F391809

General Info

Members Datasets Scaffolds Average Seq Length
293 252 586 191

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221626|2644149447
Length 228
Sequence KTMPDEDVLAAALAIMHASGPEGLTFAALSTGTGLSASTLVQRFENKQHLVRRTLLQAWDGLDRLTSELSATLPKTPEGAVDLLVGLSGDYGGIETYADGLRILREDLRDPALRARGARWRDALSQALDERLSGPSGPVPGIGLLMASHWQGALLWWSFDPQIPVADFVRQSLRRFVSVLATGASAPPLLEVLRDWATTGPAGHPASNPRDIARGPMTRPRIHPRSNA

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
42 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
43 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
44 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
46 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
131 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 2643221626 Ensifer sp. Root31 Isolate Unclassified
133 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
134 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
135 2509276019 Ensifer aridi TW10 Isolate Nodule
136 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
137 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
138 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
139 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
140 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
141 2516143018 Ensifer sp. BR816 Isolate Nodule
142 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
143 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
144 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
145 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
146 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
147 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
148 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
149 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
150 2643221557 Ensifer sp. Root558 Isolate Unclassified
151 2643221599 Rhizobium sp. Root708 Isolate Unclassified
152 2643221610 Ensifer sp. Root74 Isolate Unclassified
153 2643221618 Ensifer sp. Root231 Isolate Unclassified
154 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
155 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
156 2643221655 Ensifer sp. Root1252 Isolate Unclassified
157 2643221659 Ensifer sp. Root127 Isolate Unclassified
158 2643221668 Ensifer sp. Root423 Isolate Unclassified
159 2643221675 Ensifer sp. Root1298 Isolate Unclassified
160 2643221680 Ensifer sp. Root1312 Isolate Unclassified
161 2643221698 Ensifer sp. Root142 Isolate Unclassified
162 2643221712 Ensifer sp. Root258 Isolate Unclassified
163 2643221723 Ensifer sp. Root278 Isolate Unclassified
164 2643221726 Ensifer sp. Root954 Isolate Unclassified
165 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
166 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
167 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
168 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
169 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
170 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
171 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
172 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
173 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
174 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
175 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
176 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
177 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
178 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
179 2844163670 Ensifer sp. 1H6 Isolate Unclassified
180 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
