F392030

General Info

Members Datasets Scaffolds Average Seq Length
294 176 283 350

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000011|Ga0105240_10000011332
Length 390
Sequence VFDISHYISSLSNYRIAELNGNYPIFILSRCITLAVHEHISSMSIQNNYVAIMAGGIGSRFWPVSRTAYPKQFLDLLGTGRSLIQWTYSRFKHICPKENIYFITNEQYIQTLKQQIPEISDDNIISEPSRKNTAPCAAYFAHKMMALNPNANIIMSPADHLIMDEHSFERTTHDALDFVAHHKSLLTLGIKPTRPDTGYGYIQYDTEEELDQVYRVKTFTEKPSLELARTFLKSGDFLWEALEKYLPEMHEVFSQAKDVYNTPAEHDTIAKLYPQCTNISIDYGIMEKAKNVFVIPSYFGWCDLGTWESAYENHEKDYLGNAVFGDNVMVIDASECIIKAAPEKLVMVQGLEKFIVIDTPDVLLICERNREQQIKEYVAEVKRNKGDKFL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
8 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
9 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
10 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
11 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
106 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
161 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
170 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
171 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
175 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
176 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0.68
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 1.02
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
2 JGI24737J22298_10006886 3300001990 Bacteria 3858
3 JGI24743J22301_10016474 3300001991 Bacteria 1379
4 JGI24744J21845_10011925 3300002077 Bacteria 1769
5 JGI25162J39368_1004115 3300002737 Bacteria 3592
6 JGI25152J39213_1000647 3300002773 Bacteria 18444
7 JGI25150J39212_1000009 3300002774 Bacteria 249509
8 JGI25151J46595_10000017 3300003187 Bacteria 249509
9 JGI25165J46597_1000378 3300003214 Bacteria 48769
10 JGI25153J46596_10000023 3300003215 Bacteria 249509
11 rootH2_10028169 3300003320 Bacteria 27149
12 rootH2_10046868 3300003320 Bacteria 1697
13 rootH2_10296009 3300003320 Bacteria 1393
14 rootL2_10212684 3300003322 Bacteria 2433
15 rootH1_10010732 3300003316 Bacteria 3448
16 rootH1_10010732 3300003323 Bacteria 14229
17 rootH1_10012862 3300003323 Bacteria 52977
18 rootH1_10280022 3300003323 Bacteria 1577
19 Ga0058863_11639966 3300004799 Bacteria 2030
20 Ga0058862_12791059 3300004803 Bacteria 2137
21 Ga0065714_10003657 3300005288 Bacteria 30790
22 Ga0065714_10004769 3300005288 Bacteria 5412
23 Ga0065714_10066033 3300005288 Bacteria 7784
24 Ga0065714_10073672 3300005288 Bacteria 3137
25 Ga0065704_10070133 3300005289 Bacteria 1266035
26 Ga0065704_10094207 3300005289 Bacteria 2555
27 Ga0065704_10095601 3300005289 Bacteria 2472
28 Ga0070658_10000026 3300005327 Bacteria 171716
29 Ga0070676_10000768 3300005328 Bacteria 15786
30 Ga0070680_100012932 3300005336 Bacteria 6491
31 Ga0068868_100058499 3300005338 Bacteria 3046
32 Ga0068868_100423410 3300005338 Unclassified 1153
33 Ga0070660_100009356 3300005339 Bacteria 6886
34 Ga0070671_100040288 3300005355 Bacteria 3880
35 Ga0070673_100018869 3300005364 Bacteria 4942
36 Ga0070678_100019589 3300005456 Bacteria 4418
37 Ga0068867_100004434 3300005459 Bacteria 9869
38 Ga0070679_100003498 3300005530 Bacteria 14381
39 Ga0070684_100044242 3300005535 Bacteria 3850
40 Ga0068853_100050243 3300005539 Bacteria 3587
41 Ga0068853_100070480 3300005539 Bacteria 3043
42 Ga0070665_100005498 3300005548 Bacteria 13046
43 Ga0068855_100000042 3300005563 Bacteria 149332
44 Ga0068855_100000134 3300005563 Bacteria 94864
45 Ga0068855_100025140 3300005563 Bacteria 7129
46 Ga0068855_100492728 3300005563 Bacteria 1333
47 Ga0068857_100005686 3300005577 Bacteria 10660
48 Ga0068856_100060567 3300005614 Bacteria 3740
49 Ga0068852_100014527 3300005616 Bacteria 6067
50 Ga0068852_100109828 3300005616 Bacteria 2505
51 Ga0068861_100180142 3300005719 Bacteria 1758
52 Ga0075366_10009197 3300006195 Bacteria 5512
53 Ga0097621_100000507 3300006237 Bacteria 27254
54 Ga0068871_100000436 3300006358 Bacteria 28724
55 Ga0068865_100000580 3300006881 Bacteria 20503
56 Ga0105240_10000011 3300009093 Bacteria 523646
57 Ga0105240_10000039 3300009093 Bacteria 270117
58 Ga0105240_10029497 3300009093 Bacteria 7146
59 Ga0105240_10135823 3300009093 Bacteria 2945
60 Ga0105240_10198005 3300009093 Bacteria 2356
61 Ga0105240_10391248 3300009093 Bacteria 1568
62 Ga0114129_10000629 3300009147 Bacteria 43924
63 Ga0105241_10026872 3300009174 Bacteria 4284
64 Ga0105241_10147358 3300009174 Bacteria 1922
65 Ga0105241_10161281 3300009174 Bacteria 1843
66 Ga0105242_10031651 3300009176 Bacteria 4228
67 Ga0105237_10000193 3300009545 Bacteria 86593
68 Ga0105237_10000696 3300009545 Bacteria 46514
69 Ga0105237_10004734 3300009545 Bacteria 15649
70 Ga0105237_10006737 3300009545 Bacteria 12689
