F391808

General Info

Members Datasets Scaffolds Average Seq Length
293 172 586 490

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221567|2643849730
Length 550
Sequence VETGRITTDIPARLDRLPWARWHWMVVIGLGTVWILDGLEVTIVGSMSEALKPTDTGLGLSSSDIGMAGAVYVAGACLGALFFGQLTDKFGRKKLFLLTLGVYTVATVLTAFAPNPLWYFIARFLTGMGIGGEYAAINSAIDELIPKKYRGRVDVAINGSFWIGAALGSLLTIPLLDPKVLDPAIGWRLAFGLGAILAVGILVVRRHVPESPRWLFIHGREDEGETIVKQIEGTVAEETGRDLPTIDDEPITIRQRRTISIPEIAKTVFTLYPRRTVLCFLLFVGQAFLYNAFFFTYGDSLTTFFGVKQTGWYIAIFAVSNFAGALLLSPLFDSIGRVRMIAGTYLLSGVLLAIAGFSLGGLSAVTLTLFGVVIFFFASAGASAAYLTASEVFPLETRALCIAFFYAIGTAAGGISGPLLFGKLIDDASASKDITGLAVGYFLGAALMVIGGLAEAFLGVKAEGQSLESIAQPLTADEADSDGGPGDQGTGRGPRQXXAPVPNGTGASARPPPDEGHGDRAQTGAPGTIRRFAETKRRSGAIPERRRIRP