181 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
182 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
183 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
184 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
185 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
186 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
187 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
188 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
189 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
190 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
191 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
192 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
193 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
194 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
195 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
196 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
197 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
198 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
199 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
200 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
201 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
202 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
203 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
204 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
205 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
206 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
207 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
208 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
209 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
210 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
211 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
212 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
213 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
214 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
215 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
216 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
217 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
218 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
219 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
220 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
221 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
222 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
223 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
224 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
225 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
226 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
227 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
228 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
229 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
230 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
231 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
232 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
233 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
234 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
235 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
236 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
237 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
238 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
239 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
240 2996887358 Rhizobium sp. R711 Isolate Nodule
241 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
242 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
243 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
244 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
245 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
246 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
247 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
248 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
249 8005258706 Rhizobium sp. R693 Isolate Nodule
250 8005321885 Rhizobium sp. R72 Isolate Nodule
251 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
252 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 58.36
Metatranscriptomes 0
Isolates 41.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.53
Nodule 27.99
Rhizoplane 4.44
Rhizosphere 28.33
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10072867 3300002067 Bacteria 984
2 JGI25159J45721_1000005 3300002987 Bacteria 214315
3 JGI25160J50197_1000005 3300003354 Bacteria 417280
4 JGI25161J50226_1003600 3300003374 Bacteria 3484
5 Ga0055526_1001012 3300003771 Bacteria 20642
6 Ga0055526_1057056 3300003771 Bacteria 852
7 Ga0055524_1001474 3300003775 Bacteria 13417
8 Ga0055524_1017463 3300003775 Bacteria 2531
9 Ga0055524_1032176 3300003775 Bacteria 1492
10 Ga0055536_1000418 3300003781 Bacteria 30560
11 Ga0055528_1015354 3300003790 Bacteria 2772
12 Ga0055543_1000091 3300004625 Bacteria 79152
13 Ga0065165_1000002 3300005262 Bacteria 444192
14 Ga0070674_100043615 3300005356 Bacteria 3052
15 Ga0070700_100601800 3300005441 Bacteria 861
16 Ga0070663_100312568 3300005455 Bacteria 1261
17 Ga0070663_100599411 3300005455 Bacteria 926
18 Ga0070662_100597185 3300005457 Bacteria 928
19 Ga0068867_100136554 3300005459 Bacteria 1912
20 Ga0068853_100030459 3300005539 Bacteria 4557
21 Ga0068853_100406992 3300005539 Bacteria 1274
22 Ga0070665_100063197 3300005548 Bacteria 3712
23 Ga0070665_100171099 3300005548 Bacteria 2173
24 Ga0070665_100977920 3300005548 Bacteria 859
25 Ga0068857_100121601 3300005577 Bacteria 2351
26 Ga0068861_100172732 3300005719 Bacteria 1793
27 Ga0068862_100010406 3300005844 Bacteria 7679
28 Ga0081538_10009734 3300005981 Bacteria 7969
29 Ga0075365_10036339 3300006038 Bacteria 3191
30 Ga0075365_10078106 3300006038 Bacteria 2238
31 Ga0075365_10168984 3300006038 Bacteria 1526
32 Ga0075365_10209891 3300006038 Bacteria 1365
33 Ga0075365_10387055 3300006038 Bacteria 986
34 Ga0075368_10019033 3300006042 Bacteria 2588
35 Ga0075368_10068612 3300006042 Bacteria 1429
36 Ga0075362_10086535 3300006177 Bacteria 1450
37 Ga0075362_10189240 3300006177 Bacteria 999
38 Ga0075367_10005878 3300006178 Bacteria 6150
39 Ga0075369_10021091 3300006186 Bacteria 2673
40 Ga0075369_10104287 3300006186 Bacteria 1274
41 Ga0075431_100632650 3300006847 Bacteria 1052
42 Ga0105251_10015264 3300009011 Bacteria 4206
43 Ga0105240_10644810 3300009093 Bacteria 1161
44 Ga0111539_10428141 3300009094 Bacteria 1541
45 Ga0111539_10528409 3300009094 Bacteria 1374
46 Ga0114129_11517144 3300009147 Unclassified 823
47 Ga0105248_10087025 3300009177 Bacteria 3516
48 Ga0105237_10011641 3300009545 Bacteria 9308
49 Ga0105238_10012461 3300009551 Bacteria 8575
50 Ga0105249_10066117 3300009553 Bacteria 3328
51 Ga0123342_1026302 3300009766 Bacteria 3397
52 Ga0105239_10018970 3300010375 Bacteria 7602
53 Ga0105239_11350323 3300010375 Bacteria 823
54 Ga0105246_11904815 3300011119 Bacteria 571
55 Ga0171463_1002 3300013249 Bacteria 1274851
56 Ga0157380_10118591 3300014326 Bacteria 2237
57 Ga0183363_1183 3300015690 Bacteria 13486
58 Ga0214542_1025524 3300021321 Bacteria 3067
59 Ga0214543_1002177 3300021327 Bacteria 38571
60 Ga0209436_101266 3300025208 Bacteria 9072
