F391867

General Info

Members Datasets Scaffolds Average Seq Length
294 138 588 238

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10253433|rootH2_102534331
Length 253
Sequence VSRFVCNARVTVARLNFSYMIIASSVTKKFGRLTVLDNVSATCNKGQTISLIGPNGSGKTEFIKCLLGMVVPDSGFITFNKKNIAHNWQYRSAIGYMPQIGRYPENMTIAQVLDMMKDIRKQSNVQLDEELIHLFKLDDMLHKRMGTLSGGTRQKVSASLAFLFNPDVLILDEPTAGLDPLSTEILKDKIRKEKQQGKLVMITSHILSDLDDIVTEIIYMEDGKLRFHKSLGQLQEDTGENKLSRAIAHVMKS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
97 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
113 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
126 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
133 2738541278 Niastella sp. CF465 Isolate Unclassified
134 2738543023 Pedobacter sp. OK628 Isolate Unclassified
135 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
136 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
137 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
138 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 0
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10253433 3300003320 Bacteria 1124
2 rootH2_10199489 3300003320 Unclassified 1208
3 rootH2_10305156 3300003320 Unclassified 1362
4 rootL2_10061657 3300003322 Bacteria 7209
5 rootL2_10215156 3300003322 Unclassified 1363
6 rootL2_10321286 3300003322 Bacteria 5806
7 Ga0065165_1000023 3300005262 Bacteria 251942
8 Ga0065165_1000207 3300005262 Bacteria 101957
9 Ga0065714_10211171 3300005288 Unclassified 866
10 Ga0070658_10013373 3300005327 Bacteria 6584
11 Ga0070658_10075397 3300005327 Bacteria 2766
12 Ga0070658_10158745 3300005327 Bacteria 1896
13 Ga0070658_10216933 3300005327 Unclassified 1617
14 Ga0070658_10397653 3300005327 Bacteria 1183
15 Ga0070658_10448565 3300005327 Bacteria 1111
16 Ga0070670_100019156 3300005331 Bacteria 5869
17 Ga0068869_100161805 3300005334 Bacteria 1743
18 Ga0068869_100347113 3300005334 Unclassified 1209
19 Ga0070680_100007046 3300005336 Bacteria 8570
20 Ga0070680_100019834 3300005336 Bacteria 5330
21 Ga0070680_100066822 3300005336 Bacteria 2949
22 Ga0070682_100044451 3300005337 Bacteria 2750
23 Ga0070682_100078509 3300005337 Bacteria 2130
24 Ga0070682_100162662 3300005337 Bacteria 1543
25 Ga0070660_100002971 3300005339 Bacteria 11668
26 Ga0070660_100028276 3300005339 Bacteria 4193
27 Ga0070660_100044729 3300005339 Unclassified 3387
28 Ga0070660_100163396 3300005339 Bacteria 1795
29 Ga0070660_100429857 3300005339 Bacteria 1094
30 Ga0070660_100483091 3300005339 Bacteria 1029
31 Ga0070675_100346313 3300005354 Bacteria 1317
32 Ga0070659_100008973 3300005366 Bacteria 7331
33 Ga0070659_100113748 3300005366 Bacteria 2186
34 Ga0070659_100117564 3300005366 Bacteria 2150
35 Ga0070659_100368441 3300005366 Bacteria 1208
36 Ga0070663_100002264 3300005455 Bacteria 10781
37 Ga0070663_100232967 3300005455 Bacteria 1451
38 Ga0070678_100235342 3300005456 Bacteria 1529