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
164 2643221615 Nocardioides sp. Root224 Isolate Unclassified
165 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
166 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
167 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
168 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
169 2739367898 Nocardioides sp. CF479 Isolate Unclassified
170 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
171 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
172 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 1.02
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 12.97
Rhizosphere 73.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001997 3300000546 Bacteria 2616
2 JGI24740J21852_10015433 3300001979 Bacteria 2789
3 JGI24743J22301_10006489 3300001991 Bacteria 1996
4 Ga0070683_100000230 3300005329 Bacteria 38094
5 Ga0070683_100027640 3300005329 Bacteria 5119
6 Ga0070683_100078055 3300005329 Bacteria 3097
7 Ga0070683_100149819 3300005329 Bacteria 2212
8 Ga0070682_100014374 3300005337 Bacteria 4573
9 Ga0068868_100026195 3300005338 Bacteria 4441
10 Ga0070660_100007743 3300005339 Bacteria 7492
11 Ga0070692_10028793 3300005345 Bacteria 2764
12 Ga0070669_100009901 3300005353 Bacteria 6788
13 Ga0070667_100000022 3300005367 Bacteria 204861
14 Ga0070667_100159297 3300005367 Bacteria 1987
15 Ga0070700_100002368 3300005441 Bacteria 9598
16 Ga0070662_100091694 3300005457 Bacteria 2282
17 Ga0068867_100002039 3300005459 Bacteria 14139
18 Ga0068867_100198576 3300005459 Bacteria 1604
19 Ga0070679_100009609 3300005530 Bacteria 9149
20 Ga0068853_100024083 3300005539 Bacteria 5102
21 Ga0070665_100001640 3300005548 Bacteria 25777
22 Ga0070665_100001890 3300005548 Bacteria 23714
23 Ga0070702_100015045 3300005615 Bacteria 3940
24 Ga0070702_100068465 3300005615 Bacteria 2089
25 Ga0068859_100000329 3300005617 Bacteria 47329
26 Ga0068866_10008724 3300005718 Bacteria 4285
27 Ga0068866_10075594 3300005718 Bacteria 1794
28 Ga0068861_100083545 3300005719 Bacteria 2505
29 Ga0068870_10005698 3300005840 Bacteria 5453
30 Ga0068863_100000324 3300005841 Bacteria 48340
31 Ga0068858_100012487 3300005842 Bacteria 8011
32 Ga0068860_100000038 3300005843 Bacteria 232936
33 Ga0068860_100016142 3300005843 Bacteria 7286
34 Ga0068862_100000084 3300005844 Bacteria 112100
35 Ga0081538_10000936 3300005981 Bacteria 31509
36 Ga0075365_10037201 3300006038 Bacteria 3158
37 Ga0075365_10079505 3300006038 Bacteria 2219
38 Ga0075368_10001560 3300006042 Bacteria 7352
39 Ga0075363_100003492 3300006048 Bacteria 6693
40 Ga0075363_100023386 3300006048 Bacteria 3131
41 Ga0075364_10021339 3300006051 Bacteria 4081
42 Ga0075364_10056398 3300006051 Bacteria 2572
43 Ga0075370_10018608 3300006353 Bacteria 3770
44 Ga0075370_10048223 3300006353 Bacteria 2413
45 Ga0075370_10068843 3300006353 Bacteria 2022
46 Ga0068865_100015376 3300006881 Bacteria 4880
47 Ga0097620_100000329 3300006931 Bacteria 47329
48 Ga0105245_10007733 3300009098 Bacteria 9412
49 Ga0105245_10016035 3300009098 Bacteria 6528
50 Ga0105247_10000021 3300009101 Bacteria 229443
51 Ga0105243_10039663 3300009148 Bacteria 3673
52 Ga0105243_10042560 3300009148 Bacteria 3556
53 Ga0105242_10015017 3300009176 Bacteria 6004
54 Ga0105248_10000130 3300009177 Bacteria 87417
55 Ga0105248_10060403 3300009177 Bacteria 4255
56 Ga0105248_10065495 3300009177 Bacteria 4079
57 Ga0105249_10000060 3300009553 Bacteria 153462
58 Ga0105249_10043345 3300009553 Bacteria 4092
59 Ga0105239_10049538 3300010375 Bacteria 4606
