F392052

General Info

Members Datasets Scaffolds Average Seq Length
294 176 283 262

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10258247|Ga0105241_102582471
Length 288
Sequence LRRGDSNDRARAAFGCGAEVHRRATALIAEDEPLLAQALRAELASAWAQLEVLATVGDGASAVTQALALRPDVLFFDIRMPGQSGLEAAAELADEWPHDQPFPALVFVTAYDQYAVQAFETQAVDYVLKPVQPARLRKTVAKVQDALAKRTQGASDIEATLGQLRNLLGQVAEPAPGTAQGPLKMLQVSVGTSIRMVPVEDVVYFEAADKYVRVLTAGHEYLIRTPLKELLPQLDAQRFWQVHRGTVVRADAIDSVTRDEAGKLHLVLRGRAEKLAVSRLYAHLFKAM

Samples

Sample ID Description Type Environment
1 2643221570 Acidovorax sp. Root568 Isolate Unclassified
2 2643221596 Acidovorax sp. Root70 Isolate Unclassified
3 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
4 2643221652 Acidovorax sp. Root402 Isolate Unclassified
5 2721755523 Delftia sp. HK171 Isolate Unclassified
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
8 2857564685 Duganella sp. R-74599 Isolate Unclassified
9 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
10 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
11 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
84 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 1.7
Rhizoplane 1.7
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1000167 3300003775 Bacteria 75234
2 Ga0055530_10005234 3300003791 Bacteria 6267
3 Ga0055530_10046531 3300003791 Bacteria 1029
4 Ga0055540_1000014 3300003792 Bacteria 234171
5 Ga0055531_10000680 3300003794 Bacteria 29030
6 Ga0055531_10008397 3300003794 Bacteria 5456
7 Ga0065165_1001101 3300005262 Bacteria 32096
8 Ga0070680_100074317 3300005336 Bacteria 2797
9 Ga0070680_100081050 3300005336 Bacteria 2677
10 Ga0068868_100005025 3300005338 Bacteria 9289
11 Ga0070692_10000899 3300005345 Bacteria 10074
12 Ga0070667_100230800 3300005367 Bacteria 1650
13 Ga0070678_100025052 3300005456 Bacteria 4006
14 Ga0070662_100008945 3300005457 Bacteria 6528
15 Ga0070681_10024294 3300005458 Bacteria 6101
16 Ga0070679_100011916 3300005530 Bacteria 8298
17 Ga0070679_100404720 3300005530 Bacteria 1310
18 Ga0068853_100487891 3300005539 Bacteria 1162
19 Ga0068855_100055029 3300005563 Bacteria 4674
20 Ga0068855_100099052 3300005563 Bacteria 3358
21 Ga0068855_100272859 3300005563 Bacteria 1880
22 Ga0068854_100011664 3300005578 Bacteria 5732
23 Ga0068856_100354185 3300005614 Bacteria 1486
24 Ga0068852_100292464 3300005616 Bacteria 1574
25 Ga0068863_100251603 3300005841 Bacteria 1707
26 Ga0075365_10006848 3300006038 Bacteria 6321
27 Ga0075365_10086185 3300006038 Bacteria 2134
28 Ga0075362_10003218 3300006177 Bacteria 5659
29 Ga0075367_10003292 3300006178 Bacteria 7661
30 Ga0075370_10093180 3300006353 Bacteria 1739
31 Ga0079104_1000003 3300006946 Bacteria 468966
32 Ga0079104_1000013 3300006946 Bacteria 349477
33 Ga0105250_10001577 3300009092 Bacteria 12251
34 Ga0105240_10013081 3300009093 Bacteria 11422
35 Ga0105240_10238515 3300009093 Bacteria 2109
36 Ga0105240_10345020 3300009093 Bacteria 1691
37 Ga0105243_10007802 3300009148 Bacteria 8229
38 Ga0105241_10258247 3300009174 Bacteria 1480
39 Ga0105237_10002223 3300009545 Bacteria 24276
40 Ga0105238_10164074 3300009551 Bacteria 2197
41 Ga0105238_10213730 3300009551 Bacteria 1905
42 Ga0105239_10000470 3300010375 Bacteria 59011
43 Ga0157370_10004980 3300013104 Bacteria 15033
44 Ga0157378_10098921 3300013297 Bacteria 2661
45 Ga0163163_10018794 3300014325 Bacteria 6479
46 Ga0157376_10001128 3300014969 Bacteria 17513
47 Ga0182007_10017465 3300015262 Bacteria 2620
48 Ga0213872_10000008 3300021361 Bacteria 226283
49 Ga0209675_1007750 3300025291 Bacteria 4053
50 Ga0209050_1001450 3300025298 Bacteria 25477
51 Ga0209050_1009152 3300025298 Bacteria 5128
52 Ga0209256_1000356 3300025299 Bacteria 74710
53 Ga0209051_1000035 3300025303 Bacteria 346999
54 Ga0209051_1000346 3300025303 Bacteria 69226
55 Ga0209257_1000212 3300025304 Bacteria 138478
56 Ga0209257_1000396 3300025304 Bacteria 86000
57 Ga0207684_10062095 3300025910 Bacteria 3173
58 Ga0207654_10126411 3300025911 Bacteria 1612
59 Ga0207707_10001618 3300025912 Bacteria 20756
60 Ga0207695_10013685 3300025913 Bacteria 9657
61 Ga0207671_10002553 3300025914 Bacteria 19340
62 Ga0207660_10055261 3300025917 Bacteria 2836
63 Ga0207649_10177735 3300025920 Bacteria 1488
64 Ga0207652_10160831 3300025921 Bacteria 2013
65 Ga0207694_10067457 3300025924 Bacteria 2792
66 Ga0207694_10286375 3300025924 Bacteria 1354
67 Ga0207706_10000638 3300025933 Bacteria 37216
68 Ga0207709_10000032 3300025935 Bacteria 324478
69 Ga0207689_10378874 3300025942 Bacteria 1178
70 Ga0207661_10106409 3300025944 Bacteria 2365
71 Ga0207667_10181503 3300025949 Bacteria 2161
72 Ga0207640_10014490 3300025981 Bacteria 4541
73 Ga0207677_10002674 3300026023 Bacteria 9390
74 Ga0207677_10015061 3300026023 Bacteria 4535
75 Ga0207639_10428698 3300026041 Bacteria 1197
76 Ga0207702_10151551 3300026078 Bacteria 2109
77 Ga0207641_10554167 3300026088 Bacteria 1121
78 Ga0209281_1000002 3300027111 Bacteria 1924012
79 Ga0209281_1000182 3300027111 Bacteria 145698
80 Ga0307515_10022377 3300028794 Bacteria 11141
81 Ga0307515_10051947 3300028794 Bacteria 6095
82 Ga0307515_10053672 3300028794 Bacteria 5939
83 Ga0265316_10062038 3300031344 Bacteria 2902
84 Ga0307513_10000017 3300031456 Bacteria 282386
85 Ga0307513_10012951 3300031456 Bacteria 10255
86 Ga0307509_10034145 3300031507 Bacteria 5590
87 Ga0307514_10001372 3300031649 Bacteria 30729
88 Ga0307514_10047056 3300031649 Bacteria 3369
89 Ga0265314_10003235 3300031711 Bacteria 15924
90 Ga0265314_10058294 3300031711 Bacteria 2647
91 Ga0265342_10181884 3300031712 Bacteria 1151
92 Ga0307516_10002245 3300031730 Bacteria 26096
93 Ga0307516_10039030 3300031730 Bacteria 4734
94 Ga0307507_10047881 3300033179 Bacteria 4168
95 Ga0373928_0039949 3300035084 Bacteria 1074
96 Ga0373932_0005627 3300035112 Bacteria 2947
97 Ga0373931_0015586 3300035691 Bacteria 3731
98 Ga0395899_0174805 3300037312 Bacteria 1511
99 Ga0395900_0026816 3300037418 Bacteria 5896
100 Ga0395900_0144255 3300037418 Bacteria 2436
101 Ga0395900_0186570 3300037418 Bacteria 2105
102 Ga0395900_0459591 3300037418 Bacteria 1228
103 Ga0395905_0000125 3300037471 Bacteria 126341
104 Ga0395905_0000416 3300037471 Bacteria 59735
105 Ga0395905_0010269 3300037471 Bacteria 9117
106 Ga0395905_0060780 3300037471 Bacteria 3533
107 Ga0395905_0065322 3300037471 Bacteria 3406
108 Ga0395905_0065437 3300037471 Bacteria 3403
109 Ga0395905_0118253 3300037471 Bacteria 2491
110 Ga0395901_0044264 3300038443 Bacteria 4617
111 Ga0395901_0068189 3300038443 Bacteria 3706
112 Ga0395901_0430812 3300038443 Bacteria 1351
113 Ga0436361_0071320 3300039447 Bacteria 6752
114 Ga0436361_1054342 3300039447 Bacteria 9826
115 Ga0450919_005397 3300042121 Bacteria 1536
116 Ga0450898_037990 3300042134 Bacteria 903
117 Ga0450918_005571 3300042531 Bacteria 2258
118 Ga0451577_0110323 3300042876 Bacteria 2461
119 Ga0451577_0308991 3300042876 Bacteria 1433
120 Ga0466969_0002120 3300044656 Bacteria 10582
121 Ga0466972_0002127 3300044658 Bacteria 9728
122 Ga0466972_0007487 3300044658 Bacteria 5485
123 Ga0466989_0157495 3300044663 Bacteria 1365
124 Ga0466966_0035950 3300044684 Bacteria 3199
125 Ga0466961_0002983 3300044693 Bacteria 10508
126 Ga0466961_0086024 3300044693 Bacteria 1987
127 Ga0466963_0180833 3300044694 Bacteria 1472
128 Ga0453684_0272627 3300044712 Bacteria 1933
129 Ga0466971_0089423 3300044719 Bacteria 1409
130 Ga0466960_0211310 3300044901 Bacteria 1064
131 Ga0466959_0003210 3300045049 Bacteria 10632
132 Ga0466959_0023228 3300045049 Bacteria 4588
133 Ga0466959_0038309 3300045049 Bacteria 3542
134 Ga0451576_0427439 3300045051 Bacteria 1390
135 Ga0466958_0176400 3300045836 Bacteria 1355
136 Ga0466967_0537273 3300045976 Bacteria 1150
137 Ga0495617_000009 3300046452 Bacteria 312936
138 Ga0495627_000119 3300046453 Bacteria 99048
139 Ga0495590_0000008 3300046457 Bacteria 330520
140 Ga0495591_000043 3300046458 Bacteria 148885
141 Ga0495591_007411 3300046458 Bacteria 4669
142 Ga0495650_0000322 3300046471 Bacteria 85802
143 Ga0495650_0014985 3300046471 Bacteria 4000
144 Ga0495582_0009097 3300046473 Bacteria 5478
145 Ga0495605_0000024 3300046474 Bacteria 236016
146 Ga0495605_0002967 3300046474 Bacteria 10272
147 Ga0495605_0005221 3300046474 Bacteria 7574
148 Ga0495605_0061035 3300046474 Bacteria 1805
149 Ga0495584_0000025 3300046491 Bacteria 116731
150 Ga0495584_0016042 3300046491 Bacteria 3822
151 Ga0495584_0020946 3300046491 Bacteria 3319
152 Ga0495585_0002372 3300046492 Bacteria 13521
153 Ga0495585_0009095 3300046492 Bacteria 5982
154 Ga0495585_0062652 3300046492 Bacteria 2042
155 Ga0495585_0066840 3300046492 Bacteria 1967
156 Ga0495585_0153489 3300046492 Bacteria 1199
157 Ga0495594_0130866 3300046499 Bacteria 1421
158 Ga0495596_0001710 3300046500 Bacteria 12345
159 Ga0495596_0003383 3300046500 Bacteria 8103
160 Ga0495596_0018322 3300046500 Bacteria 2886
161 Ga0495596_0018372 3300046500 Bacteria 2882
162 Ga0495596_0026321 3300046500 Bacteria 2345
163 Ga0495596_0058902 3300046500 Bacteria 1497
164 Ga0495607_0004723 3300046501 Bacteria 9964
165 Ga0495607_0009729 3300046501 Bacteria 6489
166 Ga0495607_0033015 3300046501 Bacteria 3152
167 Ga0495607_0048889 3300046501 Bacteria 2470
168 Ga0495583_0000512 3300046506 Bacteria 55428
169 Ga0495583_0005751 3300046506 Bacteria 8302
170 Ga0495583_0039459 3300046506 Bacteria 2224
171 Ga0495606_0007381 3300046507 Bacteria 9862
172 Ga0495606_0099741 3300046507 Bacteria 1770
173 Ga0495610_0002865 3300046512 Bacteria 14003
174 Ga0495616_0004298 3300046513 Bacteria 8997
175 Ga0495616_0020104 3300046513 Bacteria 3637
176 Ga0495616_0123254 3300046513 Bacteria 1194
177 Ga0495630_0066319 3300046517 Bacteria 2713
178 Ga0495631_0005117 3300046518 Bacteria 6910
179 Ga0495631_0015919 3300046518 Bacteria 3593
180 Ga0495631_0067091 3300046518 Bacteria 1552
181 Ga0495631_0165991 3300046518 Bacteria 947
182 Ga0495632_0000012 3300046519 Bacteria 264389
183 Ga0495632_0010024 3300046519 Bacteria 5648
184 Ga0495637_0000009 3300046520 Bacteria 402028
185 Ga0495637_0008124 3300046520 Bacteria 5166
186 Ga0495643_0030613 3300046522 Bacteria 3003
187 Ga0495644_0001939 3300046523 Bacteria 8314
188 Ga0495644_0016228 3300046523 Bacteria 2851
189 Ga0495644_0017701 3300046523 Bacteria 2722
190 Ga0495644_0017850 3300046523 Bacteria 2710
191 Ga0495644_0020150 3300046523 Bacteria 2545
192 Ga0495648_0000475 3300046524 Bacteria 43147
193 Ga0495648_0021701 3300046524 Bacteria 4443
194 Ga0495663_0036439 3300046525 Bacteria 1481
195 Ga0495642_0000638 3300046528 Bacteria 17549
196 Ga0495642_0005527 3300046528 Bacteria 4857
197 Ga0495642_0084867 3300046528 Bacteria 1336
198 Ga0495654_0018266 3300046530 Bacteria 3678
199 Ga0495609_0001454 3300046538 Bacteria 15717
200 Ga0495609_0003889 3300046538 Bacteria 8380
201 Ga0495609_0007567 3300046538 Bacteria 5400
202 Ga0495597_0000071 3300046542 Bacteria 88148
203 Ga0495597_0000960 3300046542 Bacteria 22269
204 Ga0495633_0001467 3300046558 Bacteria 18303
205 Ga0495633_0014392 3300046558 Bacteria 4139
206 Ga0495656_0234516 3300046615 Bacteria 922
207 Ga0495668_0000107 3300046616 Bacteria 132624
208 Ga0495668_0000306 3300046616 Bacteria 67742
209 Ga0495668_0009617 3300046616 Bacteria 5916
210 Ga0495668_0047834 3300046616 Bacteria 2374
211 Ga0495611_0000361 3300046648 Bacteria 29629
212 Ga0495611_0002796 3300046648 Bacteria 7806
213 Ga0495611_0038893 3300046648 Bacteria 2117
214 Ga0495611_0070483 3300046648 Bacteria 1597
215 Ga0495625_0055916 3300046660 Bacteria 2812
216 Ga0495661_0004301 3300046665 Bacteria 10331
217 Ga0495661_0023371 3300046665 Bacteria 4013
218 Ga0495661_0035369 3300046665 Bacteria 3134
219 Ga0495661_0127028 3300046665 Bacteria 1402
220 Ga0495588_0087269 3300046674 Bacteria 1632
221 Ga0495669_0000035 3300046684 Bacteria 96159
222 Ga0495669_0005372 3300046684 Bacteria 5341
223 Ga0495669_0006301 3300046684 Bacteria 4953
224 Ga0495669_0012133 3300046684 Bacteria 3664
225 Ga0495669_0047989 3300046684 Bacteria 1909
226 Ga0495669_0215958 3300046684 Bacteria 919
227 Ga0495624_0013366 3300046690 Bacteria 5599
228 Ga0495670_0160886 3300046691 Bacteria 1179
229 Ga0495671_0000176 3300046692 Bacteria 56722
230 Ga0495649_0000028 3300046694 Bacteria 163229
231 Ga0495649_0043912 3300046694 Bacteria 2439
232 Ga0495589_0000077 3300046794 Bacteria 90550
233 Ga0495589_0007913 3300046794 Bacteria 5567
234 Ga0495589_0011774 3300046794 Bacteria 4538
235 Ga0495589_0020337 3300046794 Bacteria 3395
236 Ga0495660_0005230 3300046810 Bacteria 7784
237 Ga0495636_0014897 3300047318 Bacteria 3095
238 Ga0495672_0000055 3300047320 Bacteria 229428
239 Ga0495672_0000109 3300047320 Bacteria 131335
240 Ga0495672_0014240 3300047320 Bacteria 5457
241 Ga0495676_0046932 3300047321 Bacteria 3500
242 Ga0495683_0000047 3300047323 Bacteria 126770
243 Ga0495683_0014684 3300047323 Bacteria 4079
244 Ga0495683_0020279 3300047323 Bacteria 3430
245 Ga0495683_0140795 3300047323 Bacteria 1130
246 Ga0495677_0000234 3300047445 Bacteria 25123
247 Ga0495677_0010453 3300047445 Bacteria 3408
248 Ga0495679_009243 3300047446 Bacteria 3957
249 Ga0495679_016405 3300047446 Bacteria 2680
250 Ga0495685_001349 3300047447 Bacteria 7506
251 Ga0495685_017223 3300047447 Bacteria 2474
252 Ga0495681_0000016 3300047470 Bacteria 181322
253 Ga0495686_0002161 3300047472 Bacteria 19178
254 Ga0495686_0020048 3300047472 Bacteria 4461
255 Ga0495686_0054780 3300047472 Bacteria 2496
256 Ga0495593_0087990 3300047673 Bacteria 1601
257 Ga0495614_0005989 3300048089 Bacteria 5475
258 Ga0495614_0035203 3300048089 Bacteria 2152
259 Ga0495626_0000017 3300048091 Bacteria 231648
260 Ga0495626_0004437 3300048091 Bacteria 8613
261 Ga0495626_0012278 3300048091 Bacteria 4497
262 Ga0495626_0012813 3300048091 Bacteria 4377
263 Ga0495626_0014831 3300048091 Bacteria 4006
264 Ga0495626_0021663 3300048091 Bacteria 3185
265 Ga0496100_0023653 3300048903 Bacteria 3736
266 Ga0496102_0000158 3300048905 Bacteria 91822
267 Ga0496106_0178183 3300048909 Bacteria 1687
268 Ga0496110_0000001 3300048913 Bacteria 232652
269 Ga0496110_0173537 3300048913 Bacteria 1956
270 Ga0496121_0005276 3300048924 Bacteria 16661
271 Ga0496121_0161683 3300048924 Bacteria 1637
272 Ga0496124_0000125 3300048927 Bacteria 159942
273 Ga0495678_000025 3300049459 Bacteria 227891
274 Ga0495678_009724 3300049459 Bacteria 4725
275 Ga0495682_0003585 3300049460 Bacteria 6856
276 Ga0501034_0475351 3300049571 Bacteria 1165
277 Ga0501037_0059411 3300049573 Bacteria 2789
278 Ga0501047_0458849 3300049581 Bacteria 1103
279 Ga0501249_022288 3300049679 Bacteria 1386
280 nmdc:mga0yw44_125873_c1 3300050492 Bacteria 1655
281 nmdc:mga0yw44_2817_c1 3300050492 Bacteria 7545
282 nmdc:mga06z11_56515_c1 3300050494 Bacteria 2030
283 nmdc:mga07m45_100712_c1 3300050496 Bacteria 1659

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857564685 2857569911 219
2 iso_pu_bacteria 2721755523 2722885039 220
3 3300042121 Ga0450919_005397 Ga0450919_005397_484_1224 224
4 3300042531 Ga0450918_005571 Ga0450918_005571_148_849 224
5 3300044901 Ga0466960_0211310 Ga0466960_0211310_319_1041 225
6 3300046474 Ga0495605_0005221 Ga0495605_0005221_1969_2775 233
7 3300046538 Ga0495609_0003889 Ga0495609_0003889_5701_6507 233
8 3300046794 Ga0495589_0011774 Ga0495589_0011774_553_1359 233
9 3300047323 Ga0495683_0020279 Ga0495683_0020279_2510_3316 233
10 3300031456 Ga0307513_10012951 Ga0307513_100129514 234
11 3300045976 Ga0466967_0537273 Ga0466967_0537273_32_844 234
12 3300046492 Ga0495585_0002372 Ga0495585_0002372_9108_9914 234
13 3300046523 Ga0495644_0020150 Ga0495644_0020150_1538_2344 234
14 iso_pu_bacteria 2928531327 2928531371 236
15 3300042876 Ga0451577_0308991 Ga0451577_0308991_130_897 237
16 3300044712 Ga0453684_0272627 Ga0453684_0272627_73_840 237
17 3300048909 Ga0496106_0178183 Ga0496106_0178183_545_1291 237
18 3300005616 Ga0068852_100292464 Ga0068852_1002924642 238
19 3300037312 Ga0395899_0174805 Ga0395899_0174805_17_760 238
20 3300046499 Ga0495594_0130866 Ga0495594_0130866_231_1034 238
21 3300046500 Ga0495596_0058902 Ga0495596_0058902_645_1448 238
22 3300048091 Ga0495626_0012278 Ga0495626_0012278_1805_2608 238
23 3300005336 Ga0070680_100074317 Ga0070680_1000743172 239
24 3300005345 Ga0070692_10000899 Ga0070692_100008994 239
25 3300005458 Ga0070681_10024294 Ga0070681_100242944 239
26 3300005530 Ga0070679_100011916 Ga0070679_1000119168 239
27 3300005563 Ga0068855_100099052 Ga0068855_1000990523 239
28 3300005578 Ga0068854_100011664 Ga0068854_1000116642 239
29 3300005614 Ga0068856_100354185 Ga0068856_1003541852 239
30 3300013104 Ga0157370_10004980 Ga0157370_100049807 239
31 3300015262 Ga0182007_10017465 Ga0182007_100174653 239
32 3300025912 Ga0207707_10001618 Ga0207707_1000161817 239
33 3300025917 Ga0207660_10055261 Ga0207660_100552611 239
34 3300025920 Ga0207649_10177735 Ga0207649_101777352 239
35 3300025944 Ga0207661_10106409 Ga0207661_101064093 239
36 3300025981 Ga0207640_10014490 Ga0207640_100144902 239
37 3300026078 Ga0207702_10151551 Ga0207702_101515512 239
38 3300044656 Ga0466969_0002120 Ga0466969_0002120_383_1135 239
39 3300044663 Ga0466989_0157495 Ga0466989_0157495_291_1043 239
40 3300044684 Ga0466966_0035950 Ga0466966_0035950_2390_3142 239
41 3300044693 Ga0466961_0002983 Ga0466961_0002983_464_1216 239
42 3300044694 Ga0466963_0180833 Ga0466963_0180833_293_1045 239
43 3300044719 Ga0466971_0089423 Ga0466971_0089423_458_1210 239
44 3300045049 Ga0466959_0003210 Ga0466959_0003210_9410_10162 239
45 3300045836 Ga0466958_0176400 Ga0466958_0176400_190_942 239
46 3300048091 Ga0495626_0000017 Ga0495626_0000017_80311_81165 239
47 3300005457 Ga0070662_100008945 Ga0070662_1000089453 242
48 3300025933 Ga0207706_10000638 Ga0207706_100006384 242
49 3300046648 Ga0495611_0002796 Ga0495611_0002796_874_1677 242
50 3300046665 Ga0495661_0127028 Ga0495661_0127028_213_1016 242
51 3300046684 Ga0495669_0006301 Ga0495669_0006301_848_1651 242
52 3300046538 Ga0495609_0001454 Ga0495609_0001454_14003_14827 243
53 3300037418 Ga0395900_0459591 Ga0395900_0459591_48_863 244
54 3300046458 Ga0495591_007411 Ga0495591_007411_3276_4082 244
55 3300046474 Ga0495605_0002967 Ga0495605_0002967_5447_6253 244
56 3300046491 Ga0495584_0020946 Ga0495584_0020946_1994_2800 244
57 3300046492 Ga0495585_0009095 Ga0495585_0009095_3357_4163 244
58 3300046500 Ga0495596_0018372 Ga0495596_0018372_1493_2299 244
59 3300046501 Ga0495607_0004723 Ga0495607_0004723_4219_5025 244
60 3300046506 Ga0495583_0005751 Ga0495583_0005751_2043_2849 244
61 3300046507 Ga0495606_0007381 Ga0495606_0007381_2627_3433 244
62 3300046513 Ga0495616_0004298 Ga0495616_0004298_2627_3433 244
63 3300046518 Ga0495631_0015919 Ga0495631_0015919_2590_3396 244
64 3300046520 Ga0495637_0008124 Ga0495637_0008124_2497_3303 244
65 3300046523 Ga0495644_0001939 Ga0495644_0001939_6160_6966 244
