bacteria | 17549 |
| 196 | Ga0495642_0005527 | 3300046528 | Bacteria | 4857 |
| 197 | Ga0495642_0084867 | 3300046528 | Bacteria | 1336 |
| 198 | Ga0495654_0018266 | 3300046530 | Bacteria | 3678 |
| 199 | Ga0495609_0001454 | 3300046538 | Bacteria | 15717 |
| 200 | Ga0495609_0003889 | 3300046538 | Bacteria | 8380 |
| 201 | Ga0495609_0007567 | 3300046538 | Bacteria | 5400 |
| 202 | Ga0495597_0000071 | 3300046542 | Bacteria | 88148 |
| 203 | Ga0495597_0000960 | 3300046542 | Bacteria | 22269 |
| 204 | Ga0495633_0001467 | 3300046558 | Bacteria | 18303 |
| 205 | Ga0495633_0014392 | 3300046558 | Bacteria | 4139 |
| 206 | Ga0495656_0234516 | 3300046615 | Bacteria | 922 |
| 207 | Ga0495668_0000107 | 3300046616 | Bacteria | 132624 |
| 208 | Ga0495668_0000306 | 3300046616 | Bacteria | 67742 |
| 209 | Ga0495668_0009617 | 3300046616 | Bacteria | 5916 |
| 210 | Ga0495668_0047834 | 3300046616 | Bacteria | 2374 |
| 211 | Ga0495611_0000361 | 3300046648 | Bacteria | 29629 |
| 212 | Ga0495611_0002796 | 3300046648 | Bacteria | 7806 |
| 213 | Ga0495611_0038893 | 3300046648 | Bacteria | 2117 |
| 214 | Ga0495611_0070483 | 3300046648 | Bacteria | 1597 |
| 215 | Ga0495625_0055916 | 3300046660 | Bacteria | 2812 |
| 216 | Ga0495661_0004301 | 3300046665 | Bacteria | 10331 |
| 217 | Ga0495661_0023371 | 3300046665 | Bacteria | 4013 |
| 218 | Ga0495661_0035369 | 3300046665 | Bacteria | 3134 |
| 219 | Ga0495661_0127028 | 3300046665 | Bacteria | 1402 |
| 220 | Ga0495588_0087269 | 3300046674 | Bacteria | 1632 |
| 221 | Ga0495669_0000035 | 3300046684 | Bacteria | 96159 |
| 222 | Ga0495669_0005372 | 3300046684 | Bacteria | 5341 |
| 223 | Ga0495669_0006301 | 3300046684 | Bacteria | 4953 |
| 224 | Ga0495669_0012133 | 3300046684 | Bacteria | 3664 |
| 225 | Ga0495669_0047989 | 3300046684 | Bacteria | 1909 |
| 226 | Ga0495669_0215958 | 3300046684 | Bacteria | 919 |
| 227 | Ga0495624_0013366 | 3300046690 | Bacteria | 5599 |
| 228 | Ga0495670_0160886 | 3300046691 | Bacteria | 1179 |
| 229 | Ga0495671_0000176 | 3300046692 | Bacteria | 56722 |
| 230 | Ga0495649_0000028 | 3300046694 | Bacteria | 163229 |
| 231 | Ga0495649_0043912 | 3300046694 | Bacteria | 2439 |
| 232 | Ga0495589_0000077 | 3300046794 | Bacteria | 90550 |
| 233 | Ga0495589_0007913 | 3300046794 | Bacteria | 5567 |
| 234 | Ga0495589_0011774 | 3300046794 | Bacteria | 4538 |
| 235 | Ga0495589_0020337 | 3300046794 | Bacteria | 3395 |
| 236 | Ga0495660_0005230 | 3300046810 | Bacteria | 7784 |
| 237 | Ga0495636_0014897 | 3300047318 | Bacteria | 3095 |
| 238 | Ga0495672_0000055 | 3300047320 | Bacteria | 229428 |
| 239 | Ga0495672_0000109 | 3300047320 | Bacteria | 131335 |
| 240 | Ga0495672_0014240 | 3300047320 | Bacteria | 5457 |
| 241 | Ga0495676_0046932 | 3300047321 | Bacteria | 3500 |
| 242 | Ga0495683_0000047 | 3300047323 | Bacteria | 126770 |
| 243 | Ga0495683_0014684 | 3300047323 | Bacteria | 4079 |
| 244 | Ga0495683_0020279 | 3300047323 | Bacteria | 3430 |
| 245 | Ga0495683_0140795 | 3300047323 | Bacteria | 1130 |
| 246 | Ga0495677_0000234 | 3300047445 | Bacteria | 25123 |
| 247 | Ga0495677_0010453 | 3300047445 | Bacteria | 3408 |
| 248 | Ga0495679_009243 | 3300047446 | Bacteria | 3957 |
| 249 | Ga0495679_016405 | 3300047446 | Bacteria | 2680 |
| 250 | Ga0495685_001349 | 3300047447 | Bacteria | 7506 |
| 251 | Ga0495685_017223 | 3300047447 | Bacteria | 2474 |
| 252 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 253 | Ga0495686_0002161 | 3300047472 | Bacteria | 19178 |
| 254 | Ga0495686_0020048 | 3300047472 | Bacteria | 4461 |
| 255 | Ga0495686_0054780 | 3300047472 | Bacteria | 2496 |