71 Ga0105237_10010364 3300009545 Bacteria 9923
72 Ga0105237_10011675 3300009545 Bacteria 9295
73 Ga0105237_10052726 3300009545 Bacteria 4082
74 Ga0105237_10118031 3300009545 Bacteria 2647
75 Ga0105237_10156398 3300009545 Bacteria 2277
76 Ga0105238_10108415 3300009551 Bacteria 2758
77 Ga0105239_10000421 3300010375 Bacteria 61717
78 Ga0105239_10001484 3300010375 Bacteria 31179
79 Ga0105239_10001802 3300010375 Bacteria 28139
80 Ga0105239_10025474 3300010375 Bacteria 6512
81 Ga0105239_10215606 3300010375 Bacteria 2152
82 Ga0157373_10000037 3300013100 Bacteria 121670
83 Ga0157373_10005191 3300013100 Bacteria 9787
84 Ga0157373_10059098 3300013100 Bacteria 2717
85 Ga0157373_10082635 3300013100 Bacteria 2264
86 Ga0157371_10000009 3300013102 Bacteria 392895
87 Ga0157371_10002257 3300013102 Bacteria 18604
88 Ga0157371_10033785 3300013102 Bacteria 3673
89 Ga0157370_10011097 3300013104 Bacteria 9444
90 Ga0157370_10031045 3300013104 Bacteria 5230
91 Ga0157370_10150101 3300013104 Bacteria 2169
92 Ga0157370_10157103 3300013104 Bacteria 2116
93 Ga0157369_10000006 3300013105 Bacteria 412230
94 Ga0157369_10029406 3300013105 Bacteria 6072
95 Ga0157369_10146847 3300013105 Bacteria 2493
96 Ga0157374_10008653 3300013296 Bacteria 8711
97 Ga0157378_10004296 3300013297 Bacteria 12548
98 Ga0163162_10000177 3300013306 Bacteria 58576
99 Ga0163162_10008070 3300013306 Bacteria 10274
100 Ga0163162_10026512 3300013306 Bacteria 5727
101 Ga0163162_10027738 3300013306 Bacteria 5600
102 Ga0157372_10000118 3300013307 Bacteria 84096
103 Ga0157372_10002422 3300013307 Bacteria 20196
104 Ga0157372_10005186 3300013307 Bacteria 13851
105 Ga0157372_10007640 3300013307 Bacteria 11499
106 Ga0157372_10190194 3300013307 Bacteria 2377
107 Ga0157375_10008239 3300013308 Bacteria 9122
108 Ga0157375_10113086 3300013308 Bacteria 2816
109 Ga0157375_10293755 3300013308 Bacteria 1788
110 Ga0182008_10000378 3300014497 Bacteria 34433
111 Ga0182008_10002723 3300014497 Bacteria 10969
112 Ga0182008_10028025 3300014497 Bacteria 2849
113 Ga0182008_10080959 3300014497 Bacteria 1598
114 Ga0182006_1000322 3300015261 Bacteria 41718
115 Ga0182006_1000382 3300015261 Bacteria 36661
116 Ga0182006_1000622 3300015261 Bacteria 25427
117 Ga0182006_1012064 3300015261 Bacteria 3785
118 Ga0182007_10000001 3300015262 Bacteria 1127301
119 Ga0182007_10029312 3300015262 Bacteria 1885
120 Ga0183373_1006 3300015682 Bacteria 328276
121 Ga0163161_10002308 3300017792 Bacteria 13670
122 Ga0163161_10023031 3300017792 Bacteria 4389
123 Ga0163161_10057925 3300017792 Bacteria 2816
124 Ga0163161_10060984 3300017792 Bacteria 2746
125 Ga0163161_10072665 3300017792 Bacteria 2519
126 Ga0207427_100217 3300025231 Bacteria 50153
127 Ga0209437_100052 3300025233 Bacteria 380548
128 Ga0207425_1000007 3300025245 Bacteria 777411
129 Ga0209026_1000316 3300025250 Bacteria 51844
130 Ga0209129_1000006 3300025258 Bacteria 777761
131 Ga0209233_1000067 3300025261 Bacteria 380554
132 Ga0209233_1005850 3300025261 Bacteria 4037
133 Ga0209455_1005415 3300025272 Bacteria 3948
134 Ga0209025_1000025 3300025294 Bacteria 524454
135 Ga0209758_1000016 3300025297 Bacteria 778557
136 Ga0207647_10000296 3300025904 Bacteria 40915
137 Ga0207647_10002291 3300025904 Bacteria 14577
138 Ga0207647_10065500 3300025904 Bacteria 2205
139 Ga0207647_10069796 3300025904 Bacteria 2124
140 Ga0207645_10000717 3300025907 Bacteria 27578
141 Ga0207705_10000040 3300025909 Bacteria 185735
142 Ga0207705_10041247 3300025909 Bacteria 3311
143 Ga0207654_10019209 3300025911 Bacteria 3603
144 Ga0207707_10038750 3300025912 Bacteria 4165
145 Ga0207695_10000010 3300025913 Bacteria 981919
146 Ga0207695_10000058 3300025913 Bacteria 366582
147 Ga0207695_10023790 3300025913 Bacteria 6914
148 Ga0207695_10025491 3300025913 Bacteria 6618
149 Ga0207671_10000150 3300025914 Bacteria 107685
150 Ga0207671_10000661 3300025914 Bacteria 44970
151 Ga0207671_10002917 3300025914 Bacteria 17625
152 Ga0207671_10007810 3300025914 Bacteria 9199
153 Ga0207671_10013297 3300025914 Bacteria 6564
154 Ga0207671_10092735 3300025914 Bacteria 2277
155 Ga0207671_10223086 3300025914 Bacteria 1477
156 Ga0207660_10043264 3300025917 Bacteria 3165
157 Ga0207657_10041412 3300025919 Bacteria 4073
158 Ga0207652_10019911 3300025921 Bacteria 5525
159 Ga0207644_10046223 3300025931 Bacteria 3100
160 Ga0207690_10023253 3300025932 Bacteria 3867
161 Ga0207704_10000081 3300025938 Bacteria 57180
162 Ga0207667_10000037 3300025949 Bacteria 297252
163 Ga0207667_10049259 3300025949 Bacteria 4451
164 Ga0207651_10041928 3300025960 Bacteria 3042
165 Ga0207639_10028005 3300026041 Bacteria 4109
166 Ga0207639_10087585 3300026041 Bacteria 2482