39 Ga0070681_10041535 3300005458 Bacteria 4609
40 Ga0070681_10055787 3300005458 Bacteria 3933
41 Ga0070681_10165210 3300005458 Bacteria 2136
42 Ga0070681_10604801 3300005458 Unclassified 1011
43 Ga0070681_10646512 3300005458 Bacteria 972
44 Ga0068867_100280824 3300005459 Unclassified 1365
45 Ga0070679_100000437 3300005530 Bacteria 35450
46 Ga0070679_100000567 3300005530 Bacteria 31353
47 Ga0070679_100005121 3300005530 Bacteria 12113
48 Ga0070679_100151482 3300005530 Bacteria 2295
49 Ga0070679_100716134 3300005530 Bacteria 944
50 Ga0068853_100118099 3300005539 Bacteria 2363
51 Ga0068853_100217688 3300005539 Unclassified 1743
52 Ga0068853_100225117 3300005539 Bacteria 1714
53 Ga0068853_100325379 3300005539 Unclassified 1426
54 Ga0068853_100474819 3300005539 Bacteria 1178
55 Ga0068853_100504250 3300005539 Unclassified 1143
56 Ga0070693_100024011 3300005547 Bacteria 3265
57 Ga0070665_100000008 3300005548 Bacteria 606341
58 Ga0068855_100010136 3300005563 Bacteria 11361
59 Ga0068855_100010743 3300005563 Bacteria 11051
60 Ga0068855_100011339 3300005563 Bacteria 10760
61 Ga0068855_100020840 3300005563 Bacteria 7861
62 Ga0068855_100202634 3300005563 Bacteria 2233
63 Ga0068855_100281624 3300005563 Bacteria 1846
64 Ga0068855_100385725 3300005563 Bacteria 1538
65 Ga0068855_100447788 3300005563 Unclassified 1409
66 Ga0068855_100607685 3300005563 Bacteria 1178
67 Ga0068855_100752568 3300005563 Unclassified 1039
68 Ga0068857_100134948 3300005577 Unclassified 2228
69 Ga0068857_100211973 3300005577 Bacteria 1768
70 Ga0068854_100022297 3300005578 Bacteria 4311
71 Ga0068854_100218700 3300005578 Bacteria 1506
72 Ga0068856_100041376 3300005614 Bacteria 4528
73 Ga0068856_100321854 3300005614 Bacteria 1564
74 Ga0068852_100004649 3300005616 Bacteria 9731
75 Ga0068852_100151473 3300005616 Bacteria 2157
76 Ga0068852_100157965 3300005616 Bacteria 2114
77 Ga0068859_100032619 3300005617 Bacteria 5231
78 Ga0068859_100875215 3300005617 Unclassified 984
79 Ga0068866_10135291 3300005718 Bacteria 1407
80 Ga0068851_10359478 3300005834 Bacteria 849
81 Ga0068863_100263311 3300005841 Bacteria 1667
82 Ga0068863_100551413 3300005841 Bacteria 1138
83 Ga0068858_100216510 3300005842 Unclassified 1813
84 Ga0068860_100000039 3300005843 Bacteria 232543
85 Ga0068860_100132641 3300005843 Unclassified 2392
86 Ga0068860_100260862 3300005843 Unclassified 1689
87 Ga0068860_100377841 3300005843 Bacteria 1398
88 Ga0068862_100404619 3300005844 Bacteria 1277
89 Ga0097620_100032622 3300006931 Bacteria 5231
90 Ga0097620_100875067 3300006931 Unclassified 984
91 Ga0105240_10137467 3300009093 Bacteria 2925
92 Ga0114129_10002230 3300009147 Bacteria 26734
93 Ga0105241_10028304 3300009174 Bacteria 4176
94 Ga0105241_10063946 3300009174 Bacteria 2840
95 Ga0105241_10206092 3300009174 Bacteria 1645
96 Ga0105242_10768153 3300009176 Unclassified 951
97 Ga0105237_10015041 3300009545 Bacteria 8064