| 256 | Ga0495593_0087990 | 3300047673 | Bacteria | 1601 |
| 257 | Ga0495614_0005989 | 3300048089 | Bacteria | 5475 |
| 258 | Ga0495614_0035203 | 3300048089 | Bacteria | 2152 |
| 259 | Ga0495626_0000017 | 3300048091 | Bacteria | 231648 |
| 260 | Ga0495626_0004437 | 3300048091 | Bacteria | 8613 |
| 261 | Ga0495626_0012278 | 3300048091 | Bacteria | 4497 |
| 262 | Ga0495626_0012813 | 3300048091 | Bacteria | 4377 |
| 263 | Ga0495626_0014831 | 3300048091 | Bacteria | 4006 |
| 264 | Ga0495626_0021663 | 3300048091 | Bacteria | 3185 |
| 265 | Ga0496100_0023653 | 3300048903 | Bacteria | 3736 |
| 266 | Ga0496102_0000158 | 3300048905 | Bacteria | 91822 |
| 267 | Ga0496106_0178183 | 3300048909 | Bacteria | 1687 |
| 268 | Ga0496110_0000001 | 3300048913 | Bacteria | 232652 |
| 269 | Ga0496110_0173537 | 3300048913 | Bacteria | 1956 |
| 270 | Ga0496121_0005276 | 3300048924 | Bacteria | 16661 |
| 271 | Ga0496121_0161683 | 3300048924 | Bacteria | 1637 |
| 272 | Ga0496124_0000125 | 3300048927 | Bacteria | 159942 |
| 273 | Ga0495678_000025 | 3300049459 | Bacteria | 227891 |
| 274 | Ga0495678_009724 | 3300049459 | Bacteria | 4725 |
| 275 | Ga0495682_0003585 | 3300049460 | Bacteria | 6856 |
| 276 | Ga0501034_0475351 | 3300049571 | Bacteria | 1165 |
| 277 | Ga0501037_0059411 | 3300049573 | Bacteria | 2789 |
| 278 | Ga0501047_0458849 | 3300049581 | Bacteria | 1103 |
| 279 | Ga0501249_022288 | 3300049679 | Bacteria | 1386 |
| 280 | nmdc:mga0yw44_125873_c1 | 3300050492 | Bacteria | 1655 |
| 281 | nmdc:mga0yw44_2817_c1 | 3300050492 | Bacteria | 7545 |
| 282 | nmdc:mga06z11_56515_c1 | 3300050494 | Bacteria | 2030 |
| 283 | nmdc:mga07m45_100712_c1 | 3300050496 | Bacteria | 1659 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2857564685 | 2857569911 | 219 |
| 2 | iso_pu_bacteria | 2721755523 | 2722885039 | 220 |
| 3 | 3300042121 | Ga0450919_005397 | Ga0450919_005397_484_1224 | 224 |
| 4 | 3300042531 | Ga0450918_005571 | Ga0450918_005571_148_849 | 224 |
| 5 | 3300044901 | Ga0466960_0211310 | Ga0466960_0211310_319_1041 | 225 |
| 6 | 3300046474 | Ga0495605_0005221 | Ga0495605_0005221_1969_2775 | 233 |
| 7 | 3300046538 | Ga0495609_0003889 | Ga0495609_0003889_5701_6507 | 233 |
| 8 | 3300046794 | Ga0495589_0011774 | Ga0495589_0011774_553_1359 | 233 |
| 9 | 3300047323 | Ga0495683_0020279 | Ga0495683_0020279_2510_3316 | 233 |
| 10 | 3300031456 | Ga0307513_10012951 | Ga0307513_100129514 | 234 |
| 11 | 3300045976 | Ga0466967_0537273 | Ga0466967_0537273_32_844 | 234 |
| 12 | 3300046492 | Ga0495585_0002372 | Ga0495585_0002372_9108_9914 | 234 |
| 13 | 3300046523 | Ga0495644_0020150 | Ga0495644_0020150_1538_2344 | 234 |
| 14 | iso_pu_bacteria | 2928531327 | 2928531371 | 236 |
| 15 | 3300042876 | Ga0451577_0308991 | Ga0451577_0308991_130_897 | 237 |
| 16 | 3300044712 | Ga0453684_0272627 | Ga0453684_0272627_73_840 | 237 |
| 17 | 3300048909 | Ga0496106_0178183 | Ga0496106_0178183_545_1291 | 237 |
| 18 | 3300005616 | Ga0068852_100292464 | Ga0068852_1002924642 | 238 |
| 19 | 3300037312 | Ga0395899_0174805 | Ga0395899_0174805_17_760 | 238 |
| 20 | 3300046499 | Ga0495594_0130866 | Ga0495594_0130866_231_1034 | 238 |
| 21 | 3300046500 | Ga0495596_0058902 | Ga0495596_0058902_645_1448 | 238 |
| 22 | 3300048091 | Ga0495626_0012278 | Ga0495626_0012278_1805_2608 | 238 |
| 23 | 3300005336 | Ga0070680_100074317 | Ga0070680_1000743172 | 239 |
| 24 | 3300005345 | Ga0070692_10000899 | Ga0070692_100008994 | 239 |
| 25 | 3300005458 | Ga0070681_10024294 | Ga0070681_100242944 | 239 |
| 26 | 3300005530 | Ga0070679_100011916 | Ga0070679_1000119168 | 239 |
| 27 | 3300005563 | Ga0068855_100099052 | Ga0068855_1000990523 | 239 |