60 Ga0105239_10076363 3300010375 Bacteria 3685
61 Ga0105246_10000798 3300011119 Bacteria 17873
62 Ga0157369_10269076 3300013105 Bacteria 1776
63 Ga0163162_10024071 3300013306 Bacteria 6009
64 Ga0163162_10073690 3300013306 Bacteria 3471
65 Ga0157372_10001996 3300013307 Bacteria 22167
66 Ga0157372_10069617 3300013307 Bacteria 3957
67 Ga0157375_10188377 3300013308 Bacteria 2217
68 Ga0163163_10031265 3300014325 Bacteria 5138
69 Ga0163163_10044091 3300014325 Bacteria 4375
70 Ga0163163_10242024 3300014325 Bacteria 1854
71 Ga0157380_10006999 3300014326 Bacteria 7986
72 Ga0157380_10044024 3300014326 Bacteria 3496
73 Ga0157379_10013539 3300014968 Bacteria 7148
74 Ga0207710_10000027 3300025900 Bacteria 307001
75 Ga0207688_10006897 3300025901 Bacteria 6181
76 Ga0207647_10052497 3300025904 Bacteria 2516
77 Ga0207643_10036685 3300025908 Bacteria 2749
78 Ga0207657_10105954 3300025919 Bacteria 2327
79 Ga0207652_10028524 3300025921 Bacteria 4658
80 Ga0207681_10001051 3300025923 Bacteria 17912
81 Ga0207687_10010643 3300025927 Bacteria 6010
82 Ga0207687_10045873 3300025927 Bacteria 3023
83 Ga0207687_10115782 3300025927 Bacteria 1997
84 Ga0207690_10147276 3300025932 Bacteria 1742
85 Ga0207706_10006123 3300025933 Bacteria 11175
86 Ga0207709_10009405 3300025935 Bacteria 5377
87 Ga0207704_10016445 3300025938 Bacteria 3802
88 Ga0207691_10003318 3300025940 Bacteria 15676
89 Ga0207691_10081111 3300025940 Bacteria 2917
90 Ga0207711_10000089 3300025941 Bacteria 97575
91 Ga0207711_10018383 3300025941 Bacteria 5811
92 Ga0207661_10059808 3300025944 Bacteria 3072
93 Ga0207679_10042177 3300025945 Bacteria 3278
94 Ga0207679_10163347 3300025945 Bacteria 1826
95 Ga0207667_10244857 3300025949 Bacteria 1834
96 Ga0207712_10000051 3300025961 Bacteria 153466
97 Ga0207712_10031141 3300025961 Bacteria 3590
98 Ga0207658_10001841 3300025986 Bacteria 15881
99 Ga0207658_10196431 3300025986 Bacteria 1681
100 Ga0207708_10000904 3300026075 Bacteria 22288
101 Ga0207708_10009470 3300026075 Bacteria 7215
102 Ga0207702_10052015 3300026078 Bacteria 3464
103 Ga0207641_10001014 3300026088 Bacteria 28540
104 Ga0207648_10003186 3300026089 Bacteria 17286
105 Ga0207648_10124514 3300026089 Bacteria 2267
106 Ga0207674_10004941 3300026116 Bacteria 15927
107 Ga0207675_100007862 3300026118 Bacteria 10062
108 Ga0207675_100013512 3300026118 Bacteria 7620
109 Ga0207675_100014118 3300026118 Bacteria 7449
110 Ga0209813_10013832 3300027866 Bacteria 2162
111 Ga0268266_10001775 3300028379 Bacteria 24472
112 Ga0268265_10000028 3300028380 Bacteria 236467
113 Ga0268264_10000092 3300028381 Bacteria 232950
114 Ga0268264_10019379 3300028381 Bacteria 5560
115 Ga0307410_10114062 3300031852 Bacteria 1960
116 Ga0307407_10026746 3300031903 Bacteria 3060
117 Ga0307407_10039632 3300031903 Bacteria 2621
118 Ga0307409_100010836 3300031995 Bacteria 5703
119 Ga0307409_100015194 3300031995 Bacteria 5042
120 Ga0307409_100116011 3300031995 Bacteria 2256
121 Ga0307409_100173599 3300031995 Bacteria 1900
122 Ga0307416_100008730 3300032002 Bacteria 6566
123 Ga0307416_100034283 3300032002 Bacteria 3861
124 Ga0307411_10046930 3300032005 Bacteria 2789
125 Ga0307415_100000153 3300032126 Bacteria 30563
126 Ga0307415_100026007 3300032126 Bacteria 3684
127 Ga0307415_100050116 3300032126 Bacteria 2827
128 Ga0395901_0047154 3300038443 Bacteria 4474
129 Ga0395901_0060596 3300038443 Bacteria 3938
130 Ga0395901_0156730 3300038443 Bacteria 2392
131 Ga0466972_0017805 3300044658 Bacteria 3555
132 Ga0466972_0030075 3300044658 Bacteria 2674
133 Ga0466965_0006847 3300044683 Bacteria 5209
134 Ga0466965_0012918 3300044683 Bacteria 3933