66 3300046528 Ga0495642_0005527 Ga0495642_0005527_553_1359 244
67 3300046538 Ga0495609_0007567 Ga0495609_0007567_4011_4817 244
68 3300046616 Ga0495668_0009617 Ga0495668_0009617_2728_3534 244
69 3300046684 Ga0495669_0012133 Ga0495669_0012133_492_1298 244
70 3300046794 Ga0495589_0020337 Ga0495589_0020337_242_1048 244
71 3300046810 Ga0495660_0005230 Ga0495660_0005230_3938_4744 244
72 3300047323 Ga0495683_0014684 Ga0495683_0014684_18_824 244
73 3300047446 Ga0495679_009243 Ga0495679_009243_424_1230 244
74 3300047447 Ga0495685_001349 Ga0495685_001349_2483_3289 244
75 3300048091 Ga0495626_0004437 Ga0495626_0004437_3820_4626 244
76 3300048913 Ga0496110_0173537 Ga0496110_0173537_483_1304 244
77 3300049459 Ga0495678_009724 Ga0495678_009724_3355_4161 244
78 3300049460 Ga0495682_0003585 Ga0495682_0003585_616_1422 244
79 3300037471 Ga0395905_0118253 Ga0395905_0118253_1313_2128 245
80 3300046616 Ga0495668_0000107 Ga0495668_0000107_77599_78393 245
81 3300046522 Ga0495643_0030613 Ga0495643_0030613_1987_2817 249
82 3300046452 Ga0495617_000009 Ga0495617_000009_249906_250673 250
83 3300046453 Ga0495627_000119 Ga0495627_000119_36021_36788 250
84 3300046474 Ga0495605_0000024 Ga0495605_0000024_172756_173523 250
85 3300046500 Ga0495596_0003383 Ga0495596_0003383_5902_6669 250
86 3300046501 Ga0495607_0033015 Ga0495607_0033015_2273_3040 250
87 3300046513 Ga0495616_0020104 Ga0495616_0020104_2820_3587 250
88 3300046518 Ga0495631_0005117 Ga0495631_0005117_4868_5635 250
89 3300046523 Ga0495644_0016228 Ga0495644_0016228_347_1114 250
90 3300046524 Ga0495648_0000475 Ga0495648_0000475_15825_16592 250
91 3300046616 Ga0495668_0000306 Ga0495668_0000306_13740_14507 250
92 3300046648 Ga0495611_0038893 Ga0495611_0038893_617_1384 250
93 3300046794 Ga0495589_0007913 Ga0495589_0007913_208_975 250
94 3300047445 Ga0495677_0010453 Ga0495677_0010453_1870_2637 250
95 3300047472 Ga0495686_0020048 Ga0495686_0020048_974_1741 250
96 3300035691 Ga0373931_0015586 Ga0373931_0015586_1173_1994 252
97 3300037471 Ga0395905_0065437 Ga0395905_0065437_70_858 252
98 3300048903 Ga0496100_0023653 Ga0496100_0023653_1076_1897 252
99 iso_pu_bacteria 2765235838 2765570762 252
100 iso_pu_bacteria 2839094727 2839098315 252
101 3300035084 Ga0373928_0039949 Ga0373928_0039949_183_1004 253
102 3300035112 Ga0373932_0005627 Ga0373932_0005627_2033_2854 253
103 3300046492 Ga0495585_0153489 Ga0495585_0153489_403_1179 253
104 3300046507 Ga0495606_0099741 Ga0495606_0099741_553_1371 253
105 3300046513 Ga0495616_0123254 Ga0495616_0123254_176_994 253
106 3300046542 Ga0495597_0000071 Ga0495597_0000071_85906_86724 253
107 3300046794 Ga0495589_0000077 Ga0495589_0000077_40000_40818 253
108 3300047320 Ga0495672_0000109 Ga0495672_0000109_101027_101854 253
109 iso_pu_bacteria 2643221644 2644243620 253
110 3300037418 Ga0395900_0026816 Ga0395900_0026816_1223_2014 254
111 3300037418 Ga0395900_0144255 Ga0395900_0144255_116_907 254
112 3300037418 Ga0395900_0186570 Ga0395900_0186570_143_925 254
113 3300037471 Ga0395905_0000125 Ga0395905_0000125_75338_76120 254
114 3300037471 Ga0395905_0010269 Ga0395905_0010269_7788_8570 254
115 3300038443 Ga0395901_0068189 Ga0395901_0068189_1445_2227 254
116 3300038443 Ga0395901_0430812 Ga0395901_0430812_546_1337 254
117 3300046500 Ga0495596_0026321 Ga0495596_0026321_1502_2296 254
118 3300005262 Ga0065165_1001101 Ga0065165_100110132 255
119 3300005367 Ga0070667_100230800 Ga0070667_1002308002 255
120 3300014325 Ga0163163_10018794 Ga0163163_100187944 255
121 3300033179 Ga0307507_10047881 Ga0307507_100478815 255
122 3300037471 Ga0395905_0065322 Ga0395905_0065322_1242_2030 255
123 3300044693 Ga0466961_0086024 Ga0466961_0086024_1090_1875 255
124 3300045049 Ga0466959_0023228 Ga0466959_0023228_2540_3325 255
125 3300046457 Ga0495590_0000008 Ga0495590_0000008_23308_24102 255
126 3300046458 Ga0495591_000043 Ga0495591_000043_93147_93941 255
127 3300046471 Ga0495650_0000322 Ga0495650_0000322_79254_80054 255
128 3300046471 Ga0495650_0014985 Ga0495650_0014985_971_1765 255