167 Ga0207648_10001742 3300026089 Bacteria 23812
168 Ga0207674_10045632 3300026116 Bacteria 4506
169 Ga0207674_10191479 3300026116 Bacteria 1995
170 Ga0207683_10049769 3300026121 Bacteria 3669
171 Ga0207698_10009451 3300026142 Bacteria 6220
172 Ga0207698_10204037 3300026142 Bacteria 1773
173 Ga0268266_10008587 3300028379 Bacteria 9073
174 Ga0265318_10007513 3300028577 Bacteria 4922
175 Ga0307515_10043110 3300028794 Bacteria 7028
176 Ga0265338_10001941 3300028800 Bacteria 32269
177 Ga0265338_10048416 3300028800 Bacteria 3867
178 Ga0316176_1098279 3300030732 Bacteria 44333
179 Ga0316183_1030332 3300030742 Bacteria 25507
180 Ga0265332_10002042 3300031238 Bacteria 10564
181 Ga0265339_10004917 3300031249 Bacteria 9007
182 Ga0265331_10001153 3300031250 Bacteria 20138
183 Ga0265327_10000006 3300031251 Bacteria 693716
184 Ga0265327_10000228 3300031251 Bacteria 114387
185 Ga0265316_10006845 3300031344 Bacteria 10822
186 Ga0307509_10016360 3300031507 Bacteria 8586
187 Ga0307509_10022589 3300031507 Bacteria 7087
188 Ga0307408_100000305 3300031548 Bacteria 47032
189 Ga0307408_100001747 3300031548 Bacteria 15854
190 Ga0307408_100002924 3300031548 Bacteria 11838
191 Ga0265314_10017468 3300031711 Bacteria 5631
192 Ga0265314_10041492 3300031711 Bacteria 3293
193 Ga0265342_10011623 3300031712 Bacteria 6009
194 Ga0307516_10254817 3300031730 Bacteria 1448
195 Ga0307405_10000010 3300031731 Bacteria 250978
196 Ga0307407_10000042 3300031903 Bacteria 65025
197 Ga0307412_10002525 3300031911 Bacteria 10166
198 Ga0307412_10098976 3300031911 Bacteria 2058
199 Ga0307416_100000019 3300032002 Bacteria 199706
200 Ga0307416_100121062 3300032002 Bacteria 2332
201 Ga0307414_10002353 3300032004 Bacteria 9881
202 Ga0307414_10002825 3300032004 Bacteria 9156
203 Ga0307414_10045754 3300032004 Bacteria 2999
204 Ga0307414_10099425 3300032004 Unclassified 2185
205 Ga0307414_10122252 3300032004 Bacteria 2004
206 Ga0307414_10124612 3300032004 Bacteria 1988
207 Ga0307414_10362183 3300032004 Bacteria 1248
208 Ga0307507_10000032 3300033179 Bacteria 194155
209 Ga0395899_0000002 3300037312 Bacteria 1324310
210 Ga0395899_0010361 3300037312 Bacteria 7143
211 Ga0395900_0085965 3300037418 Bacteria 3232
212 Ga0395901_0004908 3300038443 Bacteria 13498
213 Ga0395901_0500534 3300038443 Bacteria 1237
214 Ga0439436_0002695 3300041404 Bacteria 5359
215 Ga0439439_0011390 3300041406 Bacteria 2139
216 Ga0451802_1679580 3300041460 Bacteria 1712
217 Ga0439448_0003523 3300042005 Bacteria 4341
218 Ga0439449_0006899 3300042007 Bacteria 4330
219 Ga0439457_001059 3300042014 Bacteria 8314
220 Ga0439462_0000897 3300042015 Bacteria 6274
221 Ga0453684_0295407 3300044712 Unclassified 1843
222 Ga0466959_0296958 3300045049 Bacteria 1107
223 Ga0495650_0000003 3300046471 Bacteria 900730
224 Ga0495585_0000470 3300046492 Bacteria 38600
225 Ga0495583_0039023 3300046506 Bacteria 2240
226 Ga0495606_0000002 3300046507 Bacteria 554637
227 Ga0495606_0003323 3300046507 Bacteria 17173
228 Ga0495606_0051651 3300046507 Bacteria 2680
229 Ga0495606_0063840 3300046507 Bacteria 2346
230 Ga0495606_0167861 3300046507 Bacteria 1276
231 Ga0495610_0000035 3300046512 Bacteria 189683
232 Ga0495610_0000815 3300046512 Bacteria 29262
233 Ga0495610_0013940 3300046512 Bacteria 4750
234 Ga0495610_0015914 3300046512 Bacteria 4350
235 Ga0495616_0002285 3300046513 Bacteria 12816
236 Ga0495616_0002520 3300046513 Bacteria 12110
237 Ga0495648_0006903 3300046524 Bacteria 9157
238 Ga0495648_0029088 3300046524 Bacteria 3672
239 Ga0495652_0140221 3300046529 Bacteria 1902
240 Ga0495652_0145814 3300046529 Bacteria 1856
241 Ga0495609_0065201 3300046538 Bacteria 1606
242 Ga0495668_0000009 3300046616 Bacteria 492623
243 Ga0495668_0000078 3300046616 Bacteria 157809
244 Ga0495625_0000719 3300046660 Bacteria 46578
245 Ga0495625_0002020 3300046660 Bacteria 22846
246 Ga0495625_0016942 3300046660 Bacteria 5718
247 Ga0495625_0216510 3300046660 Bacteria 1257
248 Ga0495661_0001605 3300046665 Bacteria 18539
249 Ga0495661_0012528 3300046665 Bacteria 5726
250 Ga0495670_0149927 3300046691 Bacteria 1223
251 Ga0495649_0000037 3300046694 Bacteria 133848
252 Ga0495636_0000024 3300047318 Bacteria 69826
253 Ga0495687_003937 3300047443 Bacteria 10395
254 Ga0495687_018012 3300047443 Bacteria 3503
255 Ga0495686_0000210 3300047472 Bacteria 107859
256 Ga0495686_0000324 3300047472 Bacteria 79635
257 Ga0495686_0000693 3300047472 Bacteria 45522
258 Ga0495614_0053064 3300048089 Bacteria 1738
259 Ga0496114_0000619 3300048917 Bacteria 26281
260 Ga0496115_0001781 3300048918 Bacteria 15408
261 Ga0496122_0000746 3300048925 Bacteria 63466
262 Ga0496123_0011166 3300048926 Bacteria 7822
263 Ga0495678_084646 3300049459 Bacteria 1130