135 Ga0466966_0117981 3300044684 Bacteria 1632
136 Ga0466961_0026400 3300044693 Bacteria 3734
137 Ga0466963_0010442 3300044694 Bacteria 5621
138 Ga0466963_0083677 3300044694 Bacteria 2164
139 Ga0466964_0004994 3300044706 Bacteria 4901
140 Ga0466964_0008662 3300044706 Bacteria 3825
141 Ga0466964_0034802 3300044706 Bacteria 2011
142 Ga0466971_0035895 3300044719 Bacteria 2223
143 Ga0466971_0040815 3300044719 Bacteria 2084
144 Ga0466970_0004142 3300044765 Bacteria 7131
145 Ga0466970_0012718 3300044765 Bacteria 4305
146 Ga0466970_0084199 3300044765 Bacteria 1721
147 Ga0466957_0012629 3300044842 Bacteria 4891
148 Ga0466957_0022227 3300044842 Bacteria 3739
149 Ga0466957_0034785 3300044842 Bacteria 3022
150 Ga0466960_0000363 3300044901 Bacteria 15482
151 Ga0466960_0002335 3300044901 Bacteria 7129
152 Ga0466960_0003029 3300044901 Bacteria 6413
153 Ga0466960_0013609 3300044901 Bacteria 3461
154 Ga0466960_0017562 3300044901 Bacteria 3122
155 Ga0466960_0038369 3300044901 Bacteria 2252
156 Ga0466958_0009795 3300045836 Bacteria 5347
157 Ga0466958_0072026 3300045836 Bacteria 2116
158 Ga0466967_0024217 3300045976 Bacteria 4987
159 Ga0466967_0033814 3300045976 Bacteria 4332
160 Ga0466967_0071516 3300045976 Bacteria 3106
161 Ga0466967_0083682 3300045976 Bacteria 2886
162 Ga0466967_0137370 3300045976 Bacteria 2274
163 Ga0466967_0160572 3300045976 Bacteria 2109
164 Ga0495641_0037241 3300046461 Bacteria 2282
165 Ga0495658_0045645 3300046683 Bacteria 2460
166 Ga0495686_0006967 3300047472 Bacteria 8540
167 Ga0496101_0154779 3300048904 Bacteria 1755
168 Ga0496102_0000761 3300048905 Bacteria 31376
169 Ga0496102_0010287 3300048905 Bacteria 8044
170 Ga0496102_0019086 3300048905 Bacteria 6036
171 Ga0496102_0024445 3300048905 Bacteria 5371
172 Ga0496102_0074282 3300048905 Bacteria 3125
173 Ga0496103_0000594 3300048906 Bacteria 28543
174 Ga0496103_0037401 3300048906 Bacteria 2974
175 Ga0496104_0023695 3300048907 Bacteria 5645
176 Ga0496105_0057441 3300048908 Bacteria 3213
177 Ga0496107_0005873 3300048910 Bacteria 8407
178 Ga0496107_0035032 3300048910 Bacteria 3599
179 Ga0496108_0066426 3300048911 Bacteria 3041
180 Ga0496108_0118262 3300048911 Bacteria 2271
181 Ga0496108_0273958 3300048911 Bacteria 1469
182 Ga0496109_0016461 3300048912 Bacteria 6464
183 Ga0496109_0017693 3300048912 Bacteria 6252
184 Ga0496109_0026450 3300048912 Bacteria 5175
185 Ga0496109_0043692 3300048912 Bacteria 4062
186 Ga0496109_0046086 3300048912 Bacteria 3959
187 Ga0496109_0053406 3300048912 Bacteria 3685
188 Ga0496110_0006129 3300048913 Bacteria 9483
189 Ga0496110_0010383 3300048913 Bacteria 7569
190 Ga0496110_0042513 3300048913 Bacteria 3967
191 Ga0496111_0004862 3300048914 Bacteria 8526
192 Ga0496111_0046126 3300048914 Bacteria 3137
193 Ga0496111_0055783 3300048914 Bacteria 2857
194 Ga0496111_0057871 3300048914 Bacteria 2806
195 Ga0496113_0054125 3300048916 Bacteria 3003
196 Ga0496113_0094630 3300048916 Bacteria 2308
197 Ga0496114_0028016 3300048917 Bacteria 4619
198 Ga0496114_0051938 3300048917 Bacteria 3414
199 Ga0496114_0057303 3300048917 Bacteria 3252
200 Ga0496114_0070078 3300048917 Bacteria 2944
201 Ga0496114_0091050 3300048917 Bacteria 2590
202 Ga0496114_0154244 3300048917 Bacteria 1993
203 Ga0496115_0012872 3300048918 Bacteria 6308
204 Ga0496115_0039873 3300048918 Bacteria 3732
205 Ga0496116_0034817 3300048919 Bacteria 3545
206 Ga0496117_0002518 3300048920 Bacteria 22967
207 Ga0496118_0003618 3300048921 Bacteria 19195
208 Ga0496119_0002502 3300048922 Bacteria 20090
209 Ga0496120_0035330 3300048923 Bacteria 2986