| 28 | 3300005578 | Ga0068854_100011664 | Ga0068854_1000116642 | 239 |
| 29 | 3300005614 | Ga0068856_100354185 | Ga0068856_1003541852 | 239 |
| 30 | 3300013104 | Ga0157370_10004980 | Ga0157370_100049807 | 239 |
| 31 | 3300015262 | Ga0182007_10017465 | Ga0182007_100174653 | 239 |
| 32 | 3300025912 | Ga0207707_10001618 | Ga0207707_1000161817 | 239 |
| 33 | 3300025917 | Ga0207660_10055261 | Ga0207660_100552611 | 239 |
| 34 | 3300025920 | Ga0207649_10177735 | Ga0207649_101777352 | 239 |
| 35 | 3300025944 | Ga0207661_10106409 | Ga0207661_101064093 | 239 |
| 36 | 3300025981 | Ga0207640_10014490 | Ga0207640_100144902 | 239 |
| 37 | 3300026078 | Ga0207702_10151551 | Ga0207702_101515512 | 239 |
| 38 | 3300044656 | Ga0466969_0002120 | Ga0466969_0002120_383_1135 | 239 |
| 39 | 3300044663 | Ga0466989_0157495 | Ga0466989_0157495_291_1043 | 239 |
| 40 | 3300044684 | Ga0466966_0035950 | Ga0466966_0035950_2390_3142 | 239 |
| 41 | 3300044693 | Ga0466961_0002983 | Ga0466961_0002983_464_1216 | 239 |
| 42 | 3300044694 | Ga0466963_0180833 | Ga0466963_0180833_293_1045 | 239 |
| 43 | 3300044719 | Ga0466971_0089423 | Ga0466971_0089423_458_1210 | 239 |
| 44 | 3300045049 | Ga0466959_0003210 | Ga0466959_0003210_9410_10162 | 239 |
| 45 | 3300045836 | Ga0466958_0176400 | Ga0466958_0176400_190_942 | 239 |
| 46 | 3300048091 | Ga0495626_0000017 | Ga0495626_0000017_80311_81165 | 239 |
| 47 | 3300005457 | Ga0070662_100008945 | Ga0070662_1000089453 | 242 |
| 48 | 3300025933 | Ga0207706_10000638 | Ga0207706_100006384 | 242 |
| 49 | 3300046648 | Ga0495611_0002796 | Ga0495611_0002796_874_1677 | 242 |
| 50 | 3300046665 | Ga0495661_0127028 | Ga0495661_0127028_213_1016 | 242 |
| 51 | 3300046684 | Ga0495669_0006301 | Ga0495669_0006301_848_1651 | 242 |
| 52 | 3300046538 | Ga0495609_0001454 | Ga0495609_0001454_14003_14827 | 243 |
| 53 | 3300037418 | Ga0395900_0459591 | Ga0395900_0459591_48_863 | 244 |
| 54 | 3300046458 | Ga0495591_007411 | Ga0495591_007411_3276_4082 | 244 |
| 55 | 3300046474 | Ga0495605_0002967 | Ga0495605_0002967_5447_6253 | 244 |
| 56 | 3300046491 | Ga0495584_0020946 | Ga0495584_0020946_1994_2800 | 244 |
| 57 | 3300046492 | Ga0495585_0009095 | Ga0495585_0009095_3357_4163 | 244 |
| 58 | 3300046500 | Ga0495596_0018372 | Ga0495596_0018372_1493_2299 | 244 |
| 59 | 3300046501 | Ga0495607_0004723 | Ga0495607_0004723_4219_5025 | 244 |
| 60 | 3300046506 | Ga0495583_0005751 | Ga0495583_0005751_2043_2849 | 244 |
| 61 | 3300046507 | Ga0495606_0007381 | Ga0495606_0007381_2627_3433 | 244 |
| 62 | 3300046513 | Ga0495616_0004298 | Ga0495616_0004298_2627_3433 | 244 |
| 63 | 3300046518 | Ga0495631_0015919 | Ga0495631_0015919_2590_3396 | 244 |
| 64 | 3300046520 | Ga0495637_0008124 | Ga0495637_0008124_2497_3303 | 244 |
| 65 | 3300046523 | Ga0495644_0001939 | Ga0495644_0001939_6160_6966 | 244 |
| 66 | 3300046528 | Ga0495642_0005527 | Ga0495642_0005527_553_1359 | 244 |
| 67 | 3300046538 | Ga0495609_0007567 | Ga0495609_0007567_4011_4817 | 244 |
| 68 | 3300046616 | Ga0495668_0009617 | Ga0495668_0009617_2728_3534 | 244 |
| 69 | 3300046684 | Ga0495669_0012133 | Ga0495669_0012133_492_1298 | 244 |
| 70 | 3300046794 | Ga0495589_0020337 | Ga0495589_0020337_242_1048 | 244 |
| 71 | 3300046810 | Ga0495660_0005230 | Ga0495660_0005230_3938_4744 | 244 |
| 72 | 3300047323 | Ga0495683_0014684 | Ga0495683_0014684_18_824 | 244 |
| 73 | 3300047446 | Ga0495679_009243 | Ga0495679_009243_424_1230 | 244 |
| 74 | 3300047447 | Ga0495685_001349 | Ga0495685_001349_2483_3289 | 244 |
| 75 | 3300048091 | Ga0495626_0004437 | Ga0495626_0004437_3820_4626 | 244 |
