F391917

General Info

Members Datasets Scaffolds Average Seq Length
294 210 588 184

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100119778|Ga0070689_1001197783
Length 204
Sequence MSRIAPAEPPYQPAIAKALNRIMPPGVEPLALFRTMARSPRVFDKMFAGGLLDKGPLSLRQREIVIDRTTARLGCEYEWGVHIAFFAAKVGFGEAEIAATVAGPPDAACWSAPEQALVALVDDLVDQRTIAEDTWTALAAHFDEAQILEAIALTGYYHTISFLCRGLSLPLETWSARFPAPAPAGRRQDPRTPSXHPPASRPTP

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
185 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
207 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
208 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
209 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
210 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0.34
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.65
Nodule 2.04
Rhizoplane 1.7
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100119778 3300005340 Bacteria 2101
2 JGI25406J46586_10026068 3300003203 Bacteria 2260
3 JGI25406J46586_10044991 3300003203 Bacteria 1524
4 Ga0055524_1000233 3300003775 Bacteria 58967
5 Ga0055530_10000758 3300003791 Bacteria 26817
6 Ga0055540_1000080 3300003792 Bacteria 111063
7 Ga0055531_10006303 3300003794 Bacteria 6758
8 JGI25405J52794_10028603 3300003911 Bacteria 1151
9 Ga0065712_10069660 3300005290 Bacteria 6915
10 Ga0070658_10001100 3300005327 Bacteria 23029
11 Ga0070676_10171517 3300005328 Bacteria 1404
12 Ga0070683_100187891 3300005329 Bacteria 1961
13 Ga0070680_100001138 3300005336 Bacteria 19076
14 Ga0068868_100580987 3300005338 Bacteria 991
15 Ga0070689_100082469 3300005340 Bacteria 2526
16 Ga0070691_10003291 3300005341 Bacteria 7240
17 Ga0070661_100048175 3300005344 Bacteria 3119
18 Ga0070675_100358745 3300005354 Bacteria 1294
19 Ga0070671_100625659 3300005355 Bacteria 931
20 Ga0070674_100614790 3300005356 Bacteria 920
21 Ga0070714_101021047 3300005435 Unclassified 805
22 Ga0070698_100037026 3300005471 Bacteria 5032
23 Ga0070699_100029858 3300005518 Bacteria 4702
24 Ga0070679_100021483 3300005530 Bacteria 6301
25 Ga0070684_100024372 3300005535 Bacteria 5075
26 Ga0070697_100021576 3300005536 Bacteria 5104
27 Ga0068853_100516674 3300005539 Bacteria 1129
28 Ga0070665_100003659 3300005548 Bacteria 16287
29 Ga0070665_100055234 3300005548 Bacteria 3983
30 Ga0070665_100641489 3300005548 Bacteria 1075
31 Ga0070704_100035510 3300005549 Bacteria 3389
32 Ga0068855_100074496 3300005563 Bacteria 3942
33 Ga0068855_100803674 3300005563 Bacteria 999
34 Ga0070664_100074780 3300005564 Bacteria 2908
35 Ga0070664_100516277 3300005564 Unclassified 1102
36 Ga0068857_100016904 3300005577 Bacteria 6392
37 Ga0068856_100122572 3300005614 Bacteria 2602
38 Ga0068856_100123346 3300005614 Bacteria 2593
39 Ga0068852_100018894 3300005616 Bacteria 5442
40 Ga0068859_100246980 3300005617 Bacteria 1874
41 Ga0068859_100288967 3300005617 Bacteria 1732