264 Ga0501047_0015554 3300049581 Bacteria 7250
265 Ga0501223_007811 3300049663 Bacteria 2184
266 Ga0501238_004602 3300049671 Bacteria 1729
267 Ga0501240_007453 3300049673 Unclassified 1376
268 Ga0501225_0004815 3300049705 Bacteria 3990
269 Ga0501044_0003052 3300049823 Bacteria 18942
270 nmdc:mga0k408_8382_c1 3300050493 Bacteria 5544
271 nmdc:mga07m45_68506_c1 3300050496 Bacteria 2017
272 Ga0500635_0001532 3300053080 Bacteria 5552
273 Ga0500583_0000010 3300053092 Bacteria 160546
274 Ga0500583_0003479 3300053092 Bacteria 4955
275 Ga0500641_0087431 3300053096 Bacteria 1328
276 Ga0500569_030994 3300053109 Bacteria 1501
277 Ga0500614_036017 3300053123 Bacteria 1236
278 Ga0500589_016296 3300053147 Bacteria 3331
279 Ga0500616_0001166 3300053153 Bacteria 26778
280 Ga0500616_0079574 3300053153 Unclassified 1650
281 Ga0500622_0000547 3300053156 Bacteria 34632
282 Ga0500627_0010000 3300053158 Bacteria 3442
283 Ga0500611_004657 3300053727 Bacteria 1866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0079574 Ga0500616_0079574_305_1198 260
2 3300005289 Ga0065704_10094207 Ga0065704_100942072 313
3 3300013308 Ga0157375_10113086 Ga0157375_101130862 314
4 3300048918 Ga0496115_0001781 Ga0496115_0001781_11615_12670 316
5 3300009147 Ga0114129_10000629 Ga0114129_1000062921 318
6 3300028800 Ga0265338_10001941 Ga0265338_100019416 320
7 3300049671 Ga0501238_004602 Ga0501238_004602_11_1096 320
8 3300046507 Ga0495606_0003323 Ga0495606_0003323_1701_2786 321
9 3300028577 Ga0265318_10007513 Ga0265318_100075132 322
10 3300031238 Ga0265332_10002042 Ga0265332_100020428 322
11 3300031249 Ga0265339_10004917 Ga0265339_100049174 322
12 3300031250 Ga0265331_10001153 Ga0265331_100011534 322
13 3300031344 Ga0265316_10006845 Ga0265316_100068454 322
14 3300031711 Ga0265314_10017468 Ga0265314_100174685 322
15 3300031712 Ga0265342_10011623 Ga0265342_100116236 322
16 3300046616 Ga0495668_0000078 Ga0495668_0000078_32339_33424 322
17 3300053096 Ga0500641_0087431 Ga0500641_0087431_148_1233 322
18 3300053153 Ga0500616_0001166 Ga0500616_0001166_11339_12424 322
19 3300053158 Ga0500627_0010000 Ga0500627_0010000_508_1593 322
20 iso_pu_bacteria 2738543023 2739301206 322
21 3300002773 JGI25152J39213_1000647 JGI25152J39213_100064710 326
22 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009229 326
23 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017229 326
24 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002310 326
25 3300003323 rootH1_10280022 rootH1_102800222 326
26 3300005288 Ga0065714_10003657 Ga0065714_1000365726 326
27 3300017792 Ga0163161_10023031 Ga0163161_100230312 326
28 3300017792 Ga0163161_10057925 Ga0163161_100579252 326
29 3300017792 Ga0163161_10072665 Ga0163161_100726652 326
30 3300025245 Ga0207425_1000007 Ga0207425_1000007327 326
31 3300025258 Ga0209129_1000006 Ga0209129_1000006327 326
32 3300025261 Ga0209233_1005850 Ga0209233_10058501 326
33 3300025294 Ga0209025_1000025 Ga0209025_1000025157 326
34 3300025297 Ga0209758_1000016 Ga0209758_1000016327 326
35 3300025914 Ga0207671_10092735 Ga0207671_100927352 326
36 3300028794 Ga0307515_10043110 Ga0307515_100431104 326
37 3300032004 Ga0307414_10002353 Ga0307414_100023539 326
38 3300032004 Ga0307414_10099425 Ga0307414_100994252 326
39 3300032004 Ga0307414_10124612 Ga0307414_101246122 326
40 3300032004 Ga0307414_10362183 Ga0307414_103621832 326
41 3300044712 Ga0453684_0295407 Ga0453684_0295407_579_1670 326
42 3300046507 Ga0495606_0167861 Ga0495606_0167861_192_1256 326
43 3300047443 Ga0495687_018012 Ga0495687_018012_1174_2232 326
44 3300049459 Ga0495678_084646 Ga0495678_084646_46_1104 326
45 3300049581 Ga0501047_0015554 Ga0501047_0015554_5742_6851 326
46 3300049705 Ga0501225_0004815 Ga0501225_0004815_2167_3258 326
47 3300049823 Ga0501044_0003052 Ga0501044_0003052_376_1485 326
48 3300053080 Ga0500635_0001532 Ga0500635_0001532_3966_5024 326
49 3300053092 Ga0500583_0000010 Ga0500583_0000010_63057_64166 326
50 3300053092 Ga0500583_0003479 Ga0500583_0003479_1132_2241 326
51 3300053147 Ga0500589_016296 Ga0500589_016296_1019_2128 326
52 3300053727 Ga0500611_004657 Ga0500611_004657_384_1484 326
53 3300005548 Ga0070665_100005498 Ga0070665_1000054981 327
54 3300025904 Ga0207647_10002291 Ga0207647_1000229113 327
55 3300025913 Ga0207695_10000010 Ga0207695_10000010722 327
56 3300028379 Ga0268266_10008587 Ga0268266_100085871 327
57 3300028800 Ga0265338_10048416 Ga0265338_100484163 327
58 3300031251 Ga0265327_10000006 Ga0265327_10000006145 327
59 3300031251 Ga0265327_10000228 Ga0265327_1000022850 327
60 3300045049 Ga0466959_0296958 Ga0466959_0296958_33_1088 327
61 3300047472 Ga0495686_0000324 Ga0495686_0000324_4374_5459 327