61 Ga0209129_1003039 3300025258 Bacteria 7611
62 Ga0209565_1043148 3300025263 Bacteria 833
63 Ga0209673_1002507 3300025273 Bacteria 12620
64 Ga0209673_1049198 3300025273 Bacteria 1129
65 Ga0209130_1000010 3300025284 Bacteria 444920
66 Ga0209130_1024822 3300025284 Bacteria 1304
67 Ga0209130_1025166 3300025284 Bacteria 1291
68 Ga0209676_1000528 3300025292 Bacteria 59750
69 Ga0209676_1011162 3300025292 Bacteria 3652
70 Ga0209025_1000234 3300025294 Bacteria 130341
71 Ga0209025_1027296 3300025294 Bacteria 2835
72 Ga0209564_1000025 3300025295 Bacteria 520535
73 Ga0209564_1004838 3300025295 Bacteria 8013
74 Ga0209564_1050330 3300025295 Bacteria 1021
75 Ga0209758_1012331 3300025297 Bacteria 4796
76 Ga0209758_1059552 3300025297 Bacteria 1270
77 Ga0209050_1033449 3300025298 Bacteria 1558
78 Ga0209256_1000209 3300025299 Bacteria 110253
79 Ga0209256_1000311 3300025299 Bacteria 84751
80 Ga0209256_1006586 3300025299 Bacteria 6082
81 Ga0209256_1039574 3300025299 Bacteria 1211
82 Ga0207426_1000036 3300025302 Bacteria 444920
83 Ga0207426_1002008 3300025302 Bacteria 14361
84 Ga0209257_1000902 3300025304 Bacteria 41639
85 Ga0207713_1021502 3300025735 Bacteria 3090
86 Ga0207647_10207154 3300025904 Bacteria 1133
87 Ga0207695_10435384 3300025913 Unclassified 1195
88 Ga0207671_10060084 3300025914 Bacteria 2820
89 Ga0207706_10924014 3300025933 Bacteria 736
90 Ga0207669_10813375 3300025937 Bacteria 776
91 Ga0207712_10612729 3300025961 Bacteria 943
92 Ga0207668_10658953 3300025972 Bacteria 917
93 Ga0207639_10069565 3300026041 Bacteria 2747
94 Ga0207678_10236329 3300026067 Bacteria 1565
95 Ga0207674_10116090 3300026116 Bacteria 2648
96 Ga0207675_100105005 3300026118 Bacteria 2662
97 Ga0209813_10088546 3300027866 Bacteria 1035
98 Ga0207428_10000086 3300027907 Bacteria 131832
99 Ga0268266_10227611 3300028379 Bacteria 1716
100 Ga0307515_10130507 3300028794 Bacteria 2772
101 Ga0307513_10513625 3300031456 Bacteria 914
102 Ga0307408_100100119 3300031548 Bacteria 2207
103 Ga0307516_10193673 3300031730 Bacteria 1757
104 Ga0307413_10012905 3300031824 Bacteria 4177
105 Ga0307410_10020424 3300031852 Bacteria 4051
106 Ga0307406_10095149 3300031901 Bacteria 2015
107 Ga0307407_10041589 3300031903 Bacteria 2571
108 Ga0307409_100050588 3300031995 Bacteria 3174
109 Ga0307416_100334911 3300032002 Bacteria 1523
110 Ga0307411_10081594 3300032005 Bacteria 2227
111 Ga0307411_11202423 3300032005 Unclassified 687
112 Ga0307415_100181228 3300032126 Bacteria 1653
113 Ga0395900_0454158 3300037418 Bacteria 1237
114 Ga0395905_0036462 3300037471 Bacteria 4618
115 Ga0451789_0134549 3300041443 Bacteria 725
116 Ga0451849_0456305 3300041505 Bacteria 1575
117 Ga0439449_0043137 3300042007 Bacteria 1675
118 Ga0495638_0016189 3300046460 Bacteria 4998
119 Ga0495585_0011716 3300046492 Bacteria 5185
120 Ga0495585_0141785 3300046492 Bacteria 1258
121 Ga0495583_0002390 3300046506 Bacteria 16164
122 Ga0495606_0087829 3300046507 Bacteria 1918
123 Ga0495656_0048341 3300046615 Bacteria 1807
124 Ga0495625_0142498 3300046660 Bacteria 1616
125 Ga0495625_0163498 3300046660 Bacteria 1490
126 Ga0495625_0309279 3300046660 Bacteria 1009
127 Ga0495687_087688 3300047443 Bacteria 1200
128 Ga0495681_0099877 3300047470 Bacteria 1270
129 Ga0495686_0110471 3300047472 Bacteria 1649
130 Ga0495615_0024887 3300048090 Bacteria 1385
131 Ga0496102_0148082 3300048905 Bacteria 2204
132 Ga0496103_0059162 3300048906 Bacteria 2381
133 Ga0496104_0453539 3300048907 Bacteria 1194
134 Ga0496105_0392166 3300048908 Bacteria 1103
135 Ga0496106_0378645 3300048909 Bacteria 1137
136 Ga0496107_0583831 3300048910 Bacteria 827