210 Ga0496121_0009475 3300048924 Bacteria 11183
211 Ga0496124_0164621 3300048927 Bacteria 1725
212 Ga0496125_0009638 3300048928 Bacteria 9874
213 Ga0496126_0046368 3300048929 Bacteria 3986
214 Ga0501309_004648 3300049129 Bacteria 1607
215 Ga0501311_001480 3300049527 Bacteria 2053
216 Ga0501321_002736 3300049537 Bacteria 1557
217 Ga0501031_0001223 3300049568 Bacteria 15717
218 Ga0501031_0002506 3300049568 Bacteria 11699
219 Ga0501033_0007878 3300049570 Bacteria 8254
220 Ga0501034_0021415 3300049571 Bacteria 6590
221 Ga0501034_0144338 3300049571 Bacteria 2358
222 Ga0501036_0003821 3300049572 Bacteria 12082
223 Ga0501036_0062186 3300049572 Bacteria 3162
224 Ga0501038_0002198 3300049574 Bacteria 18132
225 Ga0501038_0005023 3300049574 Bacteria 12285
226 Ga0501038_0032813 3300049574 Bacteria 4577
227 Ga0501039_0047317 3300049575 Bacteria 3324
228 Ga0501039_0125430 3300049575 Bacteria 2014
229 Ga0501042_0027732 3300049578 Bacteria 3984
230 Ga0501042_0028192 3300049578 Bacteria 3953
231 Ga0501042_0109444 3300049578 Bacteria 1989
232 Ga0501043_0007092 3300049579 Bacteria 8916
233 Ga0501046_0005629 3300049580 Bacteria 11183
234 Ga0501046_0049732 3300049580 Bacteria 3315
235 Ga0501046_0108557 3300049580 Bacteria 2122
236 Ga0501047_0004335 3300049581 Bacteria 13356
237 Ga0501048_0004152 3300049582 Bacteria 11043
238 Ga0501048_0049855 3300049582 Bacteria 2983
239 Ga0501067_0004460 3300049583 Bacteria 7721
240 Ga0501067_0005380 3300049583 Bacteria 7107
241 Ga0501067_0005499 3300049583 Bacteria 7026
242 Ga0501067_0048875 3300049583 Bacteria 2345
243 Ga0501068_0009181 3300049584 Bacteria 5524
244 Ga0501069_0105593 3300049585 Bacteria 1601
245 Ga0501070_0009225 3300049586 Bacteria 8342
246 Ga0501070_0031793 3300049586 Bacteria 4421
247 Ga0501071_0001511 3300049587 Bacteria 13524
248 Ga0501071_0057924 3300049587 Bacteria 2800
249 Ga0501072_0036586 3300049588 Bacteria 3848
250 Ga0501073_0007812 3300049589 Bacteria 7942
251 Ga0501073_0018568 3300049589 Bacteria 5027
252 Ga0501074_0013630 3300049590 Bacteria 5909
253 Ga0501074_0015091 3300049590 Bacteria 5619
254 Ga0501074_0038051 3300049590 Bacteria 3486
255 Ga0501075_0120225 3300049591 Bacteria 1999
256 Ga0501076_0011003 3300049592 Bacteria 6727
257 Ga0501077_0006449 3300049593 Bacteria 7203
258 Ga0501079_0031864 3300049741 Bacteria 4051
259 Ga0501079_0050090 3300049741 Bacteria 3224
260 Ga0501080_0017305 3300049742 Bacteria 6663
261 Ga0501080_0018290 3300049742 Bacteria 6486
262 Ga0501080_0182592 3300049742 Bacteria 1930
263 Ga0501081_0045664 3300049743 Bacteria 3008
264 Ga0501083_0017686 3300049744 Bacteria 4970
265 Ga0501035_0004336 3300049822 Bacteria 13462
266 Ga0501035_0115057 3300049822 Bacteria 2355
267 Ga0501044_0072444 3300049823 Bacteria 3502
268 Ga0501045_0008335 3300049824 Bacteria 7218
269 nmdc:mga03n38_7325_c1 3300050490 Bacteria 3899
270 nmdc:mga00v17_17455_c1 3300050491 Bacteria 4065
271 nmdc:mga00v17_53060_c1 3300050491 Bacteria 2470
272 nmdc:mga0yw44_20905_c1 3300050492 Bacteria 3643
273 nmdc:mga0yw44_26050_c1 3300050492 Bacteria 3335
274 nmdc:mga0yw44_41678_c1 3300050492 Bacteria 2734
275 nmdc:mga06z11_11979_c1 3300050494 Bacteria 3759
276 nmdc:mga06z11_50919_c1 3300050494 Bacteria 2118
277 nmdc:mga07m45_17989_c1 3300050496 Bacteria 3805
278 nmdc:mga07m45_18355_c1 3300050496 Bacteria 3774
279 Ga0500573_0108922 3300053140 Bacteria 1552
280 Ga0501084_0036454 3300054114 Bacteria 4108
281 Ga0501082_0007453 3300060353 Bacteria 9442
282 Ga0501082_0008186 3300060353 Bacteria 9022
283 Ga0530510_0056682 3300061734 Bacteria 2831