| 76 | 3300048913 | Ga0496110_0173537 | Ga0496110_0173537_483_1304 | 244 |
| 77 | 3300049459 | Ga0495678_009724 | Ga0495678_009724_3355_4161 | 244 |
| 78 | 3300049460 | Ga0495682_0003585 | Ga0495682_0003585_616_1422 | 244 |
| 79 | 3300037471 | Ga0395905_0118253 | Ga0395905_0118253_1313_2128 | 245 |
| 80 | 3300046616 | Ga0495668_0000107 | Ga0495668_0000107_77599_78393 | 245 |
| 81 | 3300046522 | Ga0495643_0030613 | Ga0495643_0030613_1987_2817 | 249 |
| 82 | 3300046452 | Ga0495617_000009 | Ga0495617_000009_249906_250673 | 250 |
| 83 | 3300046453 | Ga0495627_000119 | Ga0495627_000119_36021_36788 | 250 |
| 84 | 3300046474 | Ga0495605_0000024 | Ga0495605_0000024_172756_173523 | 250 |
| 85 | 3300046500 | Ga0495596_0003383 | Ga0495596_0003383_5902_6669 | 250 |
| 86 | 3300046501 | Ga0495607_0033015 | Ga0495607_0033015_2273_3040 | 250 |
| 87 | 3300046513 | Ga0495616_0020104 | Ga0495616_0020104_2820_3587 | 250 |
| 88 | 3300046518 | Ga0495631_0005117 | Ga0495631_0005117_4868_5635 | 250 |
| 89 | 3300046523 | Ga0495644_0016228 | Ga0495644_0016228_347_1114 | 250 |
| 90 | 3300046524 | Ga0495648_0000475 | Ga0495648_0000475_15825_16592 | 250 |
| 91 | 3300046616 | Ga0495668_0000306 | Ga0495668_0000306_13740_14507 | 250 |
| 92 | 3300046648 | Ga0495611_0038893 | Ga0495611_0038893_617_1384 | 250 |
| 93 | 3300046794 | Ga0495589_0007913 | Ga0495589_0007913_208_975 | 250 |
| 94 | 3300047445 | Ga0495677_0010453 | Ga0495677_0010453_1870_2637 | 250 |
| 95 | 3300047472 | Ga0495686_0020048 | Ga0495686_0020048_974_1741 | 250 |
| 96 | 3300035691 | Ga0373931_0015586 | Ga0373931_0015586_1173_1994 | 252 |
| 97 | 3300037471 | Ga0395905_0065437 | Ga0395905_0065437_70_858 | 252 |
| 98 | 3300048903 | Ga0496100_0023653 | Ga0496100_0023653_1076_1897 | 252 |
| 99 | iso_pu_bacteria | 2765235838 | 2765570762 | 252 |
| 100 | iso_pu_bacteria | 2839094727 | 2839098315 | 252 |
| 101 | 3300035084 | Ga0373928_0039949 | Ga0373928_0039949_183_1004 | 253 |
| 102 | 3300035112 | Ga0373932_0005627 | Ga0373932_0005627_2033_2854 | 253 |
| 103 | 3300046492 | Ga0495585_0153489 | Ga0495585_0153489_403_1179 | 253 |
| 104 | 3300046507 | Ga0495606_0099741 | Ga0495606_0099741_553_1371 | 253 |
| 105 | 3300046513 | Ga0495616_0123254 | Ga0495616_0123254_176_994 | 253 |
| 106 | 3300046542 | Ga0495597_0000071 | Ga0495597_0000071_85906_86724 | 253 |
| 107 | 3300046794 | Ga0495589_0000077 | Ga0495589_0000077_40000_40818 | 253 |
| 108 | 3300047320 | Ga0495672_0000109 | Ga0495672_0000109_101027_101854 | 253 |
| 109 | iso_pu_bacteria | 2643221644 | 2644243620 | 253 |
| 110 | 3300037418 | Ga0395900_0026816 | Ga0395900_0026816_1223_2014 | 254 |
| 111 | 3300037418 | Ga0395900_0144255 | Ga0395900_0144255_116_907 | 254 |
| 112 | 3300037418 | Ga0395900_0186570 | Ga0395900_0186570_143_925 | 254 |
| 113 | 3300037471 | Ga0395905_0000125 | Ga0395905_0000125_75338_76120 | 254 |
| 114 | 3300037471 | Ga0395905_0010269 | Ga0395905_0010269_7788_8570 | 254 |
| 115 | 3300038443 | Ga0395901_0068189 | Ga0395901_0068189_1445_2227 | 254 |
| 116 | 3300038443 | Ga0395901_0430812 | Ga0395901_0430812_546_1337 | 254 |
| 117 | 3300046500 | Ga0495596_0026321 | Ga0495596_0026321_1502_2296 | 254 |
| 118 | 3300005262 | Ga0065165_1001101 | Ga0065165_100110132 | 255 |
| 119 | 3300005367 | Ga0070667_100230800 | Ga0070667_1002308002 | 255 |
| 120 | 3300014325 | Ga0163163_10018794 | Ga0163163_100187944 | 255 |
| 121 | 3300033179 | Ga0307507_10047881 | Ga0307507_100478815 | 255 |
| 122 | 3300037471 | Ga0395905_0065322 | Ga0395905_0065322_1242_2030 | 255 |
| 123 | 3300044693 | Ga0466961_0086024 | Ga0466961_0086024_1090_1875 | 255 |