98 Ga0105237_10456825 3300009545 Unclassified 1283
99 Ga0105239_10010295 3300010375 Bacteria 10475
100 Ga0105239_10235379 3300010375 Unclassified 2055
101 Ga0105246_10296313 3300011119 Bacteria 1304
102 Ga0157373_10004555 3300013100 Bacteria 10421
103 Ga0157373_10010171 3300013100 Bacteria 6931
104 Ga0157373_10161494 3300013100 Bacteria 1576
105 Ga0157371_10000168 3300013102 Bacteria 95185
106 Ga0157371_10000418 3300013102 Bacteria 52571
107 Ga0157371_10004651 3300013102 Bacteria 11889
108 Ga0157371_10005252 3300013102 Bacteria 10993
109 Ga0157371_10009501 3300013102 Bacteria 7650
110 Ga0157371_10018569 3300013102 Bacteria 5138
111 Ga0157371_10052158 3300013102 Unclassified 2905
112 Ga0157371_10078169 3300013102 Bacteria 2343
113 Ga0157370_10001835 3300013104 Bacteria 26179
114 Ga0157370_10009858 3300013104 Bacteria 10124
115 Ga0157370_10010194 3300013104 Bacteria 9923
116 Ga0157370_10037706 3300013104 Bacteria 4682
117 Ga0157370_10073872 3300013104 Bacteria 3217
118 Ga0157370_10328822 3300013104 Unclassified 1409
119 Ga0157369_10029119 3300013105 Bacteria 6105
120 Ga0157369_10064627 3300013105 Bacteria 3940
121 Ga0157369_10103611 3300013105 Bacteria 3031
122 Ga0157374_10091502 3300013296 Bacteria 2901
123 Ga0157374_10248613 3300013296 Unclassified 1750
124 Ga0157378_10141438 3300013297 Bacteria 2235
125 Ga0163162_10017868 3300013306 Bacteria 6939
126 Ga0163162_10023963 3300013306 Bacteria 6023
127 Ga0163162_10061566 3300013306 Unclassified 3791
128 Ga0157372_10038214 3300013307 Bacteria 5297
129 Ga0157372_10115645 3300013307 Bacteria 3075
130 Ga0157372_10292727 3300013307 Unclassified 1894
131 Ga0157372_10457205 3300013307 Bacteria 1488
132 Ga0157372_10557726 3300013307 Bacteria 1335
133 Ga0157372_10647959 3300013307 Bacteria 1230
134 Ga0157372_10983875 3300013307 Bacteria 977
135 Ga0163163_10001087 3300014325 Bacteria 23055
136 Ga0182008_10018062 3300014497 Bacteria 3653
137 Ga0182008_10111979 3300014497 Bacteria 1353
138 Ga0182008_10149636 3300014497 Bacteria 1170
139 Ga0182007_10002833 3300015262 Bacteria 8443
140 Ga0209436_100569 3300025208 Bacteria 15863
141 Ga0209646_1007000 3300025246 Bacteria 1866
142 Ga0209676_1000511 3300025292 Bacteria 61174
143 Ga0207426_1007362 3300025302 Bacteria 4618
144 Ga0207647_10028716 3300025904 Bacteria 3609
145 Ga0207647_10112198 3300025904 Unclassified 1612
146 Ga0207705_10001687 3300025909 Bacteria 17568
147 Ga0207705_10007792 3300025909 Bacteria 7865
148 Ga0207705_10393857 3300025909 Bacteria 1071
149 Ga0207707_10008840 3300025912 Bacteria 8747
150 Ga0207707_10087733 3300025912 Unclassified 2718
151 Ga0207707_10181291 3300025912 Bacteria 1839
152 Ga0207707_10429923 3300025912 Bacteria 1131
153 Ga0207695_10007254 3300025913 Bacteria 14154
154 Ga0207695_10012973 3300025913 Bacteria 9958
155 Ga0207671_10049702 3300025914 Bacteria 3105
156 Ga0207660_10009238 3300025917 Bacteria 6379
157 Ga0207660_10028984 3300025917 Bacteria 3792
158 Ga0207660_10048664 3300025917 Bacteria 3001
159 Ga0207660_10513611 3300025917 Bacteria 973
160 Ga0207657_10009510 3300025919 Bacteria 9761
161 Ga0207657_10038831 3300025919 Bacteria 4234
162 Ga0207657_10047488 3300025919 Unclassified 3754
163 Ga0207657_10067560 3300025919 Bacteria 3040
164 Ga0207657_10166534 3300025919 Bacteria 1787
165 Ga0207657_10177547 3300025919 Bacteria 1723
166 Ga0207652_10000029 3300025921 Bacteria 149054
167 Ga0207652_10000214 3300025921 Bacteria 61294
168 Ga0207652_10000585 3300025921 Bacteria 36690
169 Ga0207652_10003995 3300025921 Bacteria 12056
170 Ga0207652_10315934 3300025921 Bacteria 1410
171 Ga0207681_10195085 3300025923 Unclassified 1552
172 Ga0207650_10047401 3300025925 Bacteria 3167
173 Ga0207650_10131419 3300025925 Bacteria 1959
174 Ga0207690_10083656 3300025932 Bacteria 2235
175 Ga0207690_10106813 3300025932 Bacteria 2009
176 Ga0207686_10491550 3300025934 Unclassified 951
177 Ga0207691_10033315 3300025940 Unclassified 4796
178 Ga0207667_10010038 3300025949 Bacteria 11099
179 Ga0207667_10027142 3300025949 Bacteria 6241
180 Ga0207667_10055978 3300025949 Unclassified 4145
181 Ga0207667_10090093 3300025949 Bacteria 3170
182 Ga0207667_10144330 3300025949 Bacteria 2451
183 Ga0207658_10109169 3300025986 Bacteria 2184
184 Ga0207703_10203687 3300026035 Unclassified 1760
185 Ga0207639_10042402 3300026041 Unclassified 3410
186 Ga0207639_10066712 3300026041 Bacteria 2798
187 Ga0207639_10215639 3300026041 Bacteria 1655
188 Ga0207639_10219933 3300026041 Unclassified 1640
189 Ga0207639_10298487 3300026041 Bacteria 1423
190 Ga0207639_10842050 3300026041 Bacteria 856
191 Ga0207678_10009916 3300026067 Bacteria 8360
192 Ga0207678_10100020 3300026067 Bacteria 2477
193 Ga0207678_10254182 3300026067 Bacteria 1505
194 Ga0207702_10145039 3300026078 Bacteria 2153
195 Ga0207648_10210639 3300026089 Unclassified 1725
196 Ga0207676_10351213 3300026095 Bacteria 1364
197 Ga0207674_10044545 3300026116 Bacteria 4570
198 Ga0207674_10132391 3300026116 Unclassified 2456
199 Ga0268266_10000016 3300028379 Bacteria 629101
200 Ga0268264_10000080 3300028381 Bacteria 249126
201 Ga0268264_10005139 3300028381 Bacteria 11091
202 Ga0268264_10676417 3300028381 Bacteria 1023
203 Ga0307509_10037623 3300031507 Bacteria 5289
204 Ga0307516_10402014 3300031730 Unclassified 1029
205 Ga0307413_10216783 3300031824 Unclassified 1395
206 Ga0307406_10365209 3300031901 Bacteria 1133
207 Ga0307409_100008989 3300031995 Bacteria 6108
208 Ga0307416_100000273 3300032002 Bacteria 27340
209 Ga0307414_10002514 3300032004 Bacteria 9619
210 Ga0307414_10116782 3300032004 Bacteria 2043
211 Ga0307414_10191722 3300032004 Bacteria 1654
212 Ga0307414_10422014 3300032004 Bacteria 1163
213 Ga0307414_10517401 3300032004 Bacteria 1058
214 Ga0307414_10650356 3300032004 Unclassified 950
215 Ga0307411_10134248 3300032005 Bacteria 1814