137 Ga0496108_0491203 3300048911 Bacteria 1072
138 Ga0496110_0132161 3300048913 Bacteria 2254
139 Ga0496111_0153710 3300048914 Bacteria 1707
140 Ga0496113_0068177 3300048916 Bacteria 2699
141 Ga0496114_0361248 3300048917 Bacteria 1284
142 Ga0496118_0055261 3300048921 Bacteria 2998
143 Ga0496119_0067176 3300048922 Bacteria 2115
144 Ga0496119_0083223 3300048922 Bacteria 1838
145 Ga0496120_0155934 3300048923 Bacteria 1143
146 Ga0496121_0243914 3300048924 Bacteria 1250
147 Ga0496122_0103983 3300048925 Bacteria 1888
148 Ga0496123_0066321 3300048926 Bacteria 2287
149 Ga0496124_0050009 3300048927 Bacteria 3563
150 Ga0496124_0635353 3300048927 Unclassified 688
151 Ga0496125_0016876 3300048928 Bacteria 6991
152 nmdc:mga03683_29790_c1 3300050489 Bacteria 2179
153 nmdc:mga00v17_48292_c1 3300050491 Bacteria 2579
154 nmdc:mga0yw44_127720_c1 3300050492 Bacteria 1643
155 nmdc:mga0yw44_37710_c1 3300050492 Bacteria 2855
156 nmdc:mga0k408_205710_c1 3300050493 Bacteria 1175
157 nmdc:mga06z11_230246_c1 3300050494 Bacteria 1085
158 nmdc:mga06z11_80921_c1 3300050494 Bacteria 1743
159 nmdc:mga04h51_28187_c1 3300050495 Bacteria 1750
160 nmdc:mga07m45_303988_c1 3300050496 Bacteria 927
161 nmdc:mga06r32_290202_c1 3300050510 Bacteria 1622
162 nmdc:mga08y16_268_c1 3300050511 Bacteria 47257
163 nmdc:mga08y16_324282_c1 3300050511 Bacteria 1585
164 nmdc:mga0sz30_12621_c1 3300050516 Bacteria 2351
165 nmdc:mga0sz30_27225_c1 3300050516 Bacteria 1508
166 Ga0500595_028707 3300053119 Bacteria 1895
167 Ga0500658_0215923 3300053134 Bacteria 879
168 Ga0500627_0056289 3300053158 Bacteria 1723
169 Ga0500627_0082298 3300053158 Bacteria 1436
170 Ga0500627_0293096 3300053158 Bacteria 712
171 Ga0590075_036794 3300059424 Bacteria 1248
172 2644149447 2643221626 Bacteria 8069654
173 2509110950 2508501122 Bacteria 6292184
174 2509142456 2508501127 Bacteria 7037543
175 2509376341 2509276019 Bacteria 6802256
176 2510318767 2510065059 Bacteria 6847884
177 2511186489 2510917028 Bacteria 6185411
178 2513865759 2513237138 Bacteria 7368160
179 2514417274 2513237305 Bacteria 7293571
180 2514586048 2513237351 Bacteria 6968952
181 2516209877 2516143018 Bacteria 6951533
182 2535515564 2534681796 Bacteria 7146037
183 2558867834 2558860100 Bacteria 8458965
184 2585202928 2582581294 Bacteria 6626667
185 2585230543 2582581299 Bacteria 6518058
186 2585392167 2582581866 Bacteria 6859583
187 2585400282 2582581867 Bacteria 7184437
188 2585823006 2585427590 Bacteria 6824633
189 2600196410 2599185352 Bacteria 7228948
190 2643809278 2643221557 Bacteria 7184309
191 2644007767 2643221599 Bacteria 6292121
192 2644069266 2643221610 Bacteria 7480339
193 2644104078 2643221618 Bacteria 7717186
194 2644191032 2643221634 Bacteria 6705461
195 2644242739 2643221643 Bacteria 5749658
196 2644306951 2643221655 Bacteria 7722067
197 2644337298 2643221659 Bacteria 7890716
198 2644379841 2643221668 Bacteria 7306521
199 2644420419 2643221675 Bacteria 7473456
200 2644453945 2643221680 Bacteria 7473610
201 2644540397 2643221698 Bacteria 7756764
202 2644619190 2643221712 Bacteria 7729434
203 2644674890 2643221723 Bacteria 7095460
204 2644686282 2643221726 Bacteria 7455827
205 2692315665 2690316117 Bacteria 6800650
206 2723574128 2721755686 Bacteria 7343952
207 2753460362 2751185821 Bacteria 6189929
208 2756670943 2756170246 Bacteria 7451806
209 2776270017 2775506902 Bacteria 6208009
210 2776281321 2775506904 Bacteria 5954060
211 2792620328 2791355091 Bacteria 6135441
212 2792626254 2791355092 Bacteria 6248105
213 2792639196 2791355094 Bacteria 7011481
214 2821450230 2821443989 Bacteria 7658172