| 124 | 3300045049 | Ga0466959_0023228 | Ga0466959_0023228_2540_3325 | 255 |
| 125 | 3300046457 | Ga0495590_0000008 | Ga0495590_0000008_23308_24102 | 255 |
| 126 | 3300046458 | Ga0495591_000043 | Ga0495591_000043_93147_93941 | 255 |
| 127 | 3300046471 | Ga0495650_0000322 | Ga0495650_0000322_79254_80054 | 255 |
| 128 | 3300046471 | Ga0495650_0014985 | Ga0495650_0014985_971_1765 | 255 |
| 129 | 3300046474 | Ga0495605_0061035 | Ga0495605_0061035_764_1558 | 255 |
| 130 | 3300046491 | Ga0495584_0000025 | Ga0495584_0000025_23231_24025 | 255 |
| 131 | 3300046492 | Ga0495585_0062652 | Ga0495585_0062652_830_1624 | 255 |
| 132 | 3300046500 | Ga0495596_0018322 | Ga0495596_0018322_1128_1922 | 255 |
| 133 | 3300046501 | Ga0495607_0009729 | Ga0495607_0009729_4250_5044 | 255 |
| 134 | 3300046506 | Ga0495583_0000512 | Ga0495583_0000512_31320_32114 | 255 |
| 135 | 3300046512 | Ga0495610_0002865 | Ga0495610_0002865_12919_13713 | 255 |
| 136 | 3300046518 | Ga0495631_0165991 | Ga0495631_0165991_41_823 | 255 |
| 137 | 3300046519 | Ga0495632_0010024 | Ga0495632_0010024_4218_5012 | 255 |
| 138 | 3300046520 | Ga0495637_0000009 | Ga0495637_0000009_316233_317027 | 255 |
| 139 | 3300046523 | Ga0495644_0017850 | Ga0495644_0017850_1828_2622 | 255 |
| 140 | 3300046542 | Ga0495597_0000960 | Ga0495597_0000960_12050_12856 | 255 |
| 141 | 3300046558 | Ga0495633_0001467 | Ga0495633_0001467_4452_5246 | 255 |
| 142 | 3300046648 | Ga0495611_0000361 | Ga0495611_0000361_7570_8364 | 255 |
| 143 | 3300046665 | Ga0495661_0023371 | Ga0495661_0023371_3111_3905 | 255 |
| 144 | 3300046684 | Ga0495669_0047989 | Ga0495669_0047989_165_959 | 255 |
| 145 | 3300046694 | Ga0495649_0000028 | Ga0495649_0000028_118951_119745 | 255 |
| 146 | 3300046694 | Ga0495649_0043912 | Ga0495649_0043912_180_974 | 255 |
| 147 | 3300047320 | Ga0495672_0000055 | Ga0495672_0000055_93099_93893 | 255 |
| 148 | 3300047323 | Ga0495683_0000047 | Ga0495683_0000047_100350_101144 | 255 |
| 149 | 3300047445 | Ga0495677_0000234 | Ga0495677_0000234_5296_6090 | 255 |
| 150 | 3300047446 | Ga0495679_016405 | Ga0495679_016405_487_1281 | 255 |
| 151 | 3300047470 | Ga0495681_0000016 | Ga0495681_0000016_125333_126127 | 255 |
| 152 | 3300047472 | Ga0495686_0002161 | Ga0495686_0002161_15829_16635 | 255 |
| 153 | 3300047472 | Ga0495686_0054780 | Ga0495686_0054780_1176_1970 | 255 |
| 154 | 3300048091 | Ga0495626_0012813 | Ga0495626_0012813_2363_3157 | 255 |
| 155 | 3300048091 | Ga0495626_0014831 | Ga0495626_0014831_2470_3276 | 255 |
| 156 | 3300048924 | Ga0496121_0005276 | Ga0496121_0005276_8722_9513 | 255 |
| 157 | 3300048924 | Ga0496121_0161683 | Ga0496121_0161683_475_1269 | 255 |
| 158 | 3300048927 | Ga0496124_0000125 | Ga0496124_0000125_110324_111115 | 255 |
| 159 | 3300049459 | Ga0495678_000025 | Ga0495678_000025_93977_94771 | 255 |
| 160 | 3300021361 | Ga0213872_10000008 | Ga0213872_1000000893 | 256 |
| 161 | 3300025910 | Ga0207684_10062095 | Ga0207684_100620952 | 256 |
| 162 | 3300039447 | Ga0436361_1054342 | Ga0436361_1054342_3633_4427 | 256 |
| 163 | 3300042134 | Ga0450898_037990 | Ga0450898_037990_43_846 | 256 |
| 164 | 3300046473 | Ga0495582_0009097 | Ga0495582_0009097_426_1232 | 256 |
| 165 | 3300046491 | Ga0495584_0016042 | Ga0495584_0016042_2631_3437 | 256 |
| 166 | 3300046492 | Ga0495585_0066840 | Ga0495585_0066840_776_1582 | 256 |
| 167 | 3300046500 | Ga0495596_0001710 | Ga0495596_0001710_8810_9616 | 256 |
| 168 | 3300046501 | Ga0495607_0048889 | Ga0495607_0048889_383_1189 | 256 |
| 169 | 3300046506 | Ga0495583_0039459 | Ga0495583_0039459_1379_2188 | 256 |
| 170 | 3300046518 | Ga0495631_0067091 | Ga0495631_0067091_226_1032 | 256 |