42 Ga0068859_100428839 3300005617 Bacteria 1418
43 Ga0068864_101027088 3300005618 Bacteria 818
44 Ga0068861_100119399 3300005719 Bacteria 2125
45 Ga0068858_100494781 3300005842 Bacteria 1181
46 Ga0068858_100670404 3300005842 Bacteria 1008
47 Ga0068858_101314483 3300005842 Bacteria 712
48 Ga0068860_100239903 3300005843 Bacteria 1763
49 Ga0081455_10000870 3300005937 Bacteria 38987
50 Ga0081455_10001357 3300005937 Bacteria 30275
51 Ga0081455_10060388 3300005937 Bacteria 3196
52 Ga0081540_1126818 3300005983 Bacteria 1049
53 Ga0081539_10001002 3300005985 Bacteria 52454
54 Ga0081539_10010747 3300005985 Bacteria 7375
55 Ga0075365_10014198 3300006038 Bacteria 4786
56 Ga0075365_10283949 3300006038 Bacteria 1165
57 Ga0075365_10354182 3300006038 Bacteria 1035
58 Ga0075432_10190490 3300006058 Bacteria 807
59 Ga0075362_10160435 3300006177 Bacteria 1082
60 Ga0075362_10416811 3300006177 Bacteria 679
61 Ga0075367_10048964 3300006178 Bacteria 2491
62 Ga0075367_10220992 3300006178 Bacteria 1185
63 Ga0075369_10001393 3300006186 Bacteria 8249
64 Ga0075369_10010527 3300006186 Bacteria 3618
65 Ga0075369_10042674 3300006186 Bacteria 1945
66 Ga0075366_10003250 3300006195 Bacteria 8541
67 Ga0075366_10126897 3300006195 Bacteria 1539
68 Ga0075366_10327433 3300006195 Bacteria 939
69 Ga0075370_10076171 3300006353 Bacteria 1924
70 Ga0075431_100167675 3300006847 Bacteria 2257
71 Ga0075433_10000084 3300006852 Bacteria 42978
72 Ga0075434_100023144 3300006871 Bacteria 6051
73 Ga0075429_100012724 3300006880 Bacteria 7301
74 Ga0097620_100246992 3300006931 Bacteria 1874
75 Ga0079104_1000267 3300006946 Bacteria 68733
76 Ga0105240_10004414 3300009093 Bacteria 21456
77 Ga0105240_10049816 3300009093 Bacteria 5284
78 Ga0111539_10249455 3300009094 Bacteria 2067
79 Ga0111539_11041765 3300009094 Bacteria 951
80 Ga0114129_10008644 3300009147 Bacteria 14517
81 Ga0114129_10177369 3300009147 Bacteria 2902
82 Ga0105242_10883865 3300009176 Unclassified 892
83 Ga0105242_11001800 3300009176 Bacteria 843
84 Ga0105248_10012884 3300009177 Bacteria 9221
85 Ga0105248_10071881 3300009177 Unclassified 3887
86 Ga0105248_10340482 3300009177 Bacteria 1689
87 Ga0105237_10197384 3300009545 Bacteria 2012
88 Ga0105035_105153 3300009988 Bacteria 1053
89 Ga0105239_10278321 3300010375 Bacteria 1883
90 Ga0105239_11888297 3300010375 Bacteria 693
91 Ga0105246_10371888 3300011119 Bacteria 1178
92 Ga0157370_10504434 3300013104 Bacteria 1111
93 Ga0157369_10273200 3300013105 Bacteria 1761
94 Ga0157378_10747800 3300013297 Bacteria 1000
95 Ga0163163_10007830 3300014325 Bacteria 9446
96 Ga0157379_10018374 3300014968 Bacteria 6164
97 Ga0157379_10042162 3300014968 Bacteria 4074
98 Ga0157379_11433449 3300014968 Bacteria 670
99 Ga0157376_10184728 3300014969 Bacteria 1908
100 Ga0206353_10685292 3300020082 Bacteria 2114
101 Ga0228598_1019983 3300024227 Bacteria 1319
102 Ga0209565_1010558 3300025263 Bacteria 2284