215 2838077021 2838074704 Bacteria 6785777
216 2840765576 2840764183 Bacteria 6358399
217 2844004697 2844002411 Bacteria 7168230
218 2844008965 2844002411 Bacteria 7168230
219 2844012320 2844009547 Bacteria 6728125
220 2844170885 2844163670 Bacteria 7266046
221 2847419275 2847417321 Bacteria 6913799
222 2848994298 2848992105 Bacteria 6810864
223 2850081309 2850079185 Bacteria 6848280
224 2855875931 2855872281 Bacteria 6964271
225 2869175180 2869169390 Bacteria 6659796
226 2869241676 2869234852 Bacteria 6654993
227 2869249200 2869242130 Bacteria 6609239
228 2869262922 2869256925 Bacteria 6981691
229 2869285640 2869278585 Bacteria 7077053
230 2871473285 2871466892 Bacteria 6923287
231 2871486420 2871481445 Bacteria 6700002
232 2874112428 2874109183 Bacteria 6517025
233 2874122760 2874116593 Bacteria 6674494
234 2874142021 2874139085 Bacteria 7021506
235 2876382000 2876377896 Bacteria 6565995
236 2876387066 2876386047 Bacteria 6698674
237 2876422196 2876420981 Bacteria 6687741
238 2878732898 2878730984 Bacteria 6380721
239 2878744795 2878738818 Bacteria 7136951
240 2878796184 2878788777 Bacteria 6567085
241 2896389125 2896384573 Bacteria 7700774
242 2903517273 2903513507 Bacteria 6344008
243 2906380611 2906378014 Bacteria 6911440
244 2906407975 2906401398 Bacteria 6693206
245 2906427806 2906427513 Bacteria 6375796
246 2920761758 2920760137 Bacteria 7427611
247 2920827807 2920822456 Bacteria 6897201
248 2923557712 2923556063 Bacteria 6793593
249 2924711478 2924710171 Bacteria 6752351
250 2924722099 2924718760 Bacteria 6331356
251 2924745399 2924741084 Bacteria 6661321
252 2924782826 2924776078 Bacteria 7492003
253 2937840291 2937836603 Bacteria 6811263
254 2937863408 2937861824 Bacteria 6660327
255 2937977557 2937972304 Bacteria 7532020
256 2937985326 2937980651 Bacteria 6517427
257 2938018563 2938014810 Bacteria 6700592
258 2941502519 2941499720 Bacteria 7599444
259 2958041655 2958034702 Bacteria 6989922
260 2958047963 2958041894 Bacteria 13082850
261 2958070650 2958064165 Bacteria 7158582
262 2958071500 2958071322 Bacteria 6815895
263 2958093730 2958092219 Bacteria 6861151
264 2958113614 2958108152 Bacteria 6681128
265 2958148018 2958144490 Bacteria 6677056
266 2961185870 2961183825 Bacteria 6688536
267 2968020473 2968016561 Bacteria 7022047
268 2968143101 2968138860 Bacteria 6605449
269 2970473770 2970469710 Bacteria 6969209
270 2970490417 2970489779 Bacteria 6517260
271 2970518096 2970510686 Bacteria 7006402
272 2970534700 2970532167 Bacteria 6553173
273 2970600256 2970593180 Bacteria 7073582
274 2970620156 2970619444 Bacteria 6986144
275 2970633042 2970627176 Bacteria 6680862
276 2977854170 2977851361 Bacteria 6694324
277 2977902986 2977898635 Bacteria 6675551
278 2977907682 2977907340 Bacteria 6577984
279 2979776679 2979772303 Bacteria 6618277
280 2996352907 2996348954 Bacteria 7239054
281 2996889496 2996887358 Bacteria 5795980
282 3004234109 3004232784 Bacteria 6662140
283 3004252575 3004248173 Bacteria 6563236
284 3004279589 3004275668 Bacteria 7114440
285 3004294967 3004289098 Bacteria 6135450
286 3005453284 3005452660 Bacteria 5889319
287 643826162 643692032 Bacteria 6891900
288 8004314694 8004312739 Bacteria 7444653
289 8004730232 8004727605 Bacteria 6643904
290 8005260845 8005258706 Bacteria 6184835
291 8005324023 8005321885 Bacteria 5795980
292 8005544192 8005542996 Bacteria 7077758
293 8046772887 8046767195 Bacteria 7547379
294 JGI24735J21928_10072867
295 JGI25159J45721_1000005
296 JGI25160J50197_1000005
297 JGI25161J50226_1003600
298 Ga0055526_1001012
299 Ga0055526_1057056