284 2643849730 2643221567 Bacteria 4163945
285 2644090606 2643221615 Bacteria 5487866
286 2644135732 2643221624 Bacteria 4384879
287 2644320410 2643221657 Bacteria 5490246
288 2645721180 2643221961 Bacteria 3919167
289 2645724807 2643221962 Bacteria 3874254
290 2740167678 2739367898 Bacteria 4367674
291 2808874420 2808606365 Bacteria 4301966
292 2857481951 2857481737 Bacteria 4761446
293 2919450532 2919446982 Bacteria 3994487
294 LJNas_1001997
295 JGI24740J21852_10015433
296 JGI24743J22301_10006489
297 Ga0070683_100000230
298 Ga0070683_100027640
299 Ga0070683_100078055
300 Ga0070683_100149819
301 Ga0070682_100014374
302 Ga0068868_100026195
303 Ga0070660_100007743
304 Ga0070692_10028793
305 Ga0070669_100009901
306 Ga0070667_100000022
307 Ga0070667_100159297
308 Ga0070700_100002368
309 Ga0070662_100091694
310 Ga0068867_100002039
311 Ga0068867_100198576
312 Ga0070679_100009609
313 Ga0068853_100024083
314 Ga0070665_100001640
315 Ga0070665_100001890
316 Ga0070702_100015045
317 Ga0070702_100068465
318 Ga0068859_100000329
319 Ga0068866_10008724
320 Ga0068866_10075594
321 Ga0068861_100083545
322 Ga0068870_10005698
323 Ga0068863_100000324
324 Ga0068858_100012487
325 Ga0068860_100000038
326 Ga0068860_100016142
327 Ga0068862_100000084
328 Ga0081538_10000936
329 Ga0075365_10037201
330 Ga0075365_10079505
331 Ga0075368_10001560
332 Ga0075363_100003492
333 Ga0075363_100023386
334 Ga0075364_10021339
335 Ga0075364_10056398
336 Ga0075370_10018608
337 Ga0075370_10048223
338 Ga0075370_10068843
339 Ga0068865_100015376
340 Ga0097620_100000329
341 Ga0105245_10007733
342 Ga0105245_10016035
343 Ga0105247_10000021
344 Ga0105243_10039663
345 Ga0105243_10042560
346 Ga0105242_10015017
347 Ga0105248_10000130
348 Ga0105248_10060403
349 Ga0105248_10065495
350 Ga0105249_10000060
351 Ga0105249_10043345
352 Ga0105239_10049538
353 Ga0105239_10076363
354 Ga0105246_10000798
355 Ga0157369_10269076
356 Ga0163162_10024071
357 Ga0163162_10073690
358 Ga0157372_10001996
359 Ga0157372_10069617
360 Ga0157375_10188377
361 Ga0163163_10031265
362 Ga0163163_10044091
363 Ga0163163_10242024
364 Ga0157380_10006999
365 Ga0157380_10044024
366 Ga0157379_10013539
367 Ga0207710_10000027
368 Ga0207688_10006897
369 Ga0207647_10052497
370 Ga0207643_10036685
371 Ga0207657_10105954
372 Ga0207652_10028524
373 Ga0207681_10001051
374 Ga0207687_10010643
375 Ga0207687_10045873
376 Ga0207687_10115782
377 Ga0207690_10147276
378 Ga0207706_10006123
379 Ga0207709_10009405
380 Ga0207704_10016445
381 Ga0207691_10003318
382 Ga0207691_10081111
383 Ga0207711_10000089
384 Ga0207711_10018383
385 Ga0207661_10059808
386 Ga0207679_10042177
387 Ga0207679_10163347
388 Ga0207667_10244857
389 Ga0207712_10000051
390 Ga0207712_10031141
391 Ga0207658_10001841
392 Ga0207658_10196431
393 Ga0207708_10000904
394 Ga0207708_10009470
395 Ga0207702_10052015
396 Ga0207641_10001014
397 Ga0207648_10003186
398 Ga0207648_10124514
399 Ga0207674_10004941
400 Ga0207675_100007862
401 Ga0207675_100013512
402 Ga0207675_100014118
403 Ga0209813_10013832
404 Ga0268266_10001775
405 Ga0268265_10000028
406 Ga0268264_10000092
407 Ga0268264_10019379
408 Ga0307410_10114062
409 Ga0307407_10026746
410 Ga0307407_10039632
411 Ga0307409_100010836
412 Ga0307409_100015194
413 Ga0307409_100116011
414 Ga0307409_100173599
415 Ga0307416_100008730
416 Ga0307416_100034283
417 Ga0307411_10046930
418 Ga0307415_100000153
419 Ga0307415_100026007
420 Ga0307415_100050116
421 Ga0395901_0047154
422 Ga0395901_0060596
423 Ga0395901_0156730
424 Ga0466972_0017805
425 Ga0466972_0030075
426 Ga0466965_0006847
427 Ga0466965_0012918