103 Ga0209675_1019978 3300025291 Bacteria 1828
104 Ga0209050_1002321 3300025298 Bacteria 16737
105 Ga0209256_1000203 3300025299 Bacteria 112500
106 Ga0207426_1050360 3300025302 Bacteria 1242
107 Ga0209051_1000035 3300025303 Bacteria 346999
108 Ga0209257_1000346 3300025304 Bacteria 95662
109 Ga0207645_10113685 3300025907 Bacteria 1754
110 Ga0207705_10004049 3300025909 Bacteria 11138
111 Ga0207684_10035757 3300025910 Bacteria 4217
112 Ga0207684_10069240 3300025910 Bacteria 2999
113 Ga0207707_10017237 3300025912 Bacteria 6295
114 Ga0207695_10030532 3300025913 Bacteria 5931
115 Ga0207695_10148580 3300025913 Bacteria 2284
116 Ga0207671_10235181 3300025914 Bacteria 1438
117 Ga0207693_10169654 3300025915 Bacteria 1718
118 Ga0207660_10059296 3300025917 Bacteria 2747
119 Ga0207657_10080691 3300025919 Bacteria 2734
120 Ga0207649_10050165 3300025920 Bacteria 2580
121 Ga0207652_10002795 3300025921 Bacteria 14640
122 Ga0207681_10776504 3300025923 Bacteria 800
123 Ga0207694_10176422 3300025924 Bacteria 1732
124 Ga0207659_10596742 3300025926 Bacteria 941
125 Ga0207690_11018629 3300025932 Bacteria 689
126 Ga0207670_11088799 3300025936 Bacteria 674
127 Ga0207704_10122493 3300025938 Bacteria 1783
128 Ga0207711_10030754 3300025941 Unclassified 4529
129 Ga0207711_10972923 3300025941 Bacteria 788
130 Ga0207711_10988171 3300025941 Bacteria 781
131 Ga0207661_10125612 3300025944 Bacteria 2190
132 Ga0207679_10003441 3300025945 Bacteria 9767
133 Ga0207667_10016525 3300025949 Bacteria 8336
134 Ga0207667_10061599 3300025949 Bacteria 3925
135 Ga0207658_10201818 3300025986 Bacteria 1661
136 Ga0207658_10239866 3300025986 Bacteria 1535
137 Ga0207703_10017633 3300026035 Bacteria 5572
138 Ga0207703_10170857 3300026035 Bacteria 1912
139 Ga0207703_10327383 3300026035 Bacteria 1405
140 Ga0207639_10447242 3300026041 Bacteria 1172
141 Ga0207702_10096552 3300026078 Bacteria 2599
142 Ga0207702_10223500 3300026078 Bacteria 1755
143 Ga0207674_10010621 3300026116 Bacteria 10414
144 Ga0207698_10020199 3300026142 Bacteria 4579
145 Ga0209281_1000076 3300027111 Bacteria 263350
146 Ga0268266_10056272 3300028379 Bacteria 3383
147 Ga0268266_10074490 3300028379 Bacteria 2948
148 Ga0268266_10075995 3300028379 Bacteria 2918
149 Ga0268266_10781041 3300028379 Bacteria 922
150 Ga0268264_10201381 3300028381 Bacteria 1822
151 Ga0265334_10022820 3300028573 Bacteria 2547
152 Ga0265340_10029363 3300031247 Bacteria 2762
153 Ga0307408_100554179 3300031548 Bacteria 1015
154 Ga0307408_100566161 3300031548 Bacteria 1005
155 Ga0316579_10272471 3300031691 Unclassified 818
156 Ga0265342_10344151 3300031712 Bacteria 778
157 Ga0307411_11395947 3300032005 Bacteria 641
158 Ga0307415_100389575 3300032126 Bacteria 1186
159 Ga0373940_0078283 3300035088 Bacteria 973
160 Ga0373944_0039283 3300035089 Unclassified 1457
161 Ga0373923_0116078 3300035111 Bacteria 1192
