F391914

General Info

Members Datasets Scaffolds Average Seq Length
294 217 262 182

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100313892|Ga0070660_1003138922
Length 219
Sequence LPLNANHSYLHDADALLSCKTVAPRLNPVLEIHMKQGVKTTKLQLAGLCATALLVASGAQALEYPIGKPQIHAGMEVAAVYLQPIAMEPAGMMRDAKTSDIHIEADIKATDKNANGFADGTWIPYLDVRYELAKQGSASVISGPMMPMVANDGPHYGDNVKLAGPGRYKLKLSVAPPGGGAHAAFGRHVDKETGVAPWFAPFTLEYDFTYAGTGKKGGY

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2534681786 Brucella suis 92/29 Isolate Unclassified
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
8 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
9 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
10 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
11 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
12 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
13 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
14 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
15 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
16 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
17 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
18 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
19 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
20 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
28 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
29 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
30 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
31 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 89.12
Metatranscriptomes 0
Isolates 10.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0.34
Rhizoplane 9.52
Rhizosphere 68.71
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10036243 3300002459 Bacteria 1023
2 JGI25155J39150_1000244 3300002704 Bacteria 21150
3 JGI25156J39149_1001686 3300002705 Bacteria 8906
4 JGI25154J39366_1000259 3300002738 Bacteria 33869
5 Ga0055538_1000020 3300003751 Bacteria 264193
6 Ga0055539_1000025 3300003752 Bacteria 264193
7 Ga0055533_1000034 3300003756 Bacteria 264193
8 Ga0055525_1000044 3300003759 Bacteria 264193
9 Ga0055529_1000703 3300003763 Bacteria 22490
10 Ga0055541_1000019 3300003841 Bacteria 264193
11 Ga0070676_10382285 3300005328 Bacteria 975
12 Ga0070683_100619812 3300005329 Bacteria 1036
13 Ga0070670_100184036 3300005331 Bacteria 1814
14 Ga0068869_100008934 3300005334 Bacteria 6486
15 Ga0070660_100313892 3300005339 Bacteria 1287
16 Ga0070689_100079364 3300005340 Bacteria 2574
17 Ga0070668_100011288 3300005347 Bacteria 6653
18 Ga0070669_100075926 3300005353 Bacteria 2493
19 Ga0070669_100312676 3300005353 Bacteria 1267
20 Ga0070675_100033905 3300005354 Bacteria 4140
21 Ga0070675_101143955 3300005354 Bacteria 716
22 Ga0070674_100049558 3300005356 Bacteria 2887
23 Ga0070673_100112995 3300005364 Bacteria 2255
24 Ga0070667_100172392 3300005367 Bacteria 1910
25 Ga0070667_100198845 3300005367 Bacteria 1778
26 Ga0070714_100104346 3300005435 Bacteria 2501
27 Ga0070700_100091752 3300005441 Bacteria 1984
28 Ga0070678_100108588 3300005456 Bacteria 2166
29 Ga0070681_10009114 3300005458 Bacteria 9751
30 Ga0070681_10058511 3300005458 Bacteria 3834
31 Ga0068867_100162025 3300005459 Bacteria 1764
32 Ga0070679_100013331 3300005530 Bacteria 7871
33 Ga0070679_100084574 3300005530 Bacteria 3160
34 Ga0070672_100006295 3300005543 Bacteria 7959
35 Ga0070672_100181274 3300005543 Bacteria 1755
36 Ga0070665_100020413 3300005548 Bacteria 6655
37 Ga0068855_100000232 3300005563 Bacteria 71087
38 Ga0068855_100343198 3300005563 Bacteria 1646
39 Ga0068855_100620646 3300005563 Bacteria 1164
40 Ga0070664_100292016 3300005564 Bacteria 1472
41 Ga0068857_100266806 3300005577 Bacteria 1572
42 Ga0068856_100551153 3300005614 Bacteria 1174
43 Ga0068852_100089165 3300005616 Bacteria 2756
44 Ga0068852_100129777 3300005616 Bacteria 2320
45 Ga0068864_100010583 3300005618 Bacteria 7627
46 Ga0068866_10275820 3300005718 Bacteria 1039
47 Ga0068870_10073485 3300005840 Bacteria 1870
48 Ga0068870_10216777 3300005840 Bacteria 1169
49 Ga0068863_100096577 3300005841 Bacteria 2805
50 Ga0068863_100147807 3300005841 Bacteria 2248
51 Ga0068863_100322974 3300005841 Bacteria 1499