428 Ga0466966_0117981
429 Ga0466961_0026400
430 Ga0466963_0010442
431 Ga0466963_0083677
432 Ga0466964_0004994
433 Ga0466964_0008662
434 Ga0466964_0034802
435 Ga0466971_0035895
436 Ga0466971_0040815
437 Ga0466970_0004142
438 Ga0466970_0012718
439 Ga0466970_0084199
440 Ga0466957_0012629
441 Ga0466957_0022227
442 Ga0466957_0034785
443 Ga0466960_0000363
444 Ga0466960_0002335
445 Ga0466960_0003029
446 Ga0466960_0013609
447 Ga0466960_0017562
448 Ga0466960_0038369
449 Ga0466958_0009795
450 Ga0466958_0072026
451 Ga0466967_0024217
452 Ga0466967_0033814
453 Ga0466967_0071516
454 Ga0466967_0083682
455 Ga0466967_0137370
456 Ga0466967_0160572
457 Ga0495641_0037241
458 Ga0495658_0045645
459 Ga0495686_0006967
460 Ga0496101_0154779
461 Ga0496102_0000761
462 Ga0496102_0010287
463 Ga0496102_0019086
464 Ga0496102_0024445
465 Ga0496102_0074282
466 Ga0496103_0000594
467 Ga0496103_0037401
468 Ga0496104_0023695
469 Ga0496105_0057441
470 Ga0496107_0005873
471 Ga0496107_0035032
472 Ga0496108_0066426
473 Ga0496108_0118262
474 Ga0496108_0273958
475 Ga0496109_0016461
476 Ga0496109_0017693
477 Ga0496109_0026450
478 Ga0496109_0043692
479 Ga0496109_0046086
480 Ga0496109_0053406
481 Ga0496110_0006129
482 Ga0496110_0010383
483 Ga0496110_0042513
484 Ga0496111_0004862
485 Ga0496111_0046126
486 Ga0496111_0055783
487 Ga0496111_0057871
488 Ga0496113_0054125
489 Ga0496113_0094630
490 Ga0496114_0028016
491 Ga0496114_0051938
492 Ga0496114_0057303
493 Ga0496114_0070078
494 Ga0496114_0091050
495 Ga0496114_0154244
496 Ga0496115_0012872
497 Ga0496115_0039873
498 Ga0496116_0034817
499 Ga0496117_0002518
500 Ga0496118_0003618
501 Ga0496119_0002502
502 Ga0496120_0035330
503 Ga0496121_0009475
504 Ga0496124_0164621
505 Ga0496125_0009638
506 Ga0496126_0046368
507 Ga0501309_004648
508 Ga0501311_001480
509 Ga0501321_002736
510 Ga0501031_0001223
511 Ga0501031_0002506
512 Ga0501033_0007878
513 Ga0501034_0021415
514 Ga0501034_0144338
515 Ga0501036_0003821
516 Ga0501036_0062186
517 Ga0501038_0002198
518 Ga0501038_0005023
519 Ga0501038_0032813
520 Ga0501039_0047317
521 Ga0501039_0125430
522 Ga0501042_0027732
523 Ga0501042_0028192
524 Ga0501042_0109444
525 Ga0501043_0007092
526 Ga0501046_0005629
527 Ga0501046_0049732
528 Ga0501046_0108557
529 Ga0501047_0004335
530 Ga0501048_0004152
531 Ga0501048_0049855
532 Ga0501067_0004460
533 Ga0501067_0005380
534 Ga0501067_0005499
535 Ga0501067_0048875
536 Ga0501068_0009181
537 Ga0501069_0105593
538 Ga0501070_0009225
539 Ga0501070_0031793
540 Ga0501071_0001511
541 Ga0501071_0057924
542 Ga0501072_0036586
543 Ga0501073_0007812
544 Ga0501073_0018568
545 Ga0501074_0013630
546 Ga0501074_0015091
547 Ga0501074_0038051
548 Ga0501075_0120225
549 Ga0501076_0011003
550 Ga0501077_0006449
551 Ga0501079_0031864
552 Ga0501079_0050090
553 Ga0501080_0017305
554 Ga0501080_0018290
555 Ga0501080_0182592
556 Ga0501081_0045664
557 Ga0501083_0017686
558 Ga0501035_0004336
559 Ga0501035_0115057
560 Ga0501044_0072444
561 Ga0501045_0008335
562 nmdc:mga03n38_7325_c1
563 nmdc:mga00v17_17455_c1
564 nmdc:mga00v17_53060_c1
565 nmdc:mga0yw44_20905_c1
566 nmdc:mga0yw44_26050_c1
567 nmdc:mga0yw44_41678_c1
568 nmdc:mga06z11_11979_c1
569 nmdc:mga06z11_50919_c1
570 nmdc:mga07m45_17989_c1
571 nmdc:mga07m45_18355_c1
572 Ga0500573_0108922
573 Ga0501084_0036454
574 Ga0501082_0007453
575 Ga0501082_0008186
576 Ga0530510_0056682
577 2643849730
578 2644090606
579 2644135732
580 2644320410
581 2645721180
582 2645724807
583 2740167678
584 2808874420
585 2857481951
586 2919450532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12832