162 Ga0373932_0101203 3300035112 Bacteria 938
163 Ga0373936_0131993 3300035113 Bacteria 1074
164 Ga0373954_0240398 3300035118 Bacteria 891
165 Ga0373957_0194672 3300035120 Bacteria 843
166 Ga0373943_0022605 3300035170 Bacteria 2916
167 Ga0373955_0233491 3300035172 Bacteria 1101
168 Ga0373955_0408746 3300035172 Bacteria 825
169 Ga0373942_0016191 3300035207 Bacteria 1827
170 Ga0373924_0137365 3300035410 Bacteria 1065
171 Ga0373935_0148525 3300035692 Bacteria 1589
172 Ga0373935_0148965 3300035692 Bacteria 1586
173 Ga0373935_0765861 3300035692 Bacteria 712
174 Ga0373927_0107945 3300035695 Bacteria 1813
175 Ga0373927_0459546 3300035695 Bacteria 841
176 Ga0373937_0019672 3300036401 Bacteria 6046
177 Ga0373937_0117513 3300036401 Bacteria 2477
178 Ga0373937_0422059 3300036401 Bacteria 1266
179 Ga0373925_0183122 3300037068 Bacteria 1659
180 Ga0373925_0514959 3300037068 Bacteria 983
181 Ga0373925_1025992 3300037068 Bacteria 679
182 Ga0395899_0043398 3300037312 Bacteria 3354
183 Ga0395900_0006685 3300037418 Bacteria 11982
184 Ga0395900_0061123 3300037418 Bacteria 3874
185 Ga0395898_1176395 3300037466 Bacteria 698
186 Ga0395905_0190136 3300037471 Bacteria 1926
187 Ga0395901_0034241 3300038443 Bacteria 5245
188 Ga0395901_0082293 3300038443 Bacteria 3363
189 Ga0436361_0858389 3300039447 Bacteria 1607
190 Ga0439448_0036496 3300042005 Bacteria 1577
191 Ga0439455_0109715 3300042012 Bacteria 767
192 Ga0495592_0694664 3300046454 Bacteria 612
193 Ga0495629_0141590 3300046459 Bacteria 1673
194 Ga0495651_0341242 3300046462 Bacteria 992
195 Ga0495653_0168793 3300046463 Bacteria 1512
196 Ga0495582_0061219 3300046473 Bacteria 2078
197 Ga0495582_0243947 3300046473 Bacteria 1030
198 Ga0495639_0266734 3300046475 Bacteria 849
199 Ga0495664_0090989 3300046477 Bacteria 1834
200 Ga0495584_0367144 3300046491 Bacteria 731
201 Ga0495608_0024877 3300046511 Bacteria 4090
202 Ga0495618_0064745 3300046514 Bacteria 2323
203 Ga0495628_0226516 3300046516 Bacteria 1402
204 Ga0495628_0562494 3300046516 Bacteria 818
205 Ga0495630_0139180 3300046517 Bacteria 1845
206 Ga0495652_0454349 3300046529 Bacteria 896
207 Ga0495640_0088191 3300046533 Bacteria 2051
208 Ga0495587_0058495 3300046536 Bacteria 2264
209 Ga0495645_0220240 3300046543 Bacteria 1277
210 Ga0495656_0431105 3300046615 Bacteria 693
211 Ga0495634_0030610 3300046642 Bacteria 3716
212 Ga0495635_0083686 3300046663 Bacteria 2183
213 Ga0495635_0102881 3300046663 Bacteria 1952
214 Ga0495659_0101825 3300046664 Bacteria 1113
215 Ga0495657_0491113 3300046675 Bacteria 716
216 Ga0495599_0015510 3300046678 Bacteria 4730
217 Ga0495599_0181011 3300046678 Bacteria 1299
218 Ga0495623_0074401 3300046679 Bacteria 2111
219 Ga0495646_0224085 3300046680 Bacteria 1015
220 Ga0495613_0354661 3300046689 Bacteria 1007
221 Ga0495624_0075926 3300046690 Bacteria 2086
222 Ga0495600_0019268 3300046809 Bacteria 4356