300 Ga0055524_1001474
301 Ga0055524_1017463
302 Ga0055524_1032176
303 Ga0055536_1000418
304 Ga0055528_1015354
305 Ga0055543_1000091
306 Ga0065165_1000002
307 Ga0070674_100043615
308 Ga0070700_100601800
309 Ga0070663_100312568
310 Ga0070663_100599411
311 Ga0070662_100597185
312 Ga0068867_100136554
313 Ga0068853_100030459
314 Ga0068853_100406992
315 Ga0070665_100063197
316 Ga0070665_100171099
317 Ga0070665_100977920
318 Ga0068857_100121601
319 Ga0068861_100172732
320 Ga0068862_100010406
321 Ga0081538_10009734
322 Ga0075365_10036339
323 Ga0075365_10078106
324 Ga0075365_10168984
325 Ga0075365_10209891
326 Ga0075365_10387055
327 Ga0075368_10019033
328 Ga0075368_10068612
329 Ga0075362_10086535
330 Ga0075362_10189240
331 Ga0075367_10005878
332 Ga0075369_10021091
333 Ga0075369_10104287
334 Ga0075431_100632650
335 Ga0105251_10015264
336 Ga0105240_10644810
337 Ga0111539_10428141
338 Ga0111539_10528409
339 Ga0114129_11517144
340 Ga0105248_10087025
341 Ga0105237_10011641
342 Ga0105238_10012461
343 Ga0105249_10066117
344 Ga0123342_1026302
345 Ga0105239_10018970
346 Ga0105239_11350323
347 Ga0105246_11904815
348 Ga0171463_1002
349 Ga0157380_10118591
350 Ga0183363_1183
351 Ga0214542_1025524
352 Ga0214543_1002177
353 Ga0209436_101266
354 Ga0209129_1003039
355 Ga0209565_1043148
356 Ga0209673_1002507
357 Ga0209673_1049198
358 Ga0209130_1000010
359 Ga0209130_1024822
360 Ga0209130_1025166
361 Ga0209676_1000528
362 Ga0209676_1011162
363 Ga0209025_1000234
364 Ga0209025_1027296
365 Ga0209564_1000025
366 Ga0209564_1004838
367 Ga0209564_1050330
368 Ga0209758_1012331
369 Ga0209758_1059552
370 Ga0209050_1033449
371 Ga0209256_1000209
372 Ga0209256_1000311
373 Ga0209256_1006586
374 Ga0209256_1039574
375 Ga0207426_1000036
376 Ga0207426_1002008
377 Ga0209257_1000902
378 Ga0207713_1021502
379 Ga0207647_10207154
380 Ga0207695_10435384
381 Ga0207671_10060084
382 Ga0207706_10924014
383 Ga0207669_10813375
384 Ga0207712_10612729
385 Ga0207668_10658953
386 Ga0207639_10069565
387 Ga0207678_10236329
388 Ga0207674_10116090
389 Ga0207675_100105005
390 Ga0209813_10088546
391 Ga0207428_10000086
392 Ga0268266_10227611
393 Ga0307515_10130507
394 Ga0307513_10513625
395 Ga0307408_100100119
396 Ga0307516_10193673
397 Ga0307413_10012905
398 Ga0307410_10020424
399 Ga0307406_10095149
400 Ga0307407_10041589
401 Ga0307409_100050588
402 Ga0307416_100334911
403 Ga0307411_10081594
404 Ga0307411_11202423
405 Ga0307415_100181228
406 Ga0395900_0454158
407 Ga0395905_0036462
408 Ga0451789_0134549
409 Ga0451849_0456305
410 Ga0439449_0043137
411 Ga0495638_0016189
412 Ga0495585_0011716
413 Ga0495585_0141785
414 Ga0495583_0002390
415 Ga0495606_0087829
416 Ga0495656_0048341
417 Ga0495625_0142498
418 Ga0495625_0163498
419 Ga0495625_0309279
420 Ga0495687_087688
421 Ga0495681_0099877
422 Ga0495686_0110471
423 Ga0495615_0024887
424 Ga0496102_0148082
425 Ga0496103_0059162
426 Ga0496104_0453539
427 Ga0496105_0392166
428 Ga0496106_0378645
429 Ga0496107_0583831
430 Ga0496108_0491203
431 Ga0496110_0132161
432 Ga0496111_0153710
433 Ga0496113_0068177
434 Ga0496114_0361248
435 Ga0496118_0055261
436 Ga0496119_0067176
437 Ga0496119_0083223
438 Ga0496120_0155934
439 Ga0496121_0243914
440 Ga0496122_0103983
441 Ga0496123_0066321
442 Ga0496124_0050009
443 Ga0496124_0635353
444 Ga0496125_0016876
445 nmdc:mga03683_29790_c1
446 nmdc:mga00v17_48292_c1
447 nmdc:mga0yw44_127720_c1
448 nmdc:mga0yw44_37710_c1
449 nmdc:mga0k408_205710_c1
450 nmdc:mga06z11_230246_c1
451 nmdc:mga06z11_80921_c1
452 nmdc:mga04h51_28187_c1
453 nmdc:mga07m45_303988_c1
454 nmdc:mga06r32_290202_c1
455 nmdc:mga08y16_268_c1