216 Ga0307415_100018632 3300032126 Bacteria 4197
217 Ga0373937_0063114 3300036401 Unclassified 3407
218 Ga0395899_0003360 3300037312 Bacteria 12693
219 Ga0395899_0005299 3300037312 Bacteria 10011
220 Ga0395899_0010446 3300037312 Bacteria 7111
221 Ga0395899_0124096 3300037312 Bacteria 1847
222 Ga0395900_0014314 3300037418 Bacteria 8097
223 Ga0395900_0048956 3300037418 Bacteria 4353
224 Ga0395900_0076173 3300037418 Bacteria 3448
225 Ga0395900_0173732 3300037418 Bacteria 2192
226 Ga0395900_0351872 3300037418 Bacteria 1446
227 Ga0395898_0004980 3300037466 Bacteria 14405
228 Ga0395898_0065291 3300037466 Bacteria 3528
229 Ga0395898_0268103 3300037466 Bacteria 1628
230 Ga0395898_0640371 3300037466 Bacteria 1005
231 Ga0395901_0002326 3300038443 Bacteria 19369
232 Ga0395901_0018130 3300038443 Bacteria 7183
233 Ga0395901_0063274 3300038443 Bacteria 3850
234 Ga0395901_0086911 3300038443 Bacteria 3269
235 Ga0395901_0235661 3300038443 Bacteria 1910
236 Ga0395901_0441203 3300038443 Bacteria 1332
237 Ga0439436_0008526 3300041404 Bacteria 3153
238 Ga0451837_0740644 3300041494 Bacteria 1343
239 Ga0451849_0697123 3300041505 Bacteria 937
240 Ga0439457_000376 3300042014 Bacteria 12585
241 Ga0439462_0026962 3300042015 Bacteria 1515
242 Ga0451577_0004215 3300042876 Bacteria 15329
243 Ga0453684_0002049 3300044712 Bacteria 51297
244 Ga0453684_0010555 3300044712 Bacteria 15763
245 Ga0466957_0070605 3300044842 Bacteria 2158
246 Ga0495645_0155963 3300046543 Bacteria 1582
247 Ga0501033_0182403 3300049570 Bacteria 1504
248 Ga0501034_0226603 3300049571 Bacteria 1820
249 Ga0501034_0234301 3300049571 Bacteria 1784
250 Ga0501046_0225333 3300049580 Bacteria 1387
251 Ga0501047_0005603 3300049581 Bacteria 11824
252 Ga0501047_0026651 3300049581 Bacteria 5563
253 Ga0501047_0213975 3300049581 Bacteria 1785
254 Ga0501047_0307665 3300049581 Unclassified 1426
255 Ga0501067_0085060 3300049583 Bacteria 1755
256 Ga0501068_0133776 3300049584 Bacteria 1552
257 Ga0501073_0232126 3300049589 Bacteria 1274
258 Ga0501073_0344228 3300049589 Bacteria 1029
259 Ga0501074_0200063 3300049590 Bacteria 1424
260 Ga0501075_0230115 3300049591 Bacteria 1414
261 Ga0501223_001805 3300049663 Bacteria 4830
262 Ga0501225_0000839 3300049705 Bacteria 9574
263 Ga0501080_0420560 3300049742 Bacteria 1200
264 Ga0501080_0699201 3300049742 Bacteria 894
265 Ga0501083_0231773 3300049744 Bacteria 1202
266 Ga0501241_003467 3300049758 Bacteria 2977
267 Ga0501035_0514790 3300049822 Bacteria 984
268 Ga0501044_0016671 3300049823 Bacteria 7889
269 Ga0501044_0330555 3300049823 Bacteria 1447
270 nmdc:mga05p37_2576_c1 3300050507 Bacteria 21082
271 Ga0500578_0134165 3300053086 Bacteria 1551
272 Ga0500644_0015358 3300053088 Bacteria 2182
273 Ga0500644_0250150 3300053088 Bacteria 747
274 Ga0500583_0000021 3300053092 Bacteria 125088
275 Ga0500583_0004443 3300053092 Bacteria 4574
276 Ga0500556_0068629 3300053104 Bacteria 1320