| 171 | 3300046519 | Ga0495632_0000012 | Ga0495632_0000012_167211_168050 | 256 |
| 172 | 3300046523 | Ga0495644_0017701 | Ga0495644_0017701_10_816 | 256 |
| 173 | 3300046524 | Ga0495648_0021701 | Ga0495648_0021701_2233_3039 | 256 |
| 174 | 3300046528 | Ga0495642_0000638 | Ga0495642_0000638_11916_12722 | 256 |
| 175 | 3300046528 | Ga0495642_0084867 | Ga0495642_0084867_10_816 | 256 |
| 176 | 3300046530 | Ga0495654_0018266 | Ga0495654_0018266_682_1488 | 256 |
| 177 | 3300046558 | Ga0495633_0014392 | Ga0495633_0014392_3108_3914 | 256 |
| 178 | 3300046616 | Ga0495668_0047834 | Ga0495668_0047834_892_1698 | 256 |
| 179 | 3300046648 | Ga0495611_0070483 | Ga0495611_0070483_566_1372 | 256 |
| 180 | 3300046660 | Ga0495625_0055916 | Ga0495625_0055916_1108_1914 | 256 |
| 181 | 3300046665 | Ga0495661_0004301 | Ga0495661_0004301_1156_1995 | 256 |
| 182 | 3300046665 | Ga0495661_0035369 | Ga0495661_0035369_1237_2043 | 256 |
| 183 | 3300046684 | Ga0495669_0000035 | Ga0495669_0000035_41870_42676 | 256 |
| 184 | 3300046684 | Ga0495669_0005372 | Ga0495669_0005372_3571_4377 | 256 |
| 185 | 3300046691 | Ga0495670_0160886 | Ga0495670_0160886_202_1008 | 256 |
| 186 | 3300046692 | Ga0495671_0000176 | Ga0495671_0000176_23803_24609 | 256 |
| 187 | 3300047320 | Ga0495672_0014240 | Ga0495672_0014240_2914_3720 | 256 |
| 188 | 3300047323 | Ga0495683_0140795 | Ga0495683_0140795_277_1083 | 256 |
| 189 | 3300048089 | Ga0495614_0005989 | Ga0495614_0005989_3050_3856 | 256 |
| 190 | 3300048091 | Ga0495626_0021663 | Ga0495626_0021663_528_1334 | 256 |
| 191 | 3300048905 | Ga0496102_0000158 | Ga0496102_0000158_16874_17680 | 256 |
| 192 | 3300048913 | Ga0496110_0000001 | Ga0496110_0000001_46830_47639 | 256 |
| 193 | 3300005841 | Ga0068863_100251603 | Ga0068863_1002516032 | 257 |
| 194 | 3300009093 | Ga0105240_10345020 | Ga0105240_103450201 | 257 |
| 195 | 3300026088 | Ga0207641_10554167 | Ga0207641_105541672 | 257 |
| 196 | 3300039447 | Ga0436361_0071320 | Ga0436361_0071320_5101_5901 | 257 |
| 197 | 3300046525 | Ga0495663_0036439 | Ga0495663_0036439_19_810 | 257 |
| 198 | 3300046615 | Ga0495656_0234516 | Ga0495656_0234516_110_901 | 257 |
| 199 | 3300046674 | Ga0495588_0087269 | Ga0495588_0087269_415_1209 | 257 |
| 200 | 3300046684 | Ga0495669_0215958 | Ga0495669_0215958_112_906 | 257 |
| 201 | 3300047318 | Ga0495636_0014897 | Ga0495636_0014897_878_1672 | 257 |
| 202 | 3300047447 | Ga0495685_017223 | Ga0495685_017223_1033_1827 | 257 |
| 203 | 3300049571 | Ga0501034_0475351 | Ga0501034_0475351_154_957 | 257 |
| 204 | iso_pu_bacteria | 2939631187 | 2939636050 | 257 |
| 205 | 3300003794 | Ga0055531_10000680 | Ga0055531_1000068017 | 258 |
| 206 | 3300005456 | Ga0070678_100025052 | Ga0070678_1000250523 | 258 |
| 207 | 3300005539 | Ga0068853_100487891 | Ga0068853_1004878912 | 258 |
| 208 | 3300006038 | Ga0075365_10006848 | Ga0075365_100068482 | 258 |
| 209 | 3300006946 | Ga0079104_1000003 | Ga0079104_1000003278 | 258 |
| 210 | 3300009092 | Ga0105250_10001577 | Ga0105250_100015777 | 258 |
| 211 | 3300009093 | Ga0105240_10013081 | Ga0105240_100130817 | 258 |
| 212 | 3300009148 | Ga0105243_10007802 | Ga0105243_100078024 | 258 |
| 213 | 3300009545 | Ga0105237_10002223 | Ga0105237_1000222313 | 258 |
| 214 | 3300009551 | Ga0105238_10164074 | Ga0105238_101640742 | 258 |
| 215 | 3300010375 | Ga0105239_10000470 | Ga0105239_1000047042 | 258 |
| 216 | 3300025303 | Ga0209051_1000346 | Ga0209051_100034631 | 258 |
| 217 | 3300025304 | Ga0209257_1000396 | Ga0209257_100039672 | 258 |
| 218 | 3300025911 | Ga0207654_10126411 | Ga0207654_101264112 | 258 |