129 3300046474 Ga0495605_0061035 Ga0495605_0061035_764_1558 255
130 3300046491 Ga0495584_0000025 Ga0495584_0000025_23231_24025 255
131 3300046492 Ga0495585_0062652 Ga0495585_0062652_830_1624 255
132 3300046500 Ga0495596_0018322 Ga0495596_0018322_1128_1922 255
133 3300046501 Ga0495607_0009729 Ga0495607_0009729_4250_5044 255
134 3300046506 Ga0495583_0000512 Ga0495583_0000512_31320_32114 255
135 3300046512 Ga0495610_0002865 Ga0495610_0002865_12919_13713 255
136 3300046518 Ga0495631_0165991 Ga0495631_0165991_41_823 255
137 3300046519 Ga0495632_0010024 Ga0495632_0010024_4218_5012 255
138 3300046520 Ga0495637_0000009 Ga0495637_0000009_316233_317027 255
139 3300046523 Ga0495644_0017850 Ga0495644_0017850_1828_2622 255
140 3300046542 Ga0495597_0000960 Ga0495597_0000960_12050_12856 255
141 3300046558 Ga0495633_0001467 Ga0495633_0001467_4452_5246 255
142 3300046648 Ga0495611_0000361 Ga0495611_0000361_7570_8364 255
143 3300046665 Ga0495661_0023371 Ga0495661_0023371_3111_3905 255
144 3300046684 Ga0495669_0047989 Ga0495669_0047989_165_959 255
145 3300046694 Ga0495649_0000028 Ga0495649_0000028_118951_119745 255
146 3300046694 Ga0495649_0043912 Ga0495649_0043912_180_974 255
147 3300047320 Ga0495672_0000055 Ga0495672_0000055_93099_93893 255
148 3300047323 Ga0495683_0000047 Ga0495683_0000047_100350_101144 255
149 3300047445 Ga0495677_0000234 Ga0495677_0000234_5296_6090 255
150 3300047446 Ga0495679_016405 Ga0495679_016405_487_1281 255
151 3300047470 Ga0495681_0000016 Ga0495681_0000016_125333_126127 255
152 3300047472 Ga0495686_0002161 Ga0495686_0002161_15829_16635 255
153 3300047472 Ga0495686_0054780 Ga0495686_0054780_1176_1970 255
154 3300048091 Ga0495626_0012813 Ga0495626_0012813_2363_3157 255
155 3300048091 Ga0495626_0014831 Ga0495626_0014831_2470_3276 255
156 3300048924 Ga0496121_0005276 Ga0496121_0005276_8722_9513 255
157 3300048924 Ga0496121_0161683 Ga0496121_0161683_475_1269 255
158 3300048927 Ga0496124_0000125 Ga0496124_0000125_110324_111115 255
159 3300049459 Ga0495678_000025 Ga0495678_000025_93977_94771 255
160 3300021361 Ga0213872_10000008 Ga0213872_1000000893 256
161 3300025910 Ga0207684_10062095 Ga0207684_100620952 256
162 3300039447 Ga0436361_1054342 Ga0436361_1054342_3633_4427 256
163 3300042134 Ga0450898_037990 Ga0450898_037990_43_846 256
164 3300046473 Ga0495582_0009097 Ga0495582_0009097_426_1232 256
165 3300046491 Ga0495584_0016042 Ga0495584_0016042_2631_3437 256
166 3300046492 Ga0495585_0066840 Ga0495585_0066840_776_1582 256
167 3300046500 Ga0495596_0001710 Ga0495596_0001710_8810_9616 256
168 3300046501 Ga0495607_0048889 Ga0495607_0048889_383_1189 256
169 3300046506 Ga0495583_0039459 Ga0495583_0039459_1379_2188 256
170 3300046518 Ga0495631_0067091 Ga0495631_0067091_226_1032 256
171 3300046519 Ga0495632_0000012 Ga0495632_0000012_167211_168050 256
172 3300046523 Ga0495644_0017701 Ga0495644_0017701_10_816 256
173 3300046524 Ga0495648_0021701 Ga0495648_0021701_2233_3039 256
174 3300046528 Ga0495642_0000638 Ga0495642_0000638_11916_12722 256
175 3300046528 Ga0495642_0084867 Ga0495642_0084867_10_816 256
176 3300046530 Ga0495654_0018266 Ga0495654_0018266_682_1488 256
177 3300046558 Ga0495633_0014392 Ga0495633_0014392_3108_3914 256
178 3300046616 Ga0495668_0047834 Ga0495668_0047834_892_1698 256
179 3300046648 Ga0495611_0070483 Ga0495611_0070483_566_1372 256
180 3300046660 Ga0495625_0055916 Ga0495625_0055916_1108_1914 256
181 3300046665 Ga0495661_0004301 Ga0495661_0004301_1156_1995 256
182 3300046665 Ga0495661_0035369 Ga0495661_0035369_1237_2043 256
183 3300046684 Ga0495669_0000035 Ga0495669_0000035_41870_42676 256
184 3300046684 Ga0495669_0005372 Ga0495669_0005372_3571_4377 256
185 3300046691 Ga0495670_0160886 Ga0495670_0160886_202_1008 256
186 3300046692 Ga0495671_0000176 Ga0495671_0000176_23803_24609 256
187 3300047320 Ga0495672_0014240 Ga0495672_0014240_2914_3720 256
188 3300047323 Ga0495683_0140795 Ga0495683_0140795_277_1083 256
189 3300048089 Ga0495614_0005989 Ga0495614_0005989_3050_3856 256