456 nmdc:mga08y16_324282_c1
457 nmdc:mga0sz30_12621_c1
458 nmdc:mga0sz30_27225_c1
459 Ga0500595_028707
460 Ga0500658_0215923
461 Ga0500627_0056289
462 Ga0500627_0082298
463 Ga0500627_0293096
464 Ga0590075_036794
465 2644149447
466 2509110950
467 2509142456
468 2509376341
469 2510318767
470 2511186489
471 2513865759
472 2514417274
473 2514586048
474 2516209877
475 2535515564
476 2558867834
477 2585202928
478 2585230543
479 2585392167
480 2585400282
481 2585823006
482 2600196410
483 2643809278
484 2644007767
485 2644069266
486 2644104078
487 2644191032
488 2644242739
489 2644306951
490 2644337298
491 2644379841
492 2644420419
493 2644453945
494 2644540397
495 2644619190
496 2644674890
497 2644686282
498 2692315665
499 2723574128
500 2753460362
501 2756670943
502 2776270017
503 2776281321
504 2792620328
505 2792626254
506 2792639196
507 2821450230
508 2838077021
509 2840765576
510 2844004697
511 2844008965
512 2844012320
513 2844170885
514 2847419275
515 2848994298
516 2850081309
517 2855875931
518 2869175180
519 2869241676
520 2869249200
521 2869262922
522 2869285640
523 2871473285
524 2871486420
525 2874112428
526 2874122760
527 2874142021
528 2876382000
529 2876387066
530 2876422196
531 2878732898
532 2878744795
533 2878796184
534 2896389125
535 2903517273
536 2906380611
537 2906407975
538 2906427806
539 2920761758
540 2920827807
541 2923557712
542 2924711478
543 2924722099
544 2924745399
545 2924782826
546 2937840291
547 2937863408
548 2937977557
549 2937985326
550 2938018563
551 2941502519
552 2958041655
553 2958047963
554 2958070650
555 2958071500
556 2958093730
557 2958113614
558 2958148018
559 2961185870
560 2968020473
561 2968143101
562 2970473770
563 2970490417
564 2970518096
565 2970534700
566 2970600256
567 2970620156
568 2970633042
569 2977854170
570 2977902986
571 2977907682
572 2979776679
573 2996352907
574 2996889496
575 3004234109
576 3004252575
577 3004279589
578 3004294967
579 3005453284
580 643826162
581 8004314694
582 8004730232
583 8005260845
584 8005324023
585 8005544192
586 8046772887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

8

54

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u18-assembly1.cif.gz_B directed evolution of a biosensor selective for the macrolide antibiotic clarithromycin 0.8026 7 187
3frq-assembly1.cif.gz_B structure of the macrolide biosensor protein, mphr(a), with erythromcyin 0.8 7 187
3g56-assembly1.cif.gz_B structure of the macrolide biosensor protein, mphr(a) 0.7948 7 184
2np5-assembly1.cif.gz_A crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1. 0.7826 8 184
3e7q-assembly1.cif.gz_A the crystal structure of the putative transcriptional regulator from pseudomonas aeruginosa pao1 0.7688 11 186
ID Description Score Start End Superfamily
3vprB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9272 7 48 1.10.10.60
3vprB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9078 7 48 1.10.10.60
1vi0A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9037 12 48 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8895 11 57 1.10.10.60
2vkvA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.888 12 65 1.10.10.60
ID Description Score Start End GO Terms
AF-F7UBR2-F1-model_v4 deleted 0.9696 23 186
AF-A0A068SZS2-F1-model_v4 HTH tetR-type domain-containing protein 0.9661 1 95
AF-A0A845AC47-F1-model_v4 TetR family transcriptional regulator 0.9593 1 183 GO:0003677
AF-A0A7V6PF40-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9538 48 184
AF-A0A367WWZ8-F1-model_v4 TetR family transcriptional regulator 0.9532 1 184 GO:0003677

Map