62 3300003322 rootL2_10212684 rootL2_102126843 328
63 3300003323 rootH1_10010732 rootH1_100107323 328
64 3300013307 Ga0157372_10190194 Ga0157372_101901942 328
65 3300013306 Ga0163162_10026512 Ga0163162_100265125 329
66 3300047318 Ga0495636_0000024 Ga0495636_0000024_47498_48583 329
67 iso_pu_bacteria 8055588893 8055589361 330
68 iso_pu_bacteria 2738541283 2738755052 331
69 iso_pu_bacteria 2738541284 2738760981 331
70 iso_pu_bacteria 2775506987 2776613167 331
71 iso_pu_bacteria 2842903701 2842908638 331
72 iso_pu_bacteria 2852623160 2852623513 331
73 iso_pu_bacteria 2852627209 2852631317 331
74 iso_pu_bacteria 2884933994 2884937586 331
75 iso_pu_bacteria 2902048731 2902048811 331
76 iso_pu_bacteria 2919186247 2919187244 331
77 iso_pu_bacteria 2939664404 2939665487 331
78 3300013308 Ga0157375_10008239 Ga0157375_100082393 332
79 3300047443 Ga0495687_003937 Ga0495687_003937_9134_10219 332
80 3300032004 Ga0307414_10122252 Ga0307414_101222522 333
81 3300005355 Ga0070671_100040288 Ga0070671_1000402883 334
82 3300013307 Ga0157372_10007640 Ga0157372_100076401 334
83 3300025931 Ga0207644_10046223 Ga0207644_100462231 334
84 3300031548 Ga0307408_100000305 Ga0307408_10000030527 334
85 3300031548 Ga0307408_100001747 Ga0307408_1000017477 334
86 3300031548 Ga0307408_100002924 Ga0307408_1000029244 334
87 3300031911 Ga0307412_10002525 Ga0307412_100025258 334
88 3300032002 Ga0307416_100121062 Ga0307416_1001210622 334
89 3300032004 Ga0307414_10045754 Ga0307414_100457542 334
90 3300049663 Ga0501223_007811 Ga0501223_007811_849_1931 334
91 3300049673 Ga0501240_007453 Ga0501240_007453_215_1297 334
92 3300001990 JGI24737J22298_10006886 JGI24737J22298_100068862 335
93 3300001991 JGI24743J22301_10016474 JGI24743J22301_100164741 335
94 3300002077 JGI24744J21845_10011925 JGI24744J21845_100119251 335
95 3300002737 JGI25162J39368_1004115 JGI25162J39368_10041152 335
96 3300003214 JGI25165J46597_1000378 JGI25165J46597_100037817 335
97 3300003320 rootH2_10028169 rootH2_1002816919 335
98 3300003320 rootH2_10046868 rootH2_100468682 335
99 3300003320 rootH2_10296009 rootH2_102960091 335
100 3300003323 rootH1_10012862 rootH1_100128623 335
101 3300004799 Ga0058863_11639966 Ga0058863_116399662 335
102 3300004803 Ga0058862_12791059 Ga0058862_127910593 335
103 3300005288 Ga0065714_10004769 Ga0065714_100047694 335
104 3300005288 Ga0065714_10066033 Ga0065714_100660332 335
105 3300005288 Ga0065714_10073672 Ga0065714_100736722 335
106 3300005289 Ga0065704_10095601 Ga0065704_100956012 335
107 3300005327 Ga0070658_10000026 Ga0070658_1000002632 335
108 3300005328 Ga0070676_10000768 Ga0070676_1000076812 335
109 3300005336 Ga0070680_100012932 Ga0070680_1000129325 335
110 3300005338 Ga0068868_100058499 Ga0068868_1000584991 335
111 3300005338 Ga0068868_100423410 Ga0068868_1004234101 335
112 3300005339 Ga0070660_100009356 Ga0070660_1000093563 335
113 3300005364 Ga0070673_100018869 Ga0070673_1000188692 335
114 3300005456 Ga0070678_100019589 Ga0070678_1000195893 335
115 3300005459 Ga0068867_100004434 Ga0068867_1000044348 335
116 3300005530 Ga0070679_100003498 Ga0070679_10000349813 335
117 3300005535 Ga0070684_100044242 Ga0070684_1000442425 335
118 3300005539 Ga0068853_100050243 Ga0068853_1000502432 335
119 3300005539 Ga0068853_100070480 Ga0068853_1000704802 335
120 3300005563 Ga0068855_100000042 Ga0068855_10000004267 335
121 3300005563 Ga0068855_100000134 Ga0068855_10000013425 335
122 3300005563 Ga0068855_100025140 Ga0068855_1000251402 335
123 3300005563 Ga0068855_100492728 Ga0068855_1004927281 335
124 3300005577 Ga0068857_100005686 Ga0068857_1000056863 335
125 3300005614 Ga0068856_100060567 Ga0068856_1000605674 335
126 3300005616 Ga0068852_100014527 Ga0068852_1000145273 335
127 3300005616 Ga0068852_100109828 Ga0068852_1001098281 335
128 3300005719 Ga0068861_100180142 Ga0068861_1001801422 335
129 3300006195 Ga0075366_10009197 Ga0075366_100091974 335
130 3300006237 Ga0097621_100000507 Ga0097621_10000050714 335
131 3300006358 Ga0068871_100000436 Ga0068871_10000043619 335
132 3300006881 Ga0068865_100000580 Ga0068865_10000058011 335
133 3300009093 Ga0105240_10000039 Ga0105240_10000039162 335
134 3300009093 Ga0105240_10029497 Ga0105240_100294972 335
135 3300009093 Ga0105240_10135823 Ga0105240_101358233 335
136 3300009093 Ga0105240_10198005 Ga0105240_101980052 335
137 3300009174 Ga0105241_10026872 Ga0105241_100268722 335
138 3300009174 Ga0105241_10147358 Ga0105241_101473581 335
139 3300009174 Ga0105241_10161281 Ga0105241_101612812 335
140 3300009176 Ga0105242_10031651 Ga0105242_100316512 335
141 3300009545 Ga0105237_10000193 Ga0105237_1000019312 335
142 3300009545 Ga0105237_10004734 Ga0105237_100047349 335