MFS_1_like

MFS_1 like family

55

175

0.92

PF00083

Sugar_tr

Sugar (and other) transporter

24

474

0.87

PF07690

MFS_1

Major Facilitator Superfamily

28

308

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.8295 57 463
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.8277 66 463
8et9-assembly1.cif.gz_A cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium 0.823 69 473
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8133 24 461
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8012 24 461
ID Description Score Start End Superfamily
af_E7F6Z2_571_733_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9139 315 470 1.20.1250.20
af_X1WCQ3_534_686_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8922 316 469 1.20.1250.20
af_Q8N4F4_121_298_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.88 72 230 1.20.1250.20
af_Q555W6_322_550_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8665 275 464 1.20.1250.20
af_Q9Y7Q9_337_572_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8547 265 472 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A376RHI6-F1-model_v4 Metabolite transport protein 0.8638 13 251 GO:0005886
GO:0022857
AF-A0A6V8NNU3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8638 25 213 GO:0016020
GO:0022857
AF-A0A7C0V2W9-F1-model_v4 MFS transporter 0.8572 28 208 GO:0016020
GO:0022857
AF-A0A5N5DFJ8-F1-model_v4 Arabinose-proton symporter 0.8466 29 237 GO:0005351
GO:0016020
AF-A0A7K0RG31-F1-model_v4 MFS transporter 0.844 31 213 GO:0016020
GO:0022857

Map