223 Ga0495581_0063418 3300047315 Bacteria 2135
224 Ga0495604_0377210 3300047317 Bacteria 937
225 Ga0495674_0009728 3300047319 Bacteria 9128
226 Ga0495674_0143295 3300047319 Bacteria 2007
227 Ga0495674_0809762 3300047319 Bacteria 728
228 Ga0495680_0210302 3300047322 Bacteria 1393
229 Ga0495680_0376853 3300047322 Bacteria 983
230 Ga0495680_0379086 3300047322 Unclassified 980
231 Ga0495675_0105530 3300047444 Bacteria 1761
232 Ga0495684_0056021 3300047471 Bacteria 3006
233 Ga0495602_0163065 3300048088 Bacteria 1738
234 Ga0495602_0364417 3300048088 Bacteria 1039
235 Ga0496104_0303307 3300048907 Bacteria 1509
236 Ga0496106_0134203 3300048909 Unclassified 1943
237 Ga0496112_0016356 3300048915 Bacteria 6947
238 Ga0496113_1011464 3300048916 Bacteria 654
239 Ga0496114_0053536 3300048917 Bacteria 3364
240 Ga0496126_0057019 3300048929 Bacteria 3529
241 Ga0501034_0000826 3300049571 Bacteria 46024
242 Ga0501034_0008942 3300049571 Bacteria 10531
243 Ga0501034_0063486 3300049571 Bacteria 3707
244 Ga0501034_0394848 3300049571 Bacteria 1307
245 Ga0501034_1047654 3300049571 Bacteria 698
246 Ga0501037_0298636 3300049573 Bacteria 1119
247 Ga0501047_0386074 3300049581 Bacteria 1234
248 Ga0501068_0008166 3300049584 Bacteria 5816
249 Ga0501070_0463993 3300049586 Bacteria 1020
250 Ga0501072_0169044 3300049588 Bacteria 1745
251 Ga0501252_001684 3300049682 Bacteria 2091
252 Ga0501259_080567 3300049688 Bacteria 715
253 Ga0501044_0137157 3300049823 Bacteria 2437
254 nmdc:mga03683_187297_c1 3300050489 Unclassified 946
255 nmdc:mga03683_283938_c1 3300050489 Bacteria 774
256 nmdc:mga03683_59833_c1 3300050489 Bacteria 1608
257 nmdc:mga03683_7711_c1 3300050489 Bacteria 3751
258 nmdc:mga03683_7809_c1 3300050489 Bacteria 1742
259 nmdc:mga03n38_769846_c1 3300050490 Bacteria 559
260 nmdc:mga00v17_220743_c1 3300050491 Bacteria 881
261 nmdc:mga00v17_82819_c1 3300050491 Bacteria 2005
262 nmdc:mga00v17_841912_c1 3300050491 Bacteria 583
263 nmdc:mga0yw44_43806_c1 3300050492 Bacteria 2674
264 nmdc:mga0yw44_8722_c1 3300050492 Bacteria 5071
265 nmdc:mga06z11_219073_c1 3300050494 Unclassified 1111
266 nmdc:mga06z11_38930_c1 3300050494 Bacteria 2364
267 nmdc:mga06z11_66503_c1 3300050494 Bacteria 1895
268 nmdc:mga05p37_386778_c1 3300050507 Bacteria 1637
269 nmdc:mga05p37_65327_c1 3300050507 Bacteria 4477
270 nmdc:mga09592_5387_c1 3300050508 Bacteria 10406
271 nmdc:mga06r32_161713_c1 3300050510 Bacteria 2221
272 nmdc:mga08y16_1083028_c1 3300050511 Bacteria 777
273 nmdc:mga08y16_381613_c1 3300050511 Bacteria 1444
274 nmdc:mga08y16_390913_c1 3300050511 Bacteria 1425
275 nmdc:mga0n895_12021_c1 3300050512 Bacteria 7748
276 nmdc:mga0a205_91621_c1 3300050515 Bacteria 2938
277 nmdc:mga0sz30_17530_c1 3300050516 Bacteria 2856
278 nmdc:mga0sz30_46239_c1 3300050516 Bacteria 1837
279 nmdc:mga0sz30_823_c1 3300050516 Bacteria 11210
280 Ga0495601_0081727 3300053077 Bacteria 2074