143 3300009545 Ga0105237_10006737 Ga0105237_100067373 335
144 3300009545 Ga0105237_10010364 Ga0105237_100103644 335
145 3300009545 Ga0105237_10011675 Ga0105237_100116754 335
146 3300009545 Ga0105237_10118031 Ga0105237_101180312 335
147 3300009545 Ga0105237_10156398 Ga0105237_101563981 335
148 3300009551 Ga0105238_10108415 Ga0105238_101084152 335
149 3300010375 Ga0105239_10000421 Ga0105239_1000042147 335
150 3300010375 Ga0105239_10001484 Ga0105239_1000148423 335
151 3300010375 Ga0105239_10025474 Ga0105239_100254743 335
152 3300010375 Ga0105239_10215606 Ga0105239_102156061 335
153 3300013100 Ga0157373_10000037 Ga0157373_1000003776 335
154 3300013100 Ga0157373_10005191 Ga0157373_100051912 335
155 3300013100 Ga0157373_10059098 Ga0157373_100590982 335
156 3300013100 Ga0157373_10082635 Ga0157373_100826351 335
157 3300013102 Ga0157371_10000009 Ga0157371_10000009330 335
158 3300013102 Ga0157371_10002257 Ga0157371_1000225716 335
159 3300013104 Ga0157370_10011097 Ga0157370_100110974 335
160 3300013104 Ga0157370_10031045 Ga0157370_100310452 335
161 3300013104 Ga0157370_10150101 Ga0157370_101501013 335
162 3300013104 Ga0157370_10157103 Ga0157370_101571032 335
163 3300013105 Ga0157369_10000006 Ga0157369_10000006356 335
164 3300013105 Ga0157369_10029406 Ga0157369_100294063 335
165 3300013105 Ga0157369_10146847 Ga0157369_101468472 335
166 3300013296 Ga0157374_10008653 Ga0157374_100086536 335
167 3300013306 Ga0163162_10000177 Ga0163162_1000017740 335
168 3300013306 Ga0163162_10008070 Ga0163162_1000807010 335
169 3300013306 Ga0163162_10027738 Ga0163162_100277384 335
170 3300013307 Ga0157372_10000118 Ga0157372_1000011876 335
171 3300013307 Ga0157372_10005186 Ga0157372_100051866 335
172 3300013308 Ga0157375_10293755 Ga0157375_102937551 335
173 3300014497 Ga0182008_10000378 Ga0182008_1000037828 335
174 3300014497 Ga0182008_10002723 Ga0182008_1000272310 335
175 3300014497 Ga0182008_10028025 Ga0182008_100280252 335
176 3300014497 Ga0182008_10080959 Ga0182008_100809591 335
177 3300015261 Ga0182006_1000322 Ga0182006_10003223 335
178 3300015261 Ga0182006_1000382 Ga0182006_100038215 335
179 3300015261 Ga0182006_1000622 Ga0182006_100062224 335
180 3300015261 Ga0182006_1012064 Ga0182006_10120643 335
181 3300015262 Ga0182007_10000001 Ga0182007_10000001305 335
182 3300015262 Ga0182007_10029312 Ga0182007_100293122 335
183 3300015682 Ga0183373_1006 Ga0183373_1006195 335
184 3300017792 Ga0163161_10002308 Ga0163161_1000230811 335
185 3300017792 Ga0163161_10060984 Ga0163161_100609842 335
186 3300025231 Ga0207427_100217 Ga0207427_10021719 335
187 3300025233 Ga0209437_100052 Ga0209437_100052283 335
188 3300025250 Ga0209026_1000316 Ga0209026_100031637 335
189 3300025261 Ga0209233_1000067 Ga0209233_1000067283 335
190 3300025272 Ga0209455_1005415 Ga0209455_10054153 335
191 3300025904 Ga0207647_10000296 Ga0207647_1000029631 335
192 3300025904 Ga0207647_10069796 Ga0207647_100697961 335
193 3300025907 Ga0207645_10000717 Ga0207645_100007172 335
194 3300025909 Ga0207705_10000040 Ga0207705_10000040106 335
195 3300025909 Ga0207705_10041247 Ga0207705_100412473 335
196 3300025911 Ga0207654_10019209 Ga0207654_100192092 335
197 3300025912 Ga0207707_10038750 Ga0207707_100387503 335
198 3300025913 Ga0207695_10000058 Ga0207695_1000005842 335
199 3300025913 Ga0207695_10023790 Ga0207695_100237905 335
200 3300025913 Ga0207695_10025491 Ga0207695_100254913 335
201 3300025914 Ga0207671_10000661 Ga0207671_1000066143 335
202 3300025914 Ga0207671_10002917 Ga0207671_100029176 335
203 3300025914 Ga0207671_10007810 Ga0207671_100078104 335
204 3300025914 Ga0207671_10013297 Ga0207671_100132972 335
205 3300025914 Ga0207671_10223086 Ga0207671_102230862 335
206 3300025917 Ga0207660_10043264 Ga0207660_100432643 335
207 3300025919 Ga0207657_10041412 Ga0207657_100414123 335
208 3300025921 Ga0207652_10019911 Ga0207652_100199113 335
209 3300025932 Ga0207690_10023253 Ga0207690_100232533 335
210 3300025938 Ga0207704_10000081 Ga0207704_100000812 335
211 3300025949 Ga0207667_10000037 Ga0207667_10000037209 335
212 3300025949 Ga0207667_10049259 Ga0207667_100492592 335
213 3300025960 Ga0207651_10041928 Ga0207651_100419282 335
214 3300026041 Ga0207639_10028005 Ga0207639_100280052 335
215 3300026041 Ga0207639_10087585 Ga0207639_100875853 335
216 3300026089 Ga0207648_10001742 Ga0207648_1000174220 335
217 3300026116 Ga0207674_10045632 Ga0207674_100456322 335
218 3300026116 Ga0207674_10191479 Ga0207674_101914792 335
219 3300026121 Ga0207683_10049769 Ga0207683_100497692 335
220 3300026142 Ga0207698_10009451 Ga0207698_100094512 335
221 3300026142 Ga0207698_10204037 Ga0207698_102040371 335
222 3300030732 Ga0316176_1098279 Ga0316176_109827926 335