52 Ga0068858_100070772 3300005842 Bacteria 3234
53 Ga0068858_100205450 3300005842 Bacteria 1863
54 Ga0068860_100085695 3300005843 Bacteria 2997
55 Ga0068860_100298236 3300005843 Bacteria 1578
56 Ga0068862_100230558 3300005844 Bacteria 1680
57 Ga0068862_101096192 3300005844 Bacteria 791
58 Ga0081455_10366758 3300005937 Bacteria 1011
59 Ga0075432_10010087 3300006058 Bacteria 3205
60 Ga0068871_100716620 3300006358 Bacteria 917
61 Ga0068865_100238715 3300006881 Bacteria 1429
62 Ga0068865_100342579 3300006881 Bacteria 1208
63 Ga0079104_1014276 3300006946 Bacteria 2402
64 Ga0105240_10020763 3300009093 Bacteria 8750
65 Ga0111539_10161435 3300009094 Bacteria 2621
66 Ga0105243_11027074 3300009148 Bacteria 829
67 Ga0105242_10041226 3300009176 Bacteria 3723
68 Ga0105248_10336107 3300009177 Bacteria 1701
69 Ga0105237_10011091 3300009545 Bacteria 9550
70 Ga0105237_10207852 3300009545 Bacteria 1957
71 Ga0105238_10085100 3300009551 Bacteria 3151
72 Ga0105249_10211941 3300009553 Bacteria 1902
73 Ga0105249_10594538 3300009553 Bacteria 1161
74 Ga0105239_10077135 3300010375 Bacteria 3667
75 Ga0157370_10144987 3300013104 Bacteria 2211
76 Ga0157370_10950742 3300013104 Bacteria 779
77 Ga0157370_11113883 3300013104 Bacteria 713
78 Ga0157369_10315663 3300013105 Bacteria 1625
79 Ga0157378_10039973 3300013297 Bacteria 4160
80 Ga0163162_10161894 3300013306 Bacteria 2359
81 Ga0163162_10541062 3300013306 Bacteria 1293
82 Ga0157375_10263143 3300013308 Bacteria 1886
83 Ga0157375_10550098 3300013308 Bacteria 1316
84 Ga0163163_10001240 3300014325 Bacteria 21506
85 Ga0163163_10130191 3300014325 Bacteria 2556
86 Ga0157379_10262744 3300014968 Bacteria 1569
87 Ga0157379_11132907 3300014968 Bacteria 750
88 Ga0163161_10006704 3300017792 Bacteria 7966
89 Ga0213872_10026885 3300021361 Bacteria 2643
90 Ga0213875_10000012 3300021388 Bacteria 312017
91 Ga0209435_100548 3300025206 Bacteria 7183
92 Ga0209784_100002 3300025224 Bacteria 1753105
93 Ga0209566_100003 3300025225 Bacteria 1753105
94 Ga0209674_100004 3300025226 Bacteria 1753105
95 Ga0209563_100006 3300025230 Bacteria 1753105
96 Ga0209646_1000021 3300025246 Bacteria 461083
97 Ga0209677_100003 3300025253 Bacteria 1753105
98 Ga0209759_1000377 3300025256 Bacteria 55893
99 Ga0209455_1000646 3300025272 Bacteria 21365
100 Ga0209025_1000040 3300025294 Bacteria 376228
101 Ga0207682_10046791 3300025893 Bacteria 1779
102 Ga0207642_10072296 3300025899 Bacteria 1645
103 Ga0207688_10194237 3300025901 Bacteria 1215
104 Ga0207695_10002151 3300025913 Bacteria 29846
105 Ga0207695_10050435 3300025913 Bacteria 4378
106 Ga0207671_10081103 3300025914 Bacteria 2433
107 Ga0207671_10265634 3300025914 Bacteria 1351
108 Ga0207693_10316511 3300025915 Bacteria 1222
109 Ga0207657_10224942 3300025919 Bacteria 1502
110 Ga0207652_10037229 3300025921 Bacteria 4118
111 Ga0207681_10297731 3300025923 Bacteria 1275
112 Ga0207681_10368910 3300025923 Bacteria 1153
113 Ga0207694_10053785 3300025924 Bacteria 3123
114 Ga0207650_10353439 3300025925 Bacteria 1209
115 Ga0207659_11010939 3300025926 Bacteria 715
116 Ga0207664_10000395 3300025929 Bacteria 31254
117 Ga0207644_10024184 3300025931 Bacteria 4168
118 Ga0207706_10341106 3300025933 Bacteria 1303
119 Ga0207686_10359002 3300025934 Bacteria 1099
120 Ga0207709_10149381 3300025935 Bacteria 1616
121 Ga0207704_10036712 3300025938 Bacteria 2822
122 Ga0207704_10336917 3300025938 Bacteria 1169
123 Ga0207691_10252302 3300025940 Bacteria 1523
124 Ga0207689_10011841 3300025942 Bacteria 7471
125 Ga0207679_10048175 3300025945 Bacteria 3101
126 Ga0207667_10000034 3300025949 Bacteria 304569
127 Ga0207667_10357349 3300025949 Bacteria 1490
128 Ga0207667_10377443 3300025949 Bacteria 1445
129 Ga0207651_10198147 3300025960 Bacteria 1607
130 Ga0207712_10220205 3300025961 Bacteria 1517
131 Ga0207640_10502301 3300025981 Bacteria 1010
132 Ga0207658_10199760 3300025986 Bacteria 1668
133 Ga0207677_10073908 3300026023 Bacteria 2416
134 Ga0207678_11451128 3300026067 Bacteria 606
135 Ga0207708_10139229 3300026075 Bacteria 1902
136 Ga0207641_10026079 3300026088 Bacteria 4822
137 Ga0207641_10095979 3300026088 Bacteria 2603
138 Ga0207648_10015700 3300026089 Bacteria 6949