277 Ga0500556_0125117 3300053104 Unclassified 1005
278 Ga0500573_0172293 3300053140 Bacteria 1169
279 Ga0500588_0065522 3300053146 Bacteria 1177
280 Ga0500603_009362 3300053150 Bacteria 2192
281 Ga0500604_0019210 3300053151 Bacteria 1911
282 Ga0500619_077945 3300053154 Bacteria 1110
283 Ga0500622_0008380 3300053156 Bacteria 5785
284 Ga0500622_0096154 3300053156 Bacteria 1464
285 Ga0500637_0063005 3300053178 Bacteria 2126
286 Ga0501082_0418319 3300060353 Bacteria 1170
287 2524006411 2523533629 Bacteria 2982326
288 2738724270 2738541278 Bacteria 9755573
289 2739300357 2738543023 Bacteria 6767879
290 2819574390 2818991442 Bacteria 8318214
291 2819576737 2818991442 Bacteria 8318214
292 2819679597 2818991460 Bacteria 7595395
293 2821137713 2821136567 Bacteria 8080116
294 2904467546 2904467357 Bacteria 8057758
295 rootH2_10253433
296 rootH2_10199489
297 rootH2_10305156
298 rootL2_10061657
299 rootL2_10215156
300 rootL2_10321286
301 Ga0065165_1000023
302 Ga0065165_1000207
303 Ga0065714_10211171
304 Ga0070658_10013373
305 Ga0070658_10075397
306 Ga0070658_10158745
307 Ga0070658_10216933
308 Ga0070658_10397653
309 Ga0070658_10448565
310 Ga0070670_100019156
311 Ga0068869_100161805
312 Ga0068869_100347113
313 Ga0070680_100007046
314 Ga0070680_100019834
315 Ga0070680_100066822
316 Ga0070682_100044451
317 Ga0070682_100078509
318 Ga0070682_100162662
319 Ga0070660_100002971
320 Ga0070660_100028276
321 Ga0070660_100044729
322 Ga0070660_100163396
323 Ga0070660_100429857
324 Ga0070660_100483091
325 Ga0070675_100346313
326 Ga0070659_100008973
327 Ga0070659_100113748
328 Ga0070659_100117564
329 Ga0070659_100368441
330 Ga0070663_100002264
331 Ga0070663_100232967
332 Ga0070678_100235342
333 Ga0070681_10041535
334 Ga0070681_10055787
335 Ga0070681_10165210
336 Ga0070681_10604801
337 Ga0070681_10646512
338 Ga0068867_100280824
339 Ga0070679_100000437
340 Ga0070679_100000567
341 Ga0070679_100005121
342 Ga0070679_100151482
343 Ga0070679_100716134
344 Ga0068853_100118099
345 Ga0068853_100217688
346 Ga0068853_100225117
347 Ga0068853_100325379
348 Ga0068853_100474819
349 Ga0068853_100504250
350 Ga0070693_100024011
351 Ga0070665_100000008
352 Ga0068855_100010136
353 Ga0068855_100010743
354 Ga0068855_100011339
355 Ga0068855_100020840
356 Ga0068855_100202634
357 Ga0068855_100281624
358 Ga0068855_100385725
359 Ga0068855_100447788
360 Ga0068855_100607685
361 Ga0068855_100752568
362 Ga0068857_100134948
363 Ga0068857_100211973
364 Ga0068854_100022297
365 Ga0068854_100218700
366 Ga0068856_100041376
367 Ga0068856_100321854
368 Ga0068852_100004649
369 Ga0068852_100151473
370 Ga0068852_100157965
371 Ga0068859_100032619
372 Ga0068859_100875215
373 Ga0068866_10135291
374 Ga0068851_10359478
375 Ga0068863_100263311
376 Ga0068863_100551413
377 Ga0068858_100216510
378 Ga0068860_100000039
379 Ga0068860_100132641
380 Ga0068860_100260862
381 Ga0068860_100377841
382 Ga0068862_100404619
383 Ga0097620_100032622