223 3300030742 Ga0316183_1030332 Ga0316183_103033212 335
224 3300031507 Ga0307509_10016360 Ga0307509_100163603 335
225 3300031507 Ga0307509_10022589 Ga0307509_100225892 335
226 3300031730 Ga0307516_10254817 Ga0307516_102548171 335
227 3300031731 Ga0307405_10000010 Ga0307405_1000001043 335
228 3300031903 Ga0307407_10000042 Ga0307407_1000004239 335
229 3300031911 Ga0307412_10098976 Ga0307412_100989762 335
230 3300032002 Ga0307416_100000019 Ga0307416_10000001910 335
231 3300032004 Ga0307414_10002825 Ga0307414_100028256 335
232 3300033179 Ga0307507_10000032 Ga0307507_1000003287 335
233 3300037312 Ga0395899_0000002 Ga0395899_0000002_1082413_1083498 335
234 3300037312 Ga0395899_0010361 Ga0395899_0010361_3866_4951 335
235 3300037418 Ga0395900_0085965 Ga0395900_0085965_1650_2735 335
236 3300038443 Ga0395901_0004908 Ga0395901_0004908_10380_11465 335
237 3300038443 Ga0395901_0500534 Ga0395901_0500534_103_1188 335
238 3300041460 Ga0451802_1679580 Ga0451802_1679580_213_1304 335
239 3300042005 Ga0439448_0003523 Ga0439448_0003523_518_1603 335
240 3300046471 Ga0495650_0000003 Ga0495650_0000003_875632_876717 335
241 3300046492 Ga0495585_0000470 Ga0495585_0000470_1744_2829 335
242 3300046506 Ga0495583_0039023 Ga0495583_0039023_65_1150 335
243 3300046507 Ga0495606_0000002 Ga0495606_0000002_80056_81141 335
244 3300046507 Ga0495606_0051651 Ga0495606_0051651_827_1912 335
245 3300046507 Ga0495606_0063840 Ga0495606_0063840_1230_2315 335
246 3300046512 Ga0495610_0000035 Ga0495610_0000035_1092_2183 335
247 3300046512 Ga0495610_0000815 Ga0495610_0000815_12999_14084 335
248 3300046512 Ga0495610_0013940 Ga0495610_0013940_817_1902 335
249 3300046512 Ga0495610_0015914 Ga0495610_0015914_2168_3259 335
250 3300046513 Ga0495616_0002285 Ga0495616_0002285_4131_5216 335
251 3300046513 Ga0495616_0002520 Ga0495616_0002520_4428_5513 335
252 3300046524 Ga0495648_0006903 Ga0495648_0006903_5028_6113 335
253 3300046524 Ga0495648_0029088 Ga0495648_0029088_2218_3303 335
254 3300046529 Ga0495652_0140221 Ga0495652_0140221_11_1096 335
255 3300046529 Ga0495652_0145814 Ga0495652_0145814_66_1151 335
256 3300046538 Ga0495609_0065201 Ga0495609_0065201_28_1113 335
257 3300046616 Ga0495668_0000009 Ga0495668_0000009_157198_158283 335
258 3300046660 Ga0495625_0000719 Ga0495625_0000719_19986_21071 335
259 3300046660 Ga0495625_0002020 Ga0495625_0002020_4361_5446 335
260 3300046660 Ga0495625_0016942 Ga0495625_0016942_3773_4858 335
261 3300046660 Ga0495625_0216510 Ga0495625_0216510_62_1147 335
262 3300046665 Ga0495661_0001605 Ga0495661_0001605_6256_7341 335
263 3300046665 Ga0495661_0012528 Ga0495661_0012528_1103_2188 335
264 3300046691 Ga0495670_0149927 Ga0495670_0149927_117_1202 335
265 3300046694 Ga0495649_0000037 Ga0495649_0000037_110218_111303 335
266 3300047472 Ga0495686_0000210 Ga0495686_0000210_5486_6571 335
267 3300047472 Ga0495686_0000693 Ga0495686_0000693_28157_29242 335
268 3300048089 Ga0495614_0053064 Ga0495614_0053064_498_1583 335
269 3300048925 Ga0496122_0000746 Ga0496122_0000746_16878_17969 335
270 3300048926 Ga0496123_0011166 Ga0496123_0011166_3092_4183 335
271 3300050493 nmdc:mga0k408_8382_c1 nmdc:mga0k408_8382_c1_1029_2114 335
272 3300050496 nmdc:mga07m45_68506_c1 nmdc:mga07m45_68506_c1_49_1134 335
273 3300053109 Ga0500569_030994 Ga0500569_030994_387_1472 335
274 3300053123 Ga0500614_036017 Ga0500614_036017_136_1221 335
275 3300053156 Ga0500622_0000547 Ga0500622_0000547_20950_22035 335
276 3300013102 Ga0157371_10033785 Ga0157371_100337852 336
277 3300013307 Ga0157372_10002422 Ga0157372_1000242211 336
278 3300025904 Ga0207647_10065500 Ga0207647_100655002 336
279 3300041404 Ga0439436_0002695 Ga0439436_0002695_178_1299 336
280 3300041406 Ga0439439_0011390 Ga0439439_0011390_960_2081 336
281 3300042007 Ga0439449_0006899 Ga0439449_0006899_1262_2383 336
282 3300042014 Ga0439457_001059 Ga0439457_001059_3607_4728 336
283 3300042015 Ga0439462_0000897 Ga0439462_0000897_2947_4068 336
284 3300009093 Ga0105240_10000011 Ga0105240_10000011332 337
285 3300009093 Ga0105240_10391248 Ga0105240_103912482 337
286 3300009545 Ga0105237_10000696 Ga0105237_1000069634 337
287 3300009545 Ga0105237_10052726 Ga0105237_100527264 337
288 3300010375 Ga0105239_10001802 Ga0105239_1000180225 337
289 3300013297 Ga0157378_10004296 Ga0157378_100042968 337
290 3300025914 Ga0207671_10000150 Ga0207671_1000015085 337
291 3300031711 Ga0265314_10041492 Ga0265314_100414922 337
292 3300048917 Ga0496114_0000619 Ga0496114_0000619_23502_24617 337
293 2162886007 SwRhRL2b_contig_1759593 SwRhRL2b_0521.00009750 338
294 3300005289 Ga0065704_10070133 Ga0065704_10070133192 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22640