281 Ga0495601_0507743 3300053077 Bacteria 777
282 Ga0495612_0302372 3300053078 Bacteria 717
283 Ga0495612_0356278 3300053078 Bacteria 661
284 Ga0495595_0129540 3300053084 Bacteria 1232
285 Ga0495619_0008913 3300053085 Bacteria 6335
286 Ga0495619_0009901 3300053085 Bacteria 6007
287 Ga0500641_0003156 3300053096 Bacteria 5839
288 Ga0500616_0001578 3300053153 Bacteria 21281
289 Ga0500636_0064057 3300053177 Bacteria 2142
290 Ga0500552_001503 3300053733 Bacteria 2230
291 2524466718 2524023210 Bacteria 9029266
292 2932818194 2932809354 Bacteria 9135765
293 8016619367 8016613128 Bacteria 8794220
294 8016636926 8016630954 Bacteria 9217207
295 Ga0070689_100119778
296 JGI25406J46586_10026068
297 JGI25406J46586_10044991
298 Ga0055524_1000233
299 Ga0055530_10000758
300 Ga0055540_1000080
301 Ga0055531_10006303
302 JGI25405J52794_10028603
303 Ga0065712_10069660
304 Ga0070658_10001100
305 Ga0070676_10171517
306 Ga0070683_100187891
307 Ga0070680_100001138
308 Ga0068868_100580987
309 Ga0070689_100082469
310 Ga0070691_10003291
311 Ga0070661_100048175
312 Ga0070675_100358745
313 Ga0070671_100625659
314 Ga0070674_100614790
315 Ga0070714_101021047
316 Ga0070698_100037026
317 Ga0070699_100029858
318 Ga0070679_100021483
319 Ga0070684_100024372
320 Ga0070697_100021576
321 Ga0068853_100516674
322 Ga0070665_100003659
323 Ga0070665_100055234
324 Ga0070665_100641489
325 Ga0070704_100035510
326 Ga0068855_100074496
327 Ga0068855_100803674
328 Ga0070664_100074780
329 Ga0070664_100516277
330 Ga0068857_100016904
331 Ga0068856_100122572
332 Ga0068856_100123346
333 Ga0068852_100018894
334 Ga0068859_100246980
335 Ga0068859_100288967
336 Ga0068859_100428839
337 Ga0068864_101027088
338 Ga0068861_100119399
339 Ga0068858_100494781
340 Ga0068858_100670404
341 Ga0068858_101314483
342 Ga0068860_100239903
343 Ga0081455_10000870
344 Ga0081455_10001357
345 Ga0081455_10060388
346 Ga0081540_1126818
347 Ga0081539_10001002
348 Ga0081539_10010747
349 Ga0075365_10014198
350 Ga0075365_10283949
351 Ga0075365_10354182
352 Ga0075432_10190490
353 Ga0075362_10160435
354 Ga0075362_10416811
355 Ga0075367_10048964
356 Ga0075367_10220992
357 Ga0075369_10001393
358 Ga0075369_10010527
359 Ga0075369_10042674
360 Ga0075366_10003250
361 Ga0075366_10126897
362 Ga0075366_10327433
363 Ga0075370_10076171
364 Ga0075431_100167675
365 Ga0075433_10000084
366 Ga0075434_100023144
367 Ga0075429_100012724
368 Ga0097620_100246992
369 Ga0079104_1000267
370 Ga0105240_10004414
371 Ga0105240_10049816
372 Ga0111539_10249455
373 Ga0111539_11041765
374 Ga0114129_10008644
375 Ga0114129_10177369
376 Ga0105242_10883865
377 Ga0105242_11001800
378 Ga0105248_10012884
379 Ga0105248_10071881
380 Ga0105248_10340482
381 Ga0105237_10197384
382 Ga0105035_105153
383 Ga0105239_10278321
384 Ga0105239_11888297
385 Ga0105246_10371888
386 Ga0157370_10504434
387 Ga0157369_10273200
388 Ga0157378_10747800
389 Ga0163163_10007830