190 3300048091 Ga0495626_0021663 Ga0495626_0021663_528_1334 256
191 3300048905 Ga0496102_0000158 Ga0496102_0000158_16874_17680 256
192 3300048913 Ga0496110_0000001 Ga0496110_0000001_46830_47639 256
193 3300005841 Ga0068863_100251603 Ga0068863_1002516032 257
194 3300009093 Ga0105240_10345020 Ga0105240_103450201 257
195 3300026088 Ga0207641_10554167 Ga0207641_105541672 257
196 3300039447 Ga0436361_0071320 Ga0436361_0071320_5101_5901 257
197 3300046525 Ga0495663_0036439 Ga0495663_0036439_19_810 257
198 3300046615 Ga0495656_0234516 Ga0495656_0234516_110_901 257
199 3300046674 Ga0495588_0087269 Ga0495588_0087269_415_1209 257
200 3300046684 Ga0495669_0215958 Ga0495669_0215958_112_906 257
201 3300047318 Ga0495636_0014897 Ga0495636_0014897_878_1672 257
202 3300047447 Ga0495685_017223 Ga0495685_017223_1033_1827 257
203 3300049571 Ga0501034_0475351 Ga0501034_0475351_154_957 257
204 iso_pu_bacteria 2939631187 2939636050 257
205 3300003794 Ga0055531_10000680 Ga0055531_1000068017 258
206 3300005456 Ga0070678_100025052 Ga0070678_1000250523 258
207 3300005539 Ga0068853_100487891 Ga0068853_1004878912 258
208 3300006038 Ga0075365_10006848 Ga0075365_100068482 258
209 3300006946 Ga0079104_1000003 Ga0079104_1000003278 258
210 3300009092 Ga0105250_10001577 Ga0105250_100015777 258
211 3300009093 Ga0105240_10013081 Ga0105240_100130817 258
212 3300009148 Ga0105243_10007802 Ga0105243_100078024 258
213 3300009545 Ga0105237_10002223 Ga0105237_1000222313 258
214 3300009551 Ga0105238_10164074 Ga0105238_101640742 258
215 3300010375 Ga0105239_10000470 Ga0105239_1000047042 258
216 3300025303 Ga0209051_1000346 Ga0209051_100034631 258
217 3300025304 Ga0209257_1000396 Ga0209257_100039672 258
218 3300025911 Ga0207654_10126411 Ga0207654_101264112 258
219 3300025913 Ga0207695_10013685 Ga0207695_100136854 258
220 3300025914 Ga0207671_10002553 Ga0207671_1000255312 258
221 3300025924 Ga0207694_10067457 Ga0207694_100674573 258
222 3300025935 Ga0207709_10000032 Ga0207709_10000032165 258
223 3300026041 Ga0207639_10428698 Ga0207639_104286982 258
224 3300027111 Ga0209281_1000002 Ga0209281_10000021492 258
225 3300028794 Ga0307515_10022377 Ga0307515_1002237712 258
226 3300031507 Ga0307509_10034145 Ga0307509_100341452 258
227 3300031649 Ga0307514_10001372 Ga0307514_1000137227 258
228 3300031649 Ga0307514_10047056 Ga0307514_100470562 258
229 3300037471 Ga0395905_0000416 Ga0395905_0000416_20016_20810 258
230 3300037471 Ga0395905_0060780 Ga0395905_0060780_2674_3471 258
231 3300038443 Ga0395901_0044264 Ga0395901_0044264_2820_3617 258
232 3300042876 Ga0451577_0110323 Ga0451577_0110323_775_1575 258
233 3300044658 Ga0466972_0007487 Ga0466972_0007487_2549_3370 258
234 3300049581 Ga0501047_0458849 Ga0501047_0458849_252_1049 258
235 3300050492 nmdc:mga0yw44_2817_c1 nmdc:mga0yw44_2817_c1_1491_2282 258
236 3300005338 Ga0068868_100005025 Ga0068868_10000502510 259
237 3300005563 Ga0068855_100272859 Ga0068855_1002728592 259
238 3300006038 Ga0075365_10086185 Ga0075365_100861852 259
239 3300006177 Ga0075362_10003218 Ga0075362_100032182 259
240 3300006178 Ga0075367_10003292 Ga0075367_100032927 259
241 3300006353 Ga0075370_10093180 Ga0075370_100931802 259
242 3300009174 Ga0105241_10258247 Ga0105241_102582471 259
243 3300013297 Ga0157378_10098921 Ga0157378_100989212 259
244 3300014969 Ga0157376_10001128 Ga0157376_100011285 259
245 3300025942 Ga0207689_10378874 Ga0207689_103788742 259
246 3300026023 Ga0207677_10002674 Ga0207677_1000267411 259
247 3300026023 Ga0207677_10015061 Ga0207677_100150615 259
248 3300028794 Ga0307515_10051947 Ga0307515_100519477 259
249 3300031344 Ga0265316_10062038 Ga0265316_100620382 259
250 3300031711 Ga0265314_10003235 Ga0265314_1000323510 259
251 3300045051 Ga0451576_0427439 Ga0451576_0427439_436_1254 259
252 3300046517 Ga0495630_0066319 Ga0495630_0066319_1181_2002 259
253 3300046690 Ga0495624_0013366 Ga0495624_0013366_3745_4566 259
254 3300047321 Ga0495676_0046932 Ga0495676_0046932_452_1273 259