139 Ga0207674_10145790 3300026116 Bacteria 2326
140 Ga0207683_10066827 3300026121 Bacteria 3171
141 Ga0207683_10087512 3300026121 Bacteria 2771
142 Ga0207698_10152509 3300026142 Bacteria 2008
143 Ga0207698_10202232 3300026142 Bacteria 1780
144 Ga0207698_10381935 3300026142 Bacteria 1340
145 Ga0268265_10031363 3300028380 Bacteria 3838
146 Ga0268264_10100986 3300028381 Bacteria 2507
147 Ga0268264_11029990 3300028381 Bacteria 830
148 Ga0265324_10002556 3300029957 Bacteria 9194
149 Ga0265325_10110395 3300031241 Bacteria 1337
150 Ga0265339_10002865 3300031249 Bacteria 12213
151 Ga0307408_100000774 3300031548 Bacteria 25726
152 Ga0265314_10007154 3300031711 Bacteria 9716
153 Ga0265314_10031284 3300031711 Bacteria 3931
154 Ga0307412_10000171 3300031911 Bacteria 46170
155 Ga0373955_0330550 3300035172 Bacteria 922
156 Ga0373955_0634832 3300035172 Bacteria 655
157 Ga0373947_0034656 3300035725 Bacteria 2986
158 Ga0373937_0608162 3300036401 Bacteria 1038
159 Ga0395899_0131549 3300037312 Bacteria 1786
160 Ga0436364_0279610 3300037853 Bacteria 1805
161 Ga0436364_0524693 3300037853 Bacteria 41977
162 Ga0436364_1389454 3300037853 Bacteria 1218
163 Ga0436365_1715013 3300039437 Bacteria 1764
164 Ga0436360_1133501 3300039438 Bacteria 1026
165 Ga0436361_0002284 3300039447 Bacteria 22301
166 Ga0436361_0815493 3300039447 Bacteria 4310
167 Ga0451853_0190459 3300041512 Bacteria 1250
168 Ga0451577_0145561 3300042876 Bacteria 2130
169 Ga0451577_0165905 3300042876 Bacteria 1990
170 Ga0451577_0210741 3300042876 Bacteria 1755
171 Ga0453684_0000077 3300044712 Bacteria 435536
172 Ga0453684_0756638 3300044712 Bacteria 1051
173 Ga0466971_0053628 3300044719 Bacteria 1817
174 Ga0451576_0000108 3300045051 Bacteria 211233
175 Ga0451576_0059488 3300045051 Bacteria 3988
176 Ga0466967_0449032 3300045976 Bacteria 1260
177 Ga0495664_0125691 3300046477 Bacteria 1552
178 Ga0495618_0324041 3300046514 Bacteria 954
179 Ga0495645_0119992 3300046543 Bacteria 1852
180 Ga0495635_0237397 3300046663 Bacteria 1231
181 Ga0495589_0080946 3300046794 Bacteria 1580
182 Ga0495600_0081797 3300046809 Bacteria 2108
183 Ga0495676_0193770 3300047321 Bacteria 1416
184 Ga0495675_0092153 3300047444 Bacteria 1902
185 Ga0495675_0205763 3300047444 Bacteria 1196
186 Ga0496100_0208590 3300048903 Bacteria 1428
187 Ga0496101_0013327 3300048904 Bacteria 5506
188 Ga0496101_0109602 3300048904 Bacteria 2077
189 Ga0496102_1097681 3300048905 Bacteria 715
190 Ga0496104_0000040 3300048907 Bacteria 162886
191 Ga0496104_0021448 3300048907 Bacteria 5930
192 Ga0496104_0029396 3300048907 Bacteria 5097
193 Ga0496105_0000060 3300048908 Bacteria 86019
194 Ga0496105_0020595 3300048908 Bacteria 5331
195 Ga0496105_0043260 3300048908 Bacteria 3714
196 Ga0496105_0069337 3300048908 Bacteria 2913
197 Ga0496108_0001550 3300048911 Bacteria 18185
198 Ga0496108_0104909 3300048911 Bacteria 2413
199 Ga0496109_0001601 3300048912 Bacteria 18890
200 Ga0496110_0064563 3300048913 Bacteria 3236
201 Ga0496110_0225139 3300048913 Bacteria 1705
202 Ga0496111_0030693 3300048914 Bacteria 3823
203 Ga0496112_0001732 3300048915 Bacteria 17083
204 Ga0496112_0131615 3300048915 Bacteria 2472
205 Ga0496113_0005275 3300048916 Bacteria 8049
206 Ga0496113_0076207 3300048916 Bacteria 2561
207 Ga0496114_0185261 3300048917 Bacteria 1819
208 Ga0496114_0412912 3300048917 Bacteria 1195
209 Ga0496115_0028476 3300048918 Bacteria 4379
210 Ga0496115_0057121 3300048918 Bacteria 3138
211 Ga0496115_0219623 3300048918 Bacteria 1569
212 Ga0496115_0357458 3300048918 Bacteria 1190
213 Ga0496116_0019832 3300048919 Bacteria 5133
214 Ga0496116_0036567 3300048919 Bacteria 3433
215 Ga0496117_0116571 3300048920 Bacteria 1650
216 Ga0496118_0139384 3300048921 Bacteria 1541
217 Ga0496119_0001849 3300048922 Bacteria 24447
218 Ga0496119_0016906 3300048922 Bacteria 5520
219 Ga0496119_0178511 3300048922 Bacteria 1115
220 Ga0496121_0008005 3300048924 Bacteria 12614
221 Ga0496121_0011738 3300048924 Bacteria 9665
222 Ga0496121_0093362 3300048924 Bacteria 2343
223 Ga0496122_0001216 3300048925 Bacteria 43689
224 Ga0496122_0052138 3300048925 Bacteria 3101
225 Ga0496123_0001018 3300048926 Bacteria 42801
226 Ga0496124_0022032 3300048927 Bacteria 5853