384 Ga0097620_100875067
385 Ga0105240_10137467
386 Ga0114129_10002230
387 Ga0105241_10028304
388 Ga0105241_10063946
389 Ga0105241_10206092
390 Ga0105242_10768153
391 Ga0105237_10015041
392 Ga0105237_10456825
393 Ga0105239_10010295
394 Ga0105239_10235379
395 Ga0105246_10296313
396 Ga0157373_10004555
397 Ga0157373_10010171
398 Ga0157373_10161494
399 Ga0157371_10000168
400 Ga0157371_10000418
401 Ga0157371_10004651
402 Ga0157371_10005252
403 Ga0157371_10009501
404 Ga0157371_10018569
405 Ga0157371_10052158
406 Ga0157371_10078169
407 Ga0157370_10001835
408 Ga0157370_10009858
409 Ga0157370_10010194
410 Ga0157370_10037706
411 Ga0157370_10073872
412 Ga0157370_10328822
413 Ga0157369_10029119
414 Ga0157369_10064627
415 Ga0157369_10103611
416 Ga0157374_10091502
417 Ga0157374_10248613
418 Ga0157378_10141438
419 Ga0163162_10017868
420 Ga0163162_10023963
421 Ga0163162_10061566
422 Ga0157372_10038214
423 Ga0157372_10115645
424 Ga0157372_10292727
425 Ga0157372_10457205
426 Ga0157372_10557726
427 Ga0157372_10647959
428 Ga0157372_10983875
429 Ga0163163_10001087
430 Ga0182008_10018062
431 Ga0182008_10111979
432 Ga0182008_10149636
433 Ga0182007_10002833
434 Ga0209436_100569
435 Ga0209646_1007000
436 Ga0209676_1000511
437 Ga0207426_1007362
438 Ga0207647_10028716
439 Ga0207647_10112198
440 Ga0207705_10001687
441 Ga0207705_10007792
442 Ga0207705_10393857
443 Ga0207707_10008840
444 Ga0207707_10087733
445 Ga0207707_10181291
446 Ga0207707_10429923
447 Ga0207695_10007254
448 Ga0207695_10012973
449 Ga0207671_10049702
450 Ga0207660_10009238
451 Ga0207660_10028984
452 Ga0207660_10048664
453 Ga0207660_10513611
454 Ga0207657_10009510
455 Ga0207657_10038831
456 Ga0207657_10047488
457 Ga0207657_10067560
458 Ga0207657_10166534
459 Ga0207657_10177547
460 Ga0207652_10000029
461 Ga0207652_10000214
462 Ga0207652_10000585
463 Ga0207652_10003995
464 Ga0207652_10315934
465 Ga0207681_10195085
466 Ga0207650_10047401
467 Ga0207650_10131419
468 Ga0207690_10083656
469 Ga0207690_10106813
470 Ga0207686_10491550
471 Ga0207691_10033315
472 Ga0207667_10010038
473 Ga0207667_10027142
474 Ga0207667_10055978
475 Ga0207667_10090093
476 Ga0207667_10144330
477 Ga0207658_10109169
478 Ga0207703_10203687
479 Ga0207639_10042402
480 Ga0207639_10066712
481 Ga0207639_10215639
482 Ga0207639_10219933
483 Ga0207639_10298487
484 Ga0207639_10842050
485 Ga0207678_10009916
486 Ga0207678_10100020
487 Ga0207678_10254182
488 Ga0207702_10145039
489 Ga0207648_10210639
490 Ga0207676_10351213
491 Ga0207674_10044545
492 Ga0207674_10132391
493 Ga0268266_10000016
494 Ga0268264_10000080
495 Ga0268264_10005139
496 Ga0268264_10676417
497 Ga0307509_10037623
498 Ga0307516_10402014
499 Ga0307413_10216783
500 Ga0307406_10365209
501 Ga0307409_100008989
502 Ga0307416_100000273
503 Ga0307414_10002514
504 Ga0307414_10116782
505 Ga0307414_10191722
506 Ga0307414_10422014
507 Ga0307414_10517401
508 Ga0307414_10650356