255 3300047673 Ga0495593_0087990 Ga0495593_0087990_153_974 259
256 3300048089 Ga0495614_0035203 Ga0495614_0035203_737_1558 259
257 3300049573 Ga0501037_0059411 Ga0501037_0059411_711_1535 259
258 3300049679 Ga0501249_022288 Ga0501249_022288_288_1127 259
259 3300050492 nmdc:mga0yw44_125873_c1 nmdc:mga0yw44_125873_c1_130_939 259
260 3300050494 nmdc:mga06z11_56515_c1 nmdc:mga06z11_56515_c1_1152_1991 259
261 3300050496 nmdc:mga07m45_100712_c1 nmdc:mga07m45_100712_c1_141_980 259
262 iso_pu_bacteria 2643221570 2643868566 259
263 iso_pu_bacteria 2643221596 2643990942 259
264 iso_pu_bacteria 2643221652 2644295920 259
265 iso_pu_bacteria 2990710928 2990711536 259
266 3300003791 Ga0055530_10005234 Ga0055530_100052344 260
267 3300003791 Ga0055530_10046531 Ga0055530_100465312 260
268 3300003792 Ga0055540_1000014 Ga0055540_1000014188 260
269 3300003794 Ga0055531_10008397 Ga0055531_100083976 260
270 3300006946 Ga0079104_1000013 Ga0079104_1000013208 260
271 3300025298 Ga0209050_1001450 Ga0209050_10014508 260
272 3300025298 Ga0209050_1009152 Ga0209050_10091522 260
273 3300025303 Ga0209051_1000035 Ga0209051_1000035298 260
274 3300025304 Ga0209257_1000212 Ga0209257_1000212104 260
275 3300027111 Ga0209281_1000182 Ga0209281_100018274 260
276 3300028794 Ga0307515_10053672 Ga0307515_100536725 260
277 3300031456 Ga0307513_10000017 Ga0307513_10000017213 260
278 3300031711 Ga0265314_10058294 Ga0265314_100582942 260
279 3300031712 Ga0265342_10181884 Ga0265342_101818842 260
280 3300031730 Ga0307516_10002245 Ga0307516_1000224521 260
281 3300031730 Ga0307516_10039030 Ga0307516_100390302 260
282 3300044658 Ga0466972_0002127 Ga0466972_0002127_1395_2210 260
283 3300045049 Ga0466959_0038309 Ga0466959_0038309_1728_2540 260
284 3300003775 Ga0055524_1000167 Ga0055524_100016731 261
285 3300005336 Ga0070680_100081050 Ga0070680_1000810501 261
286 3300005530 Ga0070679_100404720 Ga0070679_1004047202 261
287 3300005563 Ga0068855_100055029 Ga0068855_1000550297 261
288 3300009093 Ga0105240_10238515 Ga0105240_102385152 261
289 3300009551 Ga0105238_10213730 Ga0105238_102137302 261
290 3300025291 Ga0209675_1007750 Ga0209675_10077502 261
291 3300025299 Ga0209256_1000356 Ga0209256_100035631 261
292 3300025921 Ga0207652_10160831 Ga0207652_101608313 261
293 3300025924 Ga0207694_10286375 Ga0207694_102863752 261
294 3300025949 Ga0207667_10181503 Ga0207667_101815032 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

192

288

0.98

PF00072

Response_reg

Response regulator receiver domain

26

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.915 5 129
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.9012 4 123
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9003 4 123
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8976 5 123
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.8966 3 131
ID Description Score Start End Superfamily
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9156 5 129 3.40.50.2300
af_Q2FVQ7_36_146_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9126 154 257 2.40.50.1020
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9059 4 90 3.40.50.2300
af_P0AFT5_129_238_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9052 154 257 2.40.50.1020
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9052 4 90 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3D4TPM5-F1-model_v4 DNA-binding response regulator 0.9722 3 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1W9QX15-F1-model_v4 Response regulatory domain-containing protein 0.9283 2 117 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7X8X120-F1-model_v4 LytTR family transcriptional regulator 0.9249 172 257 GO:0000156
GO:0003677
AF-A0A6B3CWD3-F1-model_v4 LytTR family transcriptional regulator 0.9247 159 257 GO:0000156
GO:0003677
AF-A0A1H8Q3M4-F1-model_v4 Two-component system, response regulator YesN 0.9077 4 127 GO:0000160
GO:0003700
GO:0005737
GO:0043565

Feature Viewer

pLDDT pTM Quality
85.1 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map