227 Ga0496124_0480837 3300048927 Bacteria 838
228 Ga0496125_0000011 3300048928 Bacteria 655895
229 Ga0496125_0023972 3300048928 Bacteria 5622
230 Ga0496125_0282905 3300048928 Bacteria 1026
231 Ga0496126_0008020 3300048929 Bacteria 11459
232 Ga0496126_0036653 3300048929 Bacteria 4583
233 Ga0496126_0614733 3300048929 Bacteria 855
234 Ga0501031_0003407 3300049568 Bacteria 10205
235 Ga0501033_0079009 3300049570 Bacteria 2414
236 Ga0501034_0206685 3300049571 Bacteria 1919
237 Ga0501037_0081723 3300049573 Bacteria 2342
238 Ga0501037_0338388 3300049573 Bacteria 1040
239 Ga0501046_0362182 3300049580 Bacteria 1051
240 Ga0501047_0006791 3300049581 Bacteria 10752
241 Ga0501067_0019660 3300049583 Bacteria 3738
242 Ga0501067_0112122 3300049583 Bacteria 1517
243 Ga0501068_0172428 3300049584 Bacteria 1366
244 Ga0501070_0030989 3300049586 Bacteria 4480
245 Ga0501070_0135041 3300049586 Bacteria 2037
246 Ga0501070_0152774 3300049586 Bacteria 1904
247 Ga0501072_0111529 3300049588 Bacteria 2177
248 Ga0501073_0025437 3300049589 Bacteria 4245
249 Ga0501074_0019625 3300049590 Bacteria 4907
250 Ga0501079_0146748 3300049741 Bacteria 1839
251 Ga0501080_0020800 3300049742 Bacteria 6074
252 Ga0501080_0311382 3300049742 Bacteria 1427
253 Ga0501035_0282887 3300049822 Bacteria 1401
254 Ga0501044_0000830 3300049823 Bacteria 37092
255 Ga0501044_0006943 3300049823 Bacteria 12462
256 nmdc:mga08y16_215707_c1 3300050511 Bacteria 1987
257 Ga0495619_0161210 3300053085 Bacteria 1549
258 Ga0500618_001782 3300053125 Bacteria 9092
259 Ga0500600_0023555 3300053149 Bacteria 3676
260 Ga0501082_0009707 3300060353 Bacteria 8288
261 Ga0501082_0390454 3300060353 Bacteria 1214
262 Ga0466962_0101309 3300061719 Bacteria 1383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100104346 Ga0070714_1001043462 163
2 3300025929 Ga0207664_10000395 Ga0207664_1000039510 163
3 3300047444 Ga0495675_0092153 Ga0495675_0092153_476_976 164
4 3300002704 JGI25155J39150_1000244 JGI25155J39150_100024415 169
5 3300002705 JGI25156J39149_1001686 JGI25156J39149_10016867 169
6 3300002738 JGI25154J39366_1000259 JGI25154J39366_10002597 169
7 3300025206 Ga0209435_100548 Ga0209435_1005489 169
8 3300025246 Ga0209646_1000021 Ga0209646_100002151 169
9 3300025256 Ga0209759_1000377 Ga0209759_100037727 169
10 3300042876 Ga0451577_0145561 Ga0451577_0145561_577_1128 169
11 3300045051 Ga0451576_0000108 Ga0451576_0000108_177821_178372 169
12 iso_pu_bacteria 2511231003 2511249390 169
13 3300017792 Ga0163161_10006704 Ga0163161_100067048 170
14 3300031711 Ga0265314_10007154 Ga0265314_100071542 170
15 3300005354 Ga0070675_100033905 Ga0070675_1000339054 171
16 3300005356 Ga0070674_100049558 Ga0070674_1000495585 171
17 3300005459 Ga0068867_100162025 Ga0068867_1001620253 171
18 3300005618 Ga0068864_100010583 Ga0068864_1000105834 171
19 3300005840 Ga0068870_10073485 Ga0068870_100734853 171
20 3300005842 Ga0068858_100070772 Ga0068858_1000707723 171
21 3300009148 Ga0105243_11027074 Ga0105243_110270742 171
22 3300009553 Ga0105249_10211941 Ga0105249_102119413 171
23 3300013297 Ga0157378_10039973 Ga0157378_100399733 171
24 3300013306 Ga0163162_10161894 Ga0163162_101618943 171
25 3300025901 Ga0207688_10194237 Ga0207688_101942372 171
26 3300025923 Ga0207681_10297731 Ga0207681_102977312 171
27 3300025935 Ga0207709_10149381 Ga0207709_101493814 171
28 3300025960 Ga0207651_10198147 Ga0207651_101981473 171
29 3300025961 Ga0207712_10220205 Ga0207712_102202053 171
30 3300026089 Ga0207648_10015700 Ga0207648_100157003 171
31 3300053125 Ga0500618_001782 Ga0500618_001782_7489_8109 171
32 3300005334 Ga0068869_100008934 Ga0068869_1000089347 172
33 3300005340 Ga0070689_100079364 Ga0070689_1000793644 172
34 3300005353 Ga0070669_100075926 Ga0070669_1000759263 172
35 3300005367 Ga0070667_100198845 Ga0070667_1001988452 172
36 3300005441 Ga0070700_100091752 Ga0070700_1000917524 172
37 3300005458 Ga0070681_10009114 Ga0070681_100091146 172
38 3300005530 Ga0070679_100013331 Ga0070679_1000133316 172
39 3300005543 Ga0070672_100006295 Ga0070672_1000062955 172
40 3300005718 Ga0068866_10275820 Ga0068866_102758202 172
41 3300005841 Ga0068863_100147807 Ga0068863_1001478075 172