509 Ga0307411_10134248
510 Ga0307415_100018632
511 Ga0373937_0063114
512 Ga0395899_0003360
513 Ga0395899_0005299
514 Ga0395899_0010446
515 Ga0395899_0124096
516 Ga0395900_0014314
517 Ga0395900_0048956
518 Ga0395900_0076173
519 Ga0395900_0173732
520 Ga0395900_0351872
521 Ga0395898_0004980
522 Ga0395898_0065291
523 Ga0395898_0268103
524 Ga0395898_0640371
525 Ga0395901_0002326
526 Ga0395901_0018130
527 Ga0395901_0063274
528 Ga0395901_0086911
529 Ga0395901_0235661
530 Ga0395901_0441203
531 Ga0439436_0008526
532 Ga0451837_0740644
533 Ga0451849_0697123
534 Ga0439457_000376
535 Ga0439462_0026962
536 Ga0451577_0004215
537 Ga0453684_0002049
538 Ga0453684_0010555
539 Ga0466957_0070605
540 Ga0495645_0155963
541 Ga0501033_0182403
542 Ga0501034_0226603
543 Ga0501034_0234301
544 Ga0501046_0225333
545 Ga0501047_0005603
546 Ga0501047_0026651
547 Ga0501047_0213975
548 Ga0501047_0307665
549 Ga0501067_0085060
550 Ga0501068_0133776
551 Ga0501073_0232126
552 Ga0501073_0344228
553 Ga0501074_0200063
554 Ga0501075_0230115
555 Ga0501223_001805
556 Ga0501225_0000839
557 Ga0501080_0420560
558 Ga0501080_0699201
559 Ga0501083_0231773
560 Ga0501241_003467
561 Ga0501035_0514790
562 Ga0501044_0016671
563 Ga0501044_0330555
564 nmdc:mga05p37_2576_c1
565 Ga0500578_0134165
566 Ga0500644_0015358
567 Ga0500644_0250150
568 Ga0500583_0000021
569 Ga0500583_0004443
570 Ga0500556_0068629
571 Ga0500556_0125117
572 Ga0500573_0172293
573 Ga0500588_0065522
574 Ga0500603_009362
575 Ga0500604_0019210
576 Ga0500619_077945
577 Ga0500622_0008380
578 Ga0500622_0096154
579 Ga0500637_0063005
580 Ga0501082_0418319
581 2524006411
582 2738724270
583 2739300357
584 2819574390
585 2819576737
586 2819679597
587 2821137713
588 2904467546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9204 2 216
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.919 2 219
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9187 1 231
7osf-assembly1.cif.gz_B abc transporter complex nosdfyl, r-domain 1 0.9073 2 217
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.9054 1 215
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9385 2 65 3.40.50.300
4rvcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9187 1 231 3.40.50.300
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9151 2 217 3.40.50.300
af_Q2G1V4_2_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9151 1 214 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9139 2 65 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5N1IPL4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9893 1 231 GO:0005524
GO:0016887
AF-A0A0B8YKH2-F1-model_v4 deleted 0.9853 1 231
AF-A0A136PCM4-F1-model_v4 ABC transporter ATPase 0.9817 1 236 GO:0005524
GO:0016887
AF-A0A3N5LJZ7-F1-model_v4 ABC transporter ATP-binding protein 0.98 1 234 GO:0005524
GO:0016887
AF-A0A6N6SQS1-F1-model_v4 ABC transporter ATP-binding protein 0.9776 1 236 GO:0005524
GO:0016887

Map