390 Ga0157379_10018374
391 Ga0157379_10042162
392 Ga0157379_11433449
393 Ga0157376_10184728
394 Ga0206353_10685292
395 Ga0228598_1019983
396 Ga0209565_1010558
397 Ga0209675_1019978
398 Ga0209050_1002321
399 Ga0209256_1000203
400 Ga0207426_1050360
401 Ga0209051_1000035
402 Ga0209257_1000346
403 Ga0207645_10113685
404 Ga0207705_10004049
405 Ga0207684_10035757
406 Ga0207684_10069240
407 Ga0207707_10017237
408 Ga0207695_10030532
409 Ga0207695_10148580
410 Ga0207671_10235181
411 Ga0207693_10169654
412 Ga0207660_10059296
413 Ga0207657_10080691
414 Ga0207649_10050165
415 Ga0207652_10002795
416 Ga0207681_10776504
417 Ga0207694_10176422
418 Ga0207659_10596742
419 Ga0207690_11018629
420 Ga0207670_11088799
421 Ga0207704_10122493
422 Ga0207711_10030754
423 Ga0207711_10972923
424 Ga0207711_10988171
425 Ga0207661_10125612
426 Ga0207679_10003441
427 Ga0207667_10016525
428 Ga0207667_10061599
429 Ga0207658_10201818
430 Ga0207658_10239866
431 Ga0207703_10017633
432 Ga0207703_10170857
433 Ga0207703_10327383
434 Ga0207639_10447242
435 Ga0207702_10096552
436 Ga0207702_10223500
437 Ga0207674_10010621
438 Ga0207698_10020199
439 Ga0209281_1000076
440 Ga0268266_10056272
441 Ga0268266_10074490
442 Ga0268266_10075995
443 Ga0268266_10781041
444 Ga0268264_10201381
445 Ga0265334_10022820
446 Ga0265340_10029363
447 Ga0307408_100554179
448 Ga0307408_100566161
449 Ga0316579_10272471
450 Ga0265342_10344151
451 Ga0307411_11395947
452 Ga0307415_100389575
453 Ga0373940_0078283
454 Ga0373944_0039283
455 Ga0373923_0116078
456 Ga0373932_0101203
457 Ga0373936_0131993
458 Ga0373954_0240398
459 Ga0373957_0194672
460 Ga0373943_0022605
461 Ga0373955_0233491
462 Ga0373955_0408746
463 Ga0373942_0016191
464 Ga0373924_0137365
465 Ga0373935_0148525
466 Ga0373935_0148965
467 Ga0373935_0765861
468 Ga0373927_0107945
469 Ga0373927_0459546
470 Ga0373937_0019672
471 Ga0373937_0117513
472 Ga0373937_0422059
473 Ga0373925_0183122
474 Ga0373925_0514959
475 Ga0373925_1025992
476 Ga0395899_0043398
477 Ga0395900_0006685
478 Ga0395900_0061123
479 Ga0395898_1176395
480 Ga0395905_0190136
481 Ga0395901_0034241
482 Ga0395901_0082293
483 Ga0436361_0858389
484 Ga0439448_0036496
485 Ga0439455_0109715
486 Ga0495592_0694664
487 Ga0495629_0141590
488 Ga0495651_0341242
489 Ga0495653_0168793
490 Ga0495582_0061219
491 Ga0495582_0243947
492 Ga0495639_0266734
493 Ga0495664_0090989
494 Ga0495584_0367144
495 Ga0495608_0024877
496 Ga0495618_0064745
497 Ga0495628_0226516
498 Ga0495628_0562494
499 Ga0495630_0139180
500 Ga0495652_0454349
501 Ga0495640_0088191
502 Ga0495587_0058495
503 Ga0495645_0220240
504 Ga0495656_0431105
505 Ga0495634_0030610
506 Ga0495635_0083686
507 Ga0495635_0102881
508 Ga0495659_0101825
509 Ga0495657_0491113
510 Ga0495599_0015510
511 Ga0495599_0181011
512 Ga0495623_0074401
513 Ga0495646_0224085
514 Ga0495613_0354661
515 Ga0495624_0075926
516 Ga0495600_0019268