42 3300005841 Ga0068863_100322974 Ga0068863_1003229742 172
43 3300005843 Ga0068860_100085695 Ga0068860_1000856953 172
44 3300005843 Ga0068860_100298236 Ga0068860_1002982362 172
45 3300006358 Ga0068871_100716620 Ga0068871_1007166201 172
46 3300006881 Ga0068865_100342579 Ga0068865_1003425792 172
47 3300009176 Ga0105242_10041226 Ga0105242_100412264 172
48 3300009177 Ga0105248_10336107 Ga0105248_103361073 172
49 3300025899 Ga0207642_10072296 Ga0207642_100722963 172
50 3300025915 Ga0207693_10316511 Ga0207693_103165112 172
51 3300025934 Ga0207686_10359002 Ga0207686_103590022 172
52 3300025938 Ga0207704_10036712 Ga0207704_100367123 172
53 3300025942 Ga0207689_10011841 Ga0207689_100118414 172
54 3300025986 Ga0207658_10199760 Ga0207658_101997602 172
55 3300026075 Ga0207708_10139229 Ga0207708_101392294 172
56 3300026088 Ga0207641_10026079 Ga0207641_100260796 172
57 3300026121 Ga0207683_10066827 Ga0207683_100668275 172
58 3300028381 Ga0268264_10100986 Ga0268264_101009863 172
59 3300028381 Ga0268264_11029990 Ga0268264_110299901 172
60 3300031249 Ga0265339_10002865 Ga0265339_100028653 172
61 3300045051 Ga0451576_0059488 Ga0451576_0059488_3143_3688 172
62 3300045976 Ga0466967_0449032 Ga0466967_0449032_591_1124 172
63 iso_pu_bacteria 2534681786 2535486352 172
64 iso_pu_bacteria 2547132103 2547371194 172
65 iso_pu_bacteria 2843690924 2843695019 172
66 iso_pu_bacteria 2846033681 2846037397 172
67 iso_pu_bacteria 2846037992 2846038113 172
68 iso_pu_bacteria 2881412998 2881418483 172
69 3300009093 Ga0105240_10020763 Ga0105240_100207637 173
70 3300025913 Ga0207695_10050435 Ga0207695_100504353 173
71 3300048924 Ga0496121_0011738 Ga0496121_0011738_5118_5648 173
72 3300049568 Ga0501031_0003407 Ga0501031_0003407_5073_5615 173
73 iso_pu_bacteria 2511231026 2511385162 173
74 iso_pu_bacteria 2521172590 2521558718 173
75 iso_pu_bacteria 2551306416 2553004449 173
76 iso_pu_bacteria 2808606386 2808981822 173
77 iso_pu_bacteria 2808606415 2809131450 173
78 iso_pu_bacteria 2808606419 2809151072 173
79 iso_pu_bacteria 2818991449 2819614056 173
80 iso_pu_bacteria 2852618963 2852622648 173
81 iso_pu_bacteria 2904439833 2904443987 173
82 iso_pu_bacteria 2904530477 2904534464 173
83 iso_pu_bacteria 2904584206 2904584355 173
84 iso_pu_bacteria 2904589729 2904590823 173
85 iso_pu_bacteria 2904601388 2904603336 173
86 iso_pu_bacteria 2919046199 2919047151 173
87 iso_pu_bacteria 2919079590 2919080659 173
88 iso_pu_bacteria 2923510766 2923512304 173
89 iso_pu_bacteria 2928130867 2928131956 173
90 3300003763 Ga0055529_1000703 Ga0055529_100070312 174
91 3300005577 Ga0068857_100266806 Ga0068857_1002668062 174
92 3300013104 Ga0157370_11113883 Ga0157370_111138832 174
93 3300025272 Ga0209455_1000646 Ga0209455_100064610 174
94 3300025294 Ga0209025_1000040 Ga0209025_100004052 174
95 3300025949 Ga0207667_10377443 Ga0207667_103774433 174
96 3300026116 Ga0207674_10145790 Ga0207674_101457903 174
97 3300029957 Ga0265324_10002556 Ga0265324_100025567 174
98 3300031241 Ga0265325_10110395 Ga0265325_101103952 174
99 3300031711 Ga0265314_10031284 Ga0265314_100312842 174
100 3300031911 Ga0307412_10000171 Ga0307412_100001719 174
101 3300037312 Ga0395899_0131549 Ga0395899_0131549_633_1169 174
102 3300042876 Ga0451577_0165905 Ga0451577_0165905_1401_1949 174
103 3300042876 Ga0451577_0210741 Ga0451577_0210741_365_913 174
104 3300044712 Ga0453684_0000077 Ga0453684_0000077_260005_260553 174
105 3300044712 Ga0453684_0756638 Ga0453684_0756638_474_1022 174
106 3300048924 Ga0496121_0093362 Ga0496121_0093362_1428_1964 174
107 3300048928 Ga0496125_0000011 Ga0496125_0000011_294890_295426 174
108 3300049570 Ga0501033_0079009 Ga0501033_0079009_215_751 174
109 3300049573 Ga0501037_0081723 Ga0501037_0081723_298_834 174
110 3300049573 Ga0501037_0338388 Ga0501037_0338388_325_861 174
111 3300049580 Ga0501046_0362182 Ga0501046_0362182_144_680 174
112 3300049581 Ga0501047_0006791 Ga0501047_0006791_9469_10005 174
113 3300049822 Ga0501035_0282887 Ga0501035_0282887_334_882 174
114 3300049823 Ga0501044_0000830 Ga0501044_0000830_9236_9784 174
115 3300049823 Ga0501044_0006943 Ga0501044_0006943_11547_12083 174
116 3300053149 Ga0500600_0023555 Ga0500600_0023555_2102_2641 174