ManC_GMP_beta-helix

MannoseP isomerase/GMP-like beta-helix domain

326

381

0.93

PF00483

NTP_transferase

Nucleotidyl transferase

49

319

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.779 4 330
2cu2-assembly1.cif.gz_A-2 crystal structure of mannose-1-phosphate geranyltransferase from thermus thermophilus hb8 0.7599 4 330
2x5s-assembly1.cif.gz_B crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. 0.7511 7 329
2x5s-assembly1.cif.gz_B crystal structure of t. maritima gdp-mannose pyrophosphorylase in apo state. 0.7285 7 329
2qh5-assembly1.cif.gz_A crystal structure of mannose-6-phosphate isomerase from helicobacter pylori 0.7103 5 250
ID Description Score Start End Superfamily
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.779 4 330 3.90.550.10
2cu2A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7599 4 330 3.90.550.10
af_P24174_4_358_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7578 4 332 3.90.550.10
2x5sB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7511 7 329 3.90.550.10
af_P24174_4_358_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7379 4 332 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3B8W2Y5-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.954 5 145 GO:0004475
GO:0009298
AF-A0A1Z9MGK4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9474 5 129 GO:0004475
GO:0009298
AF-A0A6L6DEK5-F1-model_v4 NTP transferase domain-containing protein 0.9456 3 147 GO:0004475
GO:0009298
AF-A0A1Z9D8F3-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9414 5 135 GO:0004475
GO:0009298
AF-A0A1H0WR30-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9413 1 129 GO:0004475
GO:0009298

Feature Viewer

pLDDT pTM Quality
83.5 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map