| 219 | 3300025913 | Ga0207695_10013685 | Ga0207695_100136854 | 258 |
| 220 | 3300025914 | Ga0207671_10002553 | Ga0207671_1000255312 | 258 |
| 221 | 3300025924 | Ga0207694_10067457 | Ga0207694_100674573 | 258 |
| 222 | 3300025935 | Ga0207709_10000032 | Ga0207709_10000032165 | 258 |
| 223 | 3300026041 | Ga0207639_10428698 | Ga0207639_104286982 | 258 |
| 224 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021492 | 258 |
| 225 | 3300028794 | Ga0307515_10022377 | Ga0307515_1002237712 | 258 |
| 226 | 3300031507 | Ga0307509_10034145 | Ga0307509_100341452 | 258 |
| 227 | 3300031649 | Ga0307514_10001372 | Ga0307514_1000137227 | 258 |
| 228 | 3300031649 | Ga0307514_10047056 | Ga0307514_100470562 | 258 |
| 229 | 3300037471 | Ga0395905_0000416 | Ga0395905_0000416_20016_20810 | 258 |
| 230 | 3300037471 | Ga0395905_0060780 | Ga0395905_0060780_2674_3471 | 258 |
| 231 | 3300038443 | Ga0395901_0044264 | Ga0395901_0044264_2820_3617 | 258 |
| 232 | 3300042876 | Ga0451577_0110323 | Ga0451577_0110323_775_1575 | 258 |
| 233 | 3300044658 | Ga0466972_0007487 | Ga0466972_0007487_2549_3370 | 258 |
| 234 | 3300049581 | Ga0501047_0458849 | Ga0501047_0458849_252_1049 | 258 |
| 235 | 3300050492 | nmdc:mga0yw44_2817_c1 | nmdc:mga0yw44_2817_c1_1491_2282 | 258 |
| 236 | 3300005338 | Ga0068868_100005025 | Ga0068868_10000502510 | 259 |
| 237 | 3300005563 | Ga0068855_100272859 | Ga0068855_1002728592 | 259 |
| 238 | 3300006038 | Ga0075365_10086185 | Ga0075365_100861852 | 259 |
| 239 | 3300006177 | Ga0075362_10003218 | Ga0075362_100032182 | 259 |
| 240 | 3300006178 | Ga0075367_10003292 | Ga0075367_100032927 | 259 |
| 241 | 3300006353 | Ga0075370_10093180 | Ga0075370_100931802 | 259 |
| 242 | 3300009174 | Ga0105241_10258247 | Ga0105241_102582471 | 259 |
| 243 | 3300013297 | Ga0157378_10098921 | Ga0157378_100989212 | 259 |
| 244 | 3300014969 | Ga0157376_10001128 | Ga0157376_100011285 | 259 |
| 245 | 3300025942 | Ga0207689_10378874 | Ga0207689_103788742 | 259 |
| 246 | 3300026023 | Ga0207677_10002674 | Ga0207677_1000267411 | 259 |
| 247 | 3300026023 | Ga0207677_10015061 | Ga0207677_100150615 | 259 |
| 248 | 3300028794 | Ga0307515_10051947 | Ga0307515_100519477 | 259 |
| 249 | 3300031344 | Ga0265316_10062038 | Ga0265316_100620382 | 259 |
| 250 | 3300031711 | Ga0265314_10003235 | Ga0265314_1000323510 | 259 |
| 251 | 3300045051 | Ga0451576_0427439 | Ga0451576_0427439_436_1254 | 259 |
| 252 | 3300046517 | Ga0495630_0066319 | Ga0495630_0066319_1181_2002 | 259 |
| 253 | 3300046690 | Ga0495624_0013366 | Ga0495624_0013366_3745_4566 | 259 |
| 254 | 3300047321 | Ga0495676_0046932 | Ga0495676_0046932_452_1273 | 259 |
| 255 | 3300047673 | Ga0495593_0087990 | Ga0495593_0087990_153_974 | 259 |
| 256 | 3300048089 | Ga0495614_0035203 | Ga0495614_0035203_737_1558 | 259 |
| 257 | 3300049573 | Ga0501037_0059411 | Ga0501037_0059411_711_1535 | 259 |
| 258 | 3300049679 | Ga0501249_022288 | Ga0501249_022288_288_1127 | 259 |
| 259 | 3300050492 | nmdc:mga0yw44_125873_c1 | nmdc:mga0yw44_125873_c1_130_939 | 259 |
| 260 | 3300050494 | nmdc:mga06z11_56515_c1 | nmdc:mga06z11_56515_c1_1152_1991 | 259 |
| 261 | 3300050496 | nmdc:mga07m45_100712_c1 | nmdc:mga07m45_100712_c1_141_980 | 259 |
| 262 | iso_pu_bacteria | 2643221570 | 2643868566 | 259 |
| 263 | iso_pu_bacteria | 2643221596 | 2643990942 | 259 |
| 264 | iso_pu_bacteria | 2643221652 | 2644295920 | 259 |
| 265 | iso_pu_bacteria | 2990710928 | 2990711536 | 259 |
| 266 | 3300003791 | Ga0055530_10005234 | Ga0055530_100052344 | 260 |
| 267 | 3300003791 | Ga0055530_10046531 | Ga0055530_100465312 | 260 |
| 268 | 3300003792 | Ga0055540_1000014 | Ga0055540_1000014188 | 260 |