117 iso_pu_bacteria 2738541298 2738836890 174
118 iso_pu_bacteria 2738541306 2738878421 174
119 iso_pu_bacteria 2738543002 2739190113 174
120 iso_pu_bacteria 2738543008 2739225014 174
121 iso_pu_bacteria 2945934425 2945936194 174
122 iso_pu_bacteria 2990703756 2990709903 174
123 iso_pu_bacteria 641736151 642427430 174
124 3300037853 Ga0436364_1389454 Ga0436364_1389454_381_923 175
125 3300039438 Ga0436360_1133501 Ga0436360_1133501_397_939 175
126 3300005563 Ga0068855_100620646 Ga0068855_1006206461 176
127 3300005616 Ga0068852_100129777 Ga0068852_1001297772 176
128 3300013104 Ga0157370_10144987 Ga0157370_101449874 176
129 3300013105 Ga0157369_10315663 Ga0157369_103156633 176
130 3300025981 Ga0207640_10502301 Ga0207640_105023011 176
131 3300026142 Ga0207698_10152509 Ga0207698_101525093 176
132 3300048919 Ga0496116_0019832 Ga0496116_0019832_3126_3668 176
133 3300048919 Ga0496116_0036567 Ga0496116_0036567_1284_1826 176
134 3300048920 Ga0496117_0116571 Ga0496117_0116571_60_602 176
135 3300048921 Ga0496118_0139384 Ga0496118_0139384_196_738 176
136 3300048922 Ga0496119_0016906 Ga0496119_0016906_2618_3160 176
137 3300048924 Ga0496121_0008005 Ga0496121_0008005_1695_2237 176
138 3300048925 Ga0496122_0001216 Ga0496122_0001216_34354_34896 176
139 3300048925 Ga0496122_0052138 Ga0496122_0052138_1749_2291 176
140 3300048926 Ga0496123_0001018 Ga0496123_0001018_1662_2204 176
141 3300048927 Ga0496124_0022032 Ga0496124_0022032_4344_4886 176
142 3300048927 Ga0496124_0480837 Ga0496124_0480837_77_619 176
143 3300048928 Ga0496125_0023972 Ga0496125_0023972_1532_2074 176
144 3300048929 Ga0496126_0008020 Ga0496126_0008020_470_1012 176
145 3300048929 Ga0496126_0036653 Ga0496126_0036653_2374_2916 176
146 3300003751 Ga0055538_1000020 Ga0055538_100002097 177
147 3300003752 Ga0055539_1000025 Ga0055539_100002597 177
148 3300003756 Ga0055533_1000034 Ga0055533_1000034146 177
149 3300003759 Ga0055525_1000044 Ga0055525_100004497 177
150 3300003841 Ga0055541_1000019 Ga0055541_100001997 177
151 3300005563 Ga0068855_100000232 Ga0068855_10000023211 177
152 3300005563 Ga0068855_100343198 Ga0068855_1003431982 177
153 3300005614 Ga0068856_100551153 Ga0068856_1005511532 177
154 3300006946 Ga0079104_1014276 Ga0079104_10142763 177
155 3300009545 Ga0105237_10011091 Ga0105237_100110919 177
156 3300009545 Ga0105237_10207852 Ga0105237_102078522 177
157 3300009551 Ga0105238_10085100 Ga0105238_100851004 177
158 3300010375 Ga0105239_10077135 Ga0105239_100771352 177
159 3300021361 Ga0213872_10026885 Ga0213872_100268854 177
160 3300021388 Ga0213875_10000012 Ga0213875_1000001294 177
161 3300025224 Ga0209784_100002 Ga0209784_100002100 177
162 3300025225 Ga0209566_100003 Ga0209566_100003100 177
163 3300025226 Ga0209674_100004 Ga0209674_100004100 177
164 3300025230 Ga0209563_100006 Ga0209563_100006100 177
165 3300025253 Ga0209677_100003 Ga0209677_100003100 177
166 3300025913 Ga0207695_10002151 Ga0207695_100021519 177
167 3300025914 Ga0207671_10081103 Ga0207671_100811033 177
168 3300025914 Ga0207671_10265634 Ga0207671_102656342 177
169 3300025919 Ga0207657_10224942 Ga0207657_102249422 177
170 3300025921 Ga0207652_10037229 Ga0207652_100372293 177
171 3300025924 Ga0207694_10053785 Ga0207694_100537854 177
172 3300025949 Ga0207667_10000034 Ga0207667_10000034188 177
173 3300025949 Ga0207667_10357349 Ga0207667_103573492 177
174 3300035172 Ga0373955_0634832 Ga0373955_0634832_88_633 177
175 3300036401 Ga0373937_0608162 Ga0373937_0608162_477_1022 177
176 3300037853 Ga0436364_0524693 Ga0436364_0524693_6025_6579 177
177 3300039447 Ga0436361_0002284 Ga0436361_0002284_1825_2370 177
178 3300039447 Ga0436361_0815493 Ga0436361_0815493_2286_2831 177
179 3300046477 Ga0495664_0125691 Ga0495664_0125691_477_1022 177
180 3300046543 Ga0495645_0119992 Ga0495645_0119992_867_1433 177
181 3300046663 Ga0495635_0237397 Ga0495635_0237397_93_638 177
182 3300046794 Ga0495589_0080946 Ga0495589_0080946_547_1095 177
183 3300046809 Ga0495600_0081797 Ga0495600_0081797_1073_1621 177
184 3300047444 Ga0495675_0205763 Ga0495675_0205763_515_1063 177
185 3300049583 Ga0501067_0112122 Ga0501067_0112122_882_1415 177
186 3300049586 Ga0501070_0152774 Ga0501070_0152774_1191_1724 177
187 3300049742 Ga0501080_0311382 Ga0501080_0311382_246_779 177
188 3300060353 Ga0501082_0009707 Ga0501082_0009707_727_1260 177
189 iso_pu_bacteria 2734482258 2735817077 177
190 3300002459 JGI24751J29686_10036243 JGI24751J29686_100362431 178
191 3300005328 Ga0070676_10382285 Ga0070676_103822851 178
192 3300005329 Ga0070683_100619812 Ga0070683_1006198121 178
193 3300005331 Ga0070670_100184036 Ga0070670_1001840363 178
194 3300005339 Ga0070660_100313892 Ga0070660_1003138922 178
195 3300005347 Ga0070668_100011288 Ga0070668_1000112884 178
196 3300005353 Ga0070669_100312676 Ga0070669_1003126762 178
197 3300005354 Ga0070675_101143955 Ga0070675_1011439551 178
198 3300005364 Ga0070673_100112995 Ga0070673_1001129953 178
199 3300005367 Ga0070667_100172392 Ga0070667_1001723921 178
200 3300005456 Ga0070678_100108588 Ga0070678_1001085883 178
201 3300005458 Ga0070681_10058511 Ga0070681_100585115 178
202 3300005530 Ga0070679_100084574 Ga0070679_1000845744 178
203 3300005543 Ga0070672_100181274 Ga0070672_1001812743 178
204 3300005548 Ga0070665_100020413 Ga0070665_1000204135 178
205 3300005564 Ga0070664_100292016 Ga0070664_1002920163 178
206 3300005616 Ga0068852_100089165 Ga0068852_1000891653 178
207 3300005840 Ga0068870_10216777 Ga0068870_102167772 178
208 3300005841 Ga0068863_100096577 Ga0068863_1000965775 178
209 3300005842 Ga0068858_100205450 Ga0068858_1002054501 178
210 3300005844 Ga0068862_100230558 Ga0068862_1002305582 178
211 3300005844 Ga0068862_101096192 Ga0068862_1010961921 178
212 3300005937 Ga0081455_10366758 Ga0081455_103667582 178
213 3300006058 Ga0075432_10010087 Ga0075432_100100873 178
214 3300006881 Ga0068865_100238715 Ga0068865_1002387153 178
215 3300009094 Ga0111539_10161435 Ga0111539_101614353 178
216 3300009553 Ga0105249_10594538 Ga0105249_105945382 178
217 3300013104 Ga0157370_10950742 Ga0157370_109507421 178
218 3300013306 Ga0163162_10541062 Ga0163162_105410623 178
219 3300013308 Ga0157375_10263143 Ga0157375_102631433 178
220 3300013308 Ga0157375_10550098 Ga0157375_105500983 178
221 3300014325 Ga0163163_10001240 Ga0163163_100012409 178
222 3300014325 Ga0163163_10130191 Ga0163163_101301915 178
223 3300014968 Ga0157379_10262744 Ga0157379_102627443 178
224 3300014968 Ga0157379_11132907 Ga0157379_111329071 178
225 3300025893 Ga0207682_10046791 Ga0207682_100467914 178
226 3300025923 Ga0207681_10368910 Ga0207681_103689102 178
227 3300025925 Ga0207650_10353439 Ga0207650_103534392 178
228 3300025926 Ga0207659_11010939 Ga0207659_110109391 178
229 3300025931 Ga0207644_10024184 Ga0207644_100241844 178
230 3300025933 Ga0207706_10341106 Ga0207706_103411063 178
231 3300025938 Ga0207704_10336917 Ga0207704_103369172 178
232 3300025940 Ga0207691_10252302 Ga0207691_102523022 178
233 3300025945 Ga0207679_10048175 Ga0207679_100481754 178
234 3300026023 Ga0207677_10073908 Ga0207677_100739084 178
235 3300026067 Ga0207678_11451128 Ga0207678_114511281 178
236 3300026088 Ga0207641_10095979 Ga0207641_100959793 178
237 3300026121 Ga0207683_10087512 Ga0207683_100875123 178
238 3300026142 Ga0207698_10202232 Ga0207698_102022323 178
239 3300026142 Ga0207698_10381935 Ga0207698_103819353 178
240 3300028380 Ga0268265_10031363 Ga0268265_100313635 178
241 3300031548 Ga0307408_100000774 Ga0307408_1000007748 178
242 3300035172 Ga0373955_0330550 Ga0373955_0330550_111_680 178
243 3300035725 Ga0373947_0034656 Ga0373947_0034656_101_637 178
244 3300037853 Ga0436364_0279610 Ga0436364_0279610_942_1490 178
245 3300039437 Ga0436365_1715013 Ga0436365_1715013_949_1488 178
246 3300041512 Ga0451853_0190459 Ga0451853_0190459_407_952 178
247 3300044719 Ga0466971_0053628 Ga0466971_0053628_1172_1741 178
248 3300046514 Ga0495618_0324041 Ga0495618_0324041_293_838 178
249 3300047321 Ga0495676_0193770 Ga0495676_0193770_170_706 178
250 3300048903 Ga0496100_0208590 Ga0496100_0208590_114_650 178
251 3300048904 Ga0496101_0013327 Ga0496101_0013327_1524_2072 178
252 3300048904 Ga0496101_0109602 Ga0496101_0109602_611_1147 178
253 3300048905 Ga0496102_1097681 Ga0496102_1097681_59_595 178
254 3300048907 Ga0496104_0000040 Ga0496104_0000040_158967_159515 178
255 3300048907 Ga0496104_0021448 Ga0496104_0021448_4546_5082 178
256 3300048907 Ga0496104_0029396 Ga0496104_0029396_2874_3422 178
257 3300048908 Ga0496105_0000060 Ga0496105_0000060_6098_6646 178
258 3300048908 Ga0496105_0020595 Ga0496105_0020595_2858_3406 178
259 3300048908 Ga0496105_0043260 Ga0496105_0043260_1547_2083 178
260 3300048908 Ga0496105_0069337 Ga0496105_0069337_637_1185 178
261 3300048911 Ga0496108_0001550 Ga0496108_0001550_15742_16278 178
262 3300048911 Ga0496108_0104909 Ga0496108_0104909_1784_2332 178
263 3300048912 Ga0496109_0001601 Ga0496109_0001601_2127_2663 178
264 3300048913 Ga0496110_0064563 Ga0496110_0064563_2586_3134 178
265 3300048913 Ga0496110_0225139 Ga0496110_0225139_500_1036 178
266 3300048914 Ga0496111_0030693 Ga0496111_0030693_1878_2426 178
267 3300048915 Ga0496112_0001732 Ga0496112_0001732_12899_13435 178
268 3300048915 Ga0496112_0131615 Ga0496112_0131615_1042_1590 178
269 3300048916 Ga0496113_0005275 Ga0496113_0005275_7334_7870 178
270 3300048916 Ga0496113_0076207 Ga0496113_0076207_1334_1882 178
271 3300048917 Ga0496114_0185261 Ga0496114_0185261_371_919 178
272 3300048917 Ga0496114_0412912 Ga0496114_0412912_36_584 178
273 3300048918 Ga0496115_0028476 Ga0496115_0028476_1345_1893 178
274 3300048918 Ga0496115_0057121 Ga0496115_0057121_728_1264 178
275 3300048918 Ga0496115_0219623 Ga0496115_0219623_698_1246 178
276 3300048918 Ga0496115_0357458 Ga0496115_0357458_374_922 178
277 3300048922 Ga0496119_0001849 Ga0496119_0001849_20918_21466 178
278 3300048922 Ga0496119_0178511 Ga0496119_0178511_216_764 178
279 3300048928 Ga0496125_0282905 Ga0496125_0282905_263_811 178
280 3300048929 Ga0496126_0614733 Ga0496126_0614733_220_768 178
281 3300049571 Ga0501034_0206685 Ga0501034_0206685_24_581 178
282 3300049583 Ga0501067_0019660 Ga0501067_0019660_1917_2474 178
283 3300049584 Ga0501068_0172428 Ga0501068_0172428_493_1050 178
284 3300049586 Ga0501070_0030989 Ga0501070_0030989_2708_3265 178
285 3300049586 Ga0501070_0135041 Ga0501070_0135041_462_1016 178
286 3300049588 Ga0501072_0111529 Ga0501072_0111529_280_837 178
287 3300049589 Ga0501073_0025437 Ga0501073_0025437_1022_1579 178
288 3300049590 Ga0501074_0019625 Ga0501074_0019625_1248_1805 178
289 3300049741 Ga0501079_0146748 Ga0501079_0146748_214_771 178
290 3300049742 Ga0501080_0020800 Ga0501080_0020800_1362_1919 178
291 3300050511 nmdc:mga08y16_215707_c1 nmdc:mga08y16_215707_c1_1394_1939 178
292 3300053085 Ga0495619_0161210 Ga0495619_0161210_47_592 178
293 3300060353 Ga0501082_0390454 Ga0501082_0390454_328_885 178
294 3300061719 Ga0466962_0101309 Ga0466962_0101309_69_638 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10634

Iron_transport

Fe2+ transport protein

60

212

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i0y-assembly1.cif.gz_A copper-bound e46q variant of uropathogenic escherichia coli strain f11 fetp 0.9787 21 171
5i0x-assembly1.cif.gz_A copper-bound m90i variant of uropathogenic escherichia coli strain f11 fetp 0.9781 21 171
3nrq-assembly1.cif.gz_A crystal structure of copper-reconstituted fetp from uropathogenic escherichia coli strain f11 0.9752 21 171
3nrp-assembly1.cif.gz_B crystal structure of 'as isolated' uropathogenic e. coli strain f11 fetp recombinantly expressed in the periplasm of e. coli bl21(de3) 0.9752 21 171
7r3s-assembly1.cif.gz_A ftra/p19 of rubrivivax gelatinosus in complex with ni 0.9602 21 174
ID Description Score Start End Superfamily
3nrpB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.9752 21 171 2.60.40.2480
3nrpB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.9437 21 171 2.60.40.2480
2o6cB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.8893 21 171 2.60.40.2480
2o6cB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.8674 21 171 2.60.40.2480
af_I1MFH5_284_365_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7751 86 131 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A775UNM8-F1-model_v4 Iron transporter 0.9766 35 173
AF-W1YWF7-F1-model_v4 34 kDa membrane antigen 0.9744 58 173
AF-A0A059W0J1-F1-model_v4 deleted 0.9734 21 169
AF-A0A775UNM8-F1-model_v4 Iron transporter 0.9626 35 173
AF-A0A3A0EQH3-F1-model_v4 Iron transporter 0.9612 13 127

Feature Viewer

pLDDT pTM Quality
88.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map