517 Ga0495581_0063418
518 Ga0495604_0377210
519 Ga0495674_0009728
520 Ga0495674_0143295
521 Ga0495674_0809762
522 Ga0495680_0210302
523 Ga0495680_0376853
524 Ga0495680_0379086
525 Ga0495675_0105530
526 Ga0495684_0056021
527 Ga0495602_0163065
528 Ga0495602_0364417
529 Ga0496104_0303307
530 Ga0496106_0134203
531 Ga0496112_0016356
532 Ga0496113_1011464
533 Ga0496114_0053536
534 Ga0496126_0057019
535 Ga0501034_0000826
536 Ga0501034_0008942
537 Ga0501034_0063486
538 Ga0501034_0394848
539 Ga0501034_1047654
540 Ga0501037_0298636
541 Ga0501047_0386074
542 Ga0501068_0008166
543 Ga0501070_0463993
544 Ga0501072_0169044
545 Ga0501252_001684
546 Ga0501259_080567
547 Ga0501044_0137157
548 nmdc:mga03683_187297_c1
549 nmdc:mga03683_283938_c1
550 nmdc:mga03683_59833_c1
551 nmdc:mga03683_7711_c1
552 nmdc:mga03683_7809_c1
553 nmdc:mga03n38_769846_c1
554 nmdc:mga00v17_220743_c1
555 nmdc:mga00v17_82819_c1
556 nmdc:mga00v17_841912_c1
557 nmdc:mga0yw44_43806_c1
558 nmdc:mga0yw44_8722_c1
559 nmdc:mga06z11_219073_c1
560 nmdc:mga06z11_38930_c1
561 nmdc:mga06z11_66503_c1
562 nmdc:mga05p37_386778_c1
563 nmdc:mga05p37_65327_c1
564 nmdc:mga09592_5387_c1
565 nmdc:mga06r32_161713_c1
566 nmdc:mga08y16_1083028_c1
567 nmdc:mga08y16_381613_c1
568 nmdc:mga08y16_390913_c1
569 nmdc:mga0n895_12021_c1
570 nmdc:mga0a205_91621_c1
571 nmdc:mga0sz30_17530_c1
572 nmdc:mga0sz30_46239_c1
573 nmdc:mga0sz30_823_c1
574 Ga0495601_0081727
575 Ga0495601_0507743
576 Ga0495612_0302372
577 Ga0495612_0356278
578 Ga0495595_0129540
579 Ga0495619_0008913
580 Ga0495619_0009901
581 Ga0500641_0003156
582 Ga0500616_0001578
583 Ga0500636_0064057
584 Ga0500552_001503
585 2524466718
586 2932818194
587 8016619367
588 8016636926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

39

123

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.884 39 169
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8828 36 172
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8692 2 174
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8691 1 178
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8663 2 173
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9021 36 172 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8698 38 169 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8523 36 162 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8479 36 177 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8435 57 174 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A640JU83-F1-model_v4 deleted 0.9853 30 180
AF-A0A3S0GSG8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9846 2 180 GO:0051920
AF-A0A1G6YU01-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.984 1 178 GO:0051920
AF-A0A0E4CNQ8-F1-model_v4 Carboxymuconolactone decarboxylase 0.9835 2 178 GO:0051920
AF-A0A534Q4N8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9833 23 178 GO:0051920

Map