| 269 | 3300003794 | Ga0055531_10008397 | Ga0055531_100083976 | 260 |
| 270 | 3300006946 | Ga0079104_1000013 | Ga0079104_1000013208 | 260 |
| 271 | 3300025298 | Ga0209050_1001450 | Ga0209050_10014508 | 260 |
| 272 | 3300025298 | Ga0209050_1009152 | Ga0209050_10091522 | 260 |
| 273 | 3300025303 | Ga0209051_1000035 | Ga0209051_1000035298 | 260 |
| 274 | 3300025304 | Ga0209257_1000212 | Ga0209257_1000212104 | 260 |
| 275 | 3300027111 | Ga0209281_1000182 | Ga0209281_100018274 | 260 |
| 276 | 3300028794 | Ga0307515_10053672 | Ga0307515_100536725 | 260 |
| 277 | 3300031456 | Ga0307513_10000017 | Ga0307513_10000017213 | 260 |
| 278 | 3300031711 | Ga0265314_10058294 | Ga0265314_100582942 | 260 |
| 279 | 3300031712 | Ga0265342_10181884 | Ga0265342_101818842 | 260 |
| 280 | 3300031730 | Ga0307516_10002245 | Ga0307516_1000224521 | 260 |
| 281 | 3300031730 | Ga0307516_10039030 | Ga0307516_100390302 | 260 |
| 282 | 3300044658 | Ga0466972_0002127 | Ga0466972_0002127_1395_2210 | 260 |
| 283 | 3300045049 | Ga0466959_0038309 | Ga0466959_0038309_1728_2540 | 260 |
| 284 | 3300003775 | Ga0055524_1000167 | Ga0055524_100016731 | 261 |
| 285 | 3300005336 | Ga0070680_100081050 | Ga0070680_1000810501 | 261 |
| 286 | 3300005530 | Ga0070679_100404720 | Ga0070679_1004047202 | 261 |
| 287 | 3300005563 | Ga0068855_100055029 | Ga0068855_1000550297 | 261 |
| 288 | 3300009093 | Ga0105240_10238515 | Ga0105240_102385152 | 261 |
| 289 | 3300009551 | Ga0105238_10213730 | Ga0105238_102137302 | 261 |
| 290 | 3300025291 | Ga0209675_1007750 | Ga0209675_10077502 | 261 |
| 291 | 3300025299 | Ga0209256_1000356 | Ga0209256_100035631 | 261 |
| 292 | 3300025921 | Ga0207652_10160831 | Ga0207652_101608313 | 261 |
| 293 | 3300025924 | Ga0207694_10286375 | Ga0207694_102863752 | 261 |
| 294 | 3300025949 | Ga0207667_10181503 | Ga0207667_101815032 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qv0-assembly1.cif.gz_A | crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae | 0.915 | 5 | 129 |
| 1mav-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ | 0.9012 | 4 | 123 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9003 | 4 | 123 |
| 6m8o-assembly1.cif.gz_A | crystal structure of the receiver domain of lytr from staphylococcus aureus | 0.8976 | 5 | 123 |
| 6swf-assembly1.cif.gz_A | selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus | 0.8966 | 3 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qv0B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9156 | 5 | 129 | 3.40.50.2300 |
| af_Q2FVQ7_36_146_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.9126 | 154 | 257 | 2.40.50.1020 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9059 | 4 | 90 | 3.40.50.2300 |
| af_P0AFT5_129_238_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.9052 | 154 | 257 | 2.40.50.1020 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9052 | 4 | 90 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4TPM5-F1-model_v4 | DNA-binding response regulator | 0.9722 | 3 | 127 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1W9QX15-F1-model_v4 | Response regulatory domain-containing protein | 0.9283 | 2 | 117 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7X8X120-F1-model_v4 | LytTR family transcriptional regulator | 0.9249 | 172 | 257 |
GO:0000156
GO:0003677 |
| AF-A0A6B3CWD3-F1-model_v4 | LytTR family transcriptional regulator | 0.9247 | 159 | 257 |
GO:0000156
GO:0003677 |
| AF-A0A1H8Q3M4-F1-model_v4 | Two-component system, response regulator YesN | 0.9077 | 4 | 127 |
GO:0000160
GO:0003700 GO:0005737 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar