F391667

General Info

Members Datasets Scaffolds Average Seq Length
293 210 586 128

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0552704|Ga0495639_0552704_47_514
Length 155
Sequence MHISAVRISDSRIRTSRQAGFKQEQIMRMLTKAVVTTILPVKDMARARDFYEKKLGLEPKGFAADGNFLFACGGDAHIALITKPEGTKAEHTALSFEVNGIERVISDLQAEGVVFEDYDFPNLKTVDHVCVLGSEKAAWFKDSEGNYLCVHEGPH

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
130 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
135 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
208 2547132374 Acidovorax radicis N35 Isolate Unclassified
209 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
210 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 0
Rhizoplane 6.14
Rhizosphere 67.92
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0552704 3300046475 Bacteria 590
2 JGI25151J46595_10000958 3300003187 Bacteria 22047
3 Ga0065714_10049212 3300005288 Bacteria 753
4 Ga0065707_10028796 3300005295 Bacteria 1385
5 Ga0065707_10144560 3300005295 Bacteria 1729
6 Ga0070658_10224364 3300005327 Bacteria 1590
7 Ga0070658_10545916 3300005327 Bacteria 1003
8 Ga0070658_11408325 3300005327 Bacteria 605
9 Ga0070658_11459068 3300005327 Unclassified 593
10 Ga0070683_100165117 3300005329 Bacteria 2100
11 Ga0070670_100239000 3300005331 Bacteria 1581
12 Ga0070677_10037394 3300005333 Bacteria 1893
13 Ga0068869_100589047 3300005334 Bacteria 938
14 Ga0070666_10260235 3300005335 Bacteria 1230
15 Ga0070680_100406813 3300005336 Bacteria 1160
16 Ga0068868_100026262 3300005338 Bacteria 4436
17 Ga0070689_102023100 3300005340 Unclassified 527
18 Ga0070661_100066521 3300005344 Bacteria 2648
19 Ga0070669_101894353 3300005353 Bacteria 521
20 Ga0070675_100062019 3300005354 Bacteria 3088
21 Ga0070671_100036481 3300005355 Bacteria 4077
22 Ga0070671_100094100 3300005355 Bacteria 2511
23 Ga0070674_100446568 3300005356 Bacteria 1066
24 Ga0070673_100036226 3300005364 Bacteria 3748
25 Ga0070673_100396541 3300005364 Bacteria 1233
26 Ga0070688_101140044 3300005365 Bacteria 625
27 Ga0070667_100162436 3300005367 Bacteria 1968
28 Ga0070663_100764679 3300005455 Unclassified 826
29 Ga0070678_100008400 3300005456 Bacteria 6183
30 Ga0068867_101440447 3300005459 Unclassified 640
31 Ga0070685_10004022 3300005466 Bacteria 7423
32 Ga0070698_101458621 3300005471 Bacteria 635
33 Ga0070672_100162540 3300005543 Bacteria 1853
34 Ga0070672_101102308 3300005543 Bacteria 705
35 Ga0070686_100417436 3300005544 Bacteria 1024
36 Ga0070696_101966732 3300005546 Bacteria 507
37 Ga0070693_101008547 3300005547 Unclassified 630
38 Ga0070665_100001596 3300005548 Bacteria 26117
39 Ga0070704_100031521 3300005549 Bacteria 3567
40 Ga0070704_101793534 3300005549 Bacteria 568
41 Ga0070664_100146651 3300005564 Bacteria 2081
42 Ga0068852_100013266 3300005616 Bacteria 6301
43 Ga0068852_101089058 3300005616 Bacteria 819
44 Ga0068859_102681085 3300005617 Unclassified 548
45 Ga0068864_100040266 3300005618 Bacteria 3997
46 Ga0068864_100193554 3300005618 Bacteria 1865
47 Ga0068866_10073314 3300005718 Bacteria 1816
48 Ga0068870_10108759 3300005840 Bacteria 1579
49 Ga0068858_100047769 3300005842 Bacteria 3967
50 Ga0068860_100138920 3300005843 Bacteria 2334
51 Ga0070717_12165395 3300006028 Unclassified 500
52 Ga0075368_10062455 3300006042 Bacteria 1493
53 Ga0075432_10168233 3300006058 Bacteria 851
54 Ga0075367_10800287 3300006178 Bacteria 600
55 Ga0075366_10001656 3300006195 Bacteria 11187
56 Ga0075366_10163407 3300006195 Bacteria 1349
57 Ga0075366_10229947 3300006195 Bacteria 1130
58 Ga0075366_10249026 3300006195 Bacteria 1083
59 Ga0075366_10250909 3300006195 Bacteria 1079
60 Ga0075366_10403175 3300006195 Bacteria 842
61 Ga0075366_10572854 3300006195 Bacteria 699
62 Ga0075370_10000289 3300006353 Bacteria 18028
63 Ga0075370_10139319 3300006353 Bacteria 1418
64 Ga0075370_10305037 3300006353 Bacteria 947
65 Ga0068871_100075004 3300006358 Bacteria 2791
66 Ga0068871_100901981 3300006358 Bacteria 819
67 Ga0075428_100111654 3300006844 Bacteria 2978
68 Ga0075428_100783356 3300006844 Bacteria 1014
69 Ga0075430_100095923 3300006846 Bacteria 2479
70 Ga0075430_100366356 3300006846 Bacteria 1190
71 Ga0075431_101297258 3300006847 Bacteria 689
72 Ga0075429_100557041 3300006880 Bacteria 1005
73 Ga0097620_102681080 3300006931 Unclassified 548
74 Ga0111539_10585227 3300009094 Bacteria 1300
75 Ga0105245_10137625 3300009098 Bacteria 2297
76 Ga0105243_10005893 3300009148 Bacteria 9490
77 Ga0105241_12427284 3300009174 Unclassified 524
78 Ga0105242_10510696 3300009176 Bacteria 1145
79 Ga0105242_11900159 3300009176 Bacteria 636
80 Ga0105248_10000644 3300009177 Bacteria 39638
81 Ga0105248_10109908 3300009177 Bacteria 3108
82 Ga0105249_12882037 3300009553 Bacteria 552
83 Ga0105246_10766204 3300011119 Bacteria 853
84 Ga0157326_1048878 3300012513 Bacteria 616
85 Ga0157371_10436126 3300013102 Bacteria 962
86 Ga0157369_11341984 3300013105 Bacteria 728
87 Ga0157374_10069183 3300013296 Bacteria 3323
88 Ga0157378_10118341 3300013297 Unclassified 2438
89 Ga0163162_10266612 3300013306 Bacteria 1844
90 Ga0157379_10692757 3300014968 Bacteria 956
91 Ga0157376_10043441 3300014969 Bacteria 3689
92 Ga0163161_10201293 3300017792 Bacteria 1535
93 Ga0209129_1003151 3300025258 Bacteria 7388
94 Ga0209025_1000230 3300025294 Bacteria 131131
95 Ga0209025_1030304 3300025294 Bacteria 2592
96 Ga0207656_10090805 3300025321 Bacteria 1386
97 Ga0207682_10022003 3300025893 Bacteria 2510
98 Ga0207688_10158572 3300025901 Bacteria 1340
99 Ga0207680_10259335 3300025903 Bacteria 1203
100 Ga0207705_11406991 3300025909 Bacteria 530
101 Ga0207662_10721086 3300025918 Bacteria 700
102 Ga0207657_10835417 3300025919 Bacteria 711
103 Ga0207649_10183705 3300025920 Bacteria 1465
104 Ga0207650_10007739 3300025925 Bacteria 7324
105 Ga0207650_10372921 3300025925 Bacteria 1177
106 Ga0207659_10087200 3300025926 Bacteria 2323
107 Ga0207687_10086401 3300025927 Bacteria 2277
108 Ga0207644_10050325 3300025931 Bacteria 2986
109 Ga0207690_10560766 3300025932 Bacteria 929
110 Ga0207706_11584802 3300025933 Bacteria 531
111 Ga0207709_10012331 3300025935 Bacteria 4710
112 Ga0207669_10191279 3300025937 Bacteria 1476
113 Ga0207691_10015077 3300025940 Bacteria 7355
114 Ga0207711_10043174 3300025941 Bacteria 3845
115 Ga0207689_10560779 3300025942 Bacteria 960
116 Ga0207661_10186410 3300025944 Bacteria 1816
117 Ga0207679_10031855 3300025945 Bacteria 3695
118 Ga0207640_10198562 3300025981 Bacteria 1518
119 Ga0207658_10133795 3300025986 Bacteria 1996
120 Ga0207677_10005102 3300026023 Bacteria 7102
121 Ga0207677_10397657 3300026023 Bacteria 1168
122 Ga0207639_10975360 3300026041 Bacteria 793
123 Ga0207678_11345724 3300026067 Bacteria 632
124 Ga0207648_10111156 3300026089 Bacteria 2406
125 Ga0207676_10043963 3300026095 Bacteria 3443
126 Ga0207676_10196260 3300026095 Bacteria 1780
127 Ga0207676_12047231 3300026095 Bacteria 571
128 Ga0207683_10005909 3300026121 Bacteria 10491
129 Ga0207683_10150455 3300026121 Bacteria 2101
130 Ga0207698_10038927 3300026142 Bacteria 3518
131 Ga0207698_10586124 3300026142 Bacteria 1098
132 Ga0268266_10000272 3300028379 Bacteria 85423
133 Ga0268264_10117324 3300028381 Bacteria 2341
134 Ga0307517_10004027 3300028786 Bacteria 22740
135 Ga0307517_10071813 3300028786 Bacteria 3096
136 Ga0307515_10000378 3300028794 Bacteria 108916
137 Ga0307515_10001006 3300028794 Bacteria 64436
138 Ga0307515_10029956 3300028794 Bacteria 9170
139 Ga0307515_10220073 3300028794 Bacteria 1719
140 Ga0307511_10328554 3300030521 Bacteria 671
141 Ga0265327_10000512 3300031251 Bacteria 67274
142 Ga0307513_10074068 3300031456 Bacteria 3543
143 Ga0307513_10088835 3300031456 Bacteria 3157
144 Ga0307513_10147632 3300031456 Bacteria 2267
145 Ga0307513_10190990 3300031456 Bacteria 1900
146 Ga0307509_10008345 3300031507 Bacteria 13233
147 Ga0307509_10045445 3300031507 Bacteria 4735
148 Ga0307509_10050073 3300031507 Bacteria 4474
149 Ga0307408_101475480 3300031548 Bacteria 642
150 Ga0307408_101972691 3300031548 Bacteria 561
151 Ga0307508_10001018 3300031616 Bacteria 32597
152 Ga0307508_10001804 3300031616 Bacteria 23735
153 Ga0307508_10173394 3300031616 Bacteria 1760
154 Ga0307508_10182815 3300031616 Bacteria 1699
155 Ga0307508_10523803 3300031616 Bacteria 781
156 Ga0307514_10473869 3300031649 Bacteria 606
157 Ga0307516_10000312 3300031730 Bacteria 62905
158 Ga0307516_10207374 3300031730 Bacteria 1676
159 Ga0307516_10293077 3300031730 Bacteria 1305
160 Ga0307516_10354128 3300031730 Bacteria 1133
161 Ga0307416_102842476 3300032002 Bacteria 579
162 Ga0307507_10632925 3300033179 Bacteria 546
163 Ga0307510_10372378 3300033180 Bacteria 874
164 Ga0307510_10387956 3300033180 Bacteria 841
165 Ga0373960_0194924 3300035121 Bacteria 714
166 Ga0395905_0089826 3300037471 Bacteria 2879
167 Ga0395905_0204881 3300037471 Bacteria 1849
168 Ga0439436_0082775 3300041404 Bacteria 893
169 Ga0439461_0041896 3300041410 Bacteria 992
170 Ga0451787_088151 3300041441 Bacteria 944
171 Ga0451797_0496613 3300041453 Bacteria 881
172 Ga0451807_2342355 3300041486 Unclassified 986
173 Ga0451841_0562838 3300041498 Bacteria 581
174 Ga0451841_0730296 3300041498 Bacteria 626
175 Ga0451847_0075689 3300041503 Bacteria 1301
176 Ga0451843_1023015 3300041509 Bacteria 1174
177 Ga0451853_2512098 3300041512 Bacteria 1323
178 Ga0439431_0055785 3300041997 Bacteria 1032
179 Ga0439431_0062492 3300041997 Bacteria 982
180 Ga0439437_002000 3300042000 Bacteria 2160
181 Ga0439437_004768 3300042000 Bacteria 1485
182 Ga0439441_034856 3300042001 Bacteria 990
183 Ga0439455_0154059 3300042012 Bacteria 655
184 Ga0439462_0053841 3300042015 Bacteria 1084
185 Ga0439462_0061532 3300042015 Bacteria 1016
186 Ga0439463_081270 3300042016 Bacteria 833
187 Ga0450891_000144 3300042129 Bacteria 6587
188 Ga0450894_016970 3300042131 Bacteria 968
189 Ga0439446_0030710 3300042156 Bacteria 1553
190 Ga0450909_010704 3300042185 Bacteria 1343
191 Ga0439434_0260516 3300042435 Bacteria 594
192 Ga0439459_0221039 3300042438 Bacteria 525
193 Ga0439464_0022784 3300042439 Bacteria 1727
194 Ga0451577_0000489 3300042876 Bacteria 67100
195 Ga0451577_0191504 3300042876 Bacteria 1845
196 Ga0451577_1347175 3300042876 Bacteria 634
197 Ga0466969_0004483 3300044656 Bacteria 7432
198 Ga0466972_0074431 3300044658 Bacteria 1618
199 Ga0466972_0120316 3300044658 Bacteria 1238
200 Ga0453683_0007768 3300044673 Bacteria 7250
201 Ga0453683_0467900 3300044673 Bacteria 816
202 Ga0466966_0126455 3300044684 Bacteria 1567
203 Ga0466961_0020158 3300044693 Bacteria 4292
204 Ga0453684_0000014 3300044712 Bacteria 993311
205 Ga0453684_0052715 3300044712 Bacteria 5316
206 Ga0453684_0128679 3300044712 Bacteria 3042
207 Ga0453684_0544038 3300044712 Bacteria 1280
208 Ga0466968_0569907 3300044735 Bacteria 569
209 Ga0466970_0093872 3300044765 Bacteria 1630
210 Ga0466970_0376825 3300044765 Unclassified 807
211 Ga0451576_0000943 3300045051 Bacteria 54571
212 Ga0451576_0067797 3300045051 Bacteria 3714
213 Ga0451576_0068911 3300045051 Bacteria 3681
214 Ga0451576_0101052 3300045051 Bacteria 2999
215 Ga0495627_014338 3300046453 Bacteria 2768
216 Ga0495638_0209176 3300046460 Bacteria 1097
217 Ga0495606_0082942 3300046507 Bacteria 1989
218 Ga0495608_0808609 3300046511 Bacteria 553
219 Ga0495620_0047877 3300046515 Bacteria 1837
220 Ga0495620_0232119 3300046515 Bacteria 705
221 Ga0495632_0099390 3300046519 Bacteria 1372
222 Ga0495637_0041868 3300046520 Bacteria 1962
223 Ga0495663_0058841 3300046525 Bacteria 1205
224 Ga0495666_0202671 3300046526 Bacteria 912
225 Ga0495654_0202038 3300046530 Bacteria 850
226 Ga0495597_0000083 3300046542 Bacteria 83574
227 Ga0495634_0684928 3300046642 Bacteria 590
228 Ga0495625_0115885 3300046660 Bacteria 1828
229 Ga0495657_0298586 3300046675 Bacteria 961
230 Ga0495658_0063388 3300046683 Bacteria 2127
231 Ga0495670_0040184 3300046691 Bacteria 2333
232 Ga0495671_0053425 3300046692 Bacteria 2005
233 Ga0495660_0055944 3300046810 Bacteria 2134
234 Ga0495660_0274622 3300046810 Bacteria 773
235 Ga0495676_0073371 3300047321 Bacteria 2624
236 Ga0495673_0292152 3300047469 Bacteria 586
237 Ga0495681_0122231 3300047470 Bacteria 1116
238 Ga0495593_0300484 3300047673 Bacteria 802
239 Ga0495615_0020334 3300048090 Bacteria 1486
240 Ga0496100_0254172 3300048903 Bacteria 1301
241 Ga0496101_0519272 3300048904 Bacteria 941
242 Ga0496102_0307489 3300048905 Bacteria 1494
243 Ga0496102_0459681 3300048905 Bacteria 1194
244 Ga0496104_0038890 3300048907 Bacteria 4453
245 Ga0496105_0114391 3300048908 Bacteria 2225
246 Ga0496108_0204635 3300048911 Bacteria 1713
247 Ga0496109_0062316 3300048912 Bacteria 3410
248 Ga0496109_0131198 3300048912 Bacteria 2339
249 Ga0496110_0057830 3300048913 Bacteria 3415
250 Ga0496110_0296164 3300048913 Bacteria 1474
251 Ga0496111_0397609 3300048914 Bacteria 1018
252 Ga0496112_0013273 3300048915 Bacteria 7605
253 Ga0496113_0031546 3300048916 Bacteria 3846
254 Ga0496115_0584879 3300048918 Bacteria 889
255 Ga0496118_0366965 3300048921 Unclassified 761
256 Ga0496121_0010604 3300048924 Bacteria 10355
257 Ga0496124_0446082 3300048927 Bacteria 884
258 Ga0496125_0467489 3300048928 Bacteria 718
259 Ga0496125_0581021 3300048928 Unclassified 615
260 Ga0501038_0740735 3300049574 Bacteria 734
261 Ga0501041_0016704 3300049577 Bacteria 4368
262 Ga0501075_0422788 3300049591 Bacteria 1016
263 Ga0501080_0523562 3300049742 Bacteria 1058
264 Ga0501263_021659 3300049760 Bacteria 868
265 nmdc:mga0k408_121444_c1 3300050493 Bacteria 1547
266 nmdc:mga0k408_3321_c1 3300050493 Bacteria 8513
267 nmdc:mga0k408_582106_c1 3300050493 Bacteria 661
268 nmdc:mga0k408_66721_c1 3300050493 Bacteria 2096
269 nmdc:mga0k408_805104_c1 3300050493 Bacteria 547
270 nmdc:mga07m45_143851_c1 3300050496 Bacteria 1382
271 nmdc:mga07m45_191596_c1 3300050496 Bacteria 1189
272 nmdc:mga07m45_202921_c1 3300050496 Bacteria 1153
273 nmdc:mga07m45_255201_c1 3300050496 Bacteria 1020
274 nmdc:mga07m45_282_c1 3300050496 Bacteria 20415
275 nmdc:mga07m45_337072_c1 3300050496 Bacteria 876
276 nmdc:mga0qj67_100077_c1 3300050509 Bacteria 2336
277 nmdc:mga0qj67_1110375_c1 3300050509 Bacteria 617
278 nmdc:mga0qj67_854164_c1 3300050509 Bacteria 719
279 nmdc:mga08y16_977914_c1 3300050511 Bacteria 828
280 Ga0500610_0000115 3300053079 Bacteria 24228
281 Ga0500610_0000411 3300053079 Bacteria 13125
282 Ga0495619_0798498 3300053085 Bacteria 638
283 Ga0500646_0006562 3300053090 Bacteria 2960
284 Ga0500583_0193091 3300053092 Bacteria 1013
285 Ga0500641_0364323 3300053096 Bacteria 577
286 Ga0500593_000096 3300053117 Bacteria 32939
287 Ga0500593_000944 3300053117 Bacteria 10727
288 Ga0500607_000146 3300053121 Bacteria 59939
289 Ga0500627_0001531 3300053158 Bacteria 6505
290 Ga0500633_0100172 3300053160 Bacteria 1066
291 2548497977 2547132374 Bacteria 5530232
292 2919708640 2919704043 Bacteria 5560311
293 2945948465 2945945610 Bacteria 5951079
294 Ga0495639_0552704
295 JGI25151J46595_10000958
296 Ga0065714_10049212
297 Ga0065707_10028796
298 Ga0065707_10144560
299 Ga0070658_10224364
300 Ga0070658_10545916
301 Ga0070658_11408325
302 Ga0070658_11459068
303 Ga0070683_100165117
304 Ga0070670_100239000
305 Ga0070677_10037394
306 Ga0068869_100589047
307 Ga0070666_10260235
308 Ga0070680_100406813
309 Ga0068868_100026262
310 Ga0070689_102023100
311 Ga0070661_100066521
312 Ga0070669_101894353
313 Ga0070675_100062019
314 Ga0070671_100036481
315 Ga0070671_100094100
316 Ga0070674_100446568
317 Ga0070673_100036226
318 Ga0070673_100396541
319 Ga0070688_101140044
320 Ga0070667_100162436
321 Ga0070663_100764679
322 Ga0070678_100008400
323 Ga0068867_101440447
324 Ga0070685_10004022
325 Ga0070698_101458621
326 Ga0070672_100162540
327 Ga0070672_101102308
328 Ga0070686_100417436
329 Ga0070696_101966732
330 Ga0070693_101008547
331 Ga0070665_100001596
332 Ga0070704_100031521
333 Ga0070704_101793534
334 Ga0070664_100146651
335 Ga0068852_100013266
336 Ga0068852_101089058
337 Ga0068859_102681085
338 Ga0068864_100040266
339 Ga0068864_100193554
340 Ga0068866_10073314
341 Ga0068870_10108759
342 Ga0068858_100047769
343 Ga0068860_100138920
344 Ga0070717_12165395
345 Ga0075368_10062455
346 Ga0075432_10168233
347 Ga0075367_10800287
348 Ga0075366_10001656
349 Ga0075366_10163407
350 Ga0075366_10229947
351 Ga0075366_10249026
352 Ga0075366_10250909
353 Ga0075366_10403175
354 Ga0075366_10572854
355 Ga0075370_10000289
356 Ga0075370_10139319
357 Ga0075370_10305037
358 Ga0068871_100075004
359 Ga0068871_100901981
360 Ga0075428_100111654
361 Ga0075428_100783356
362 Ga0075430_100095923
363 Ga0075430_100366356
364 Ga0075431_101297258
365 Ga0075429_100557041
366 Ga0097620_102681080
367 Ga0111539_10585227
368 Ga0105245_10137625
369 Ga0105243_10005893
370 Ga0105241_12427284
371 Ga0105242_10510696
372 Ga0105242_11900159
373 Ga0105248_10000644
374 Ga0105248_10109908
375 Ga0105249_12882037
376 Ga0105246_10766204
377 Ga0157326_1048878
378 Ga0157371_10436126
379 Ga0157369_11341984
380 Ga0157374_10069183
381 Ga0157378_10118341
382 Ga0163162_10266612
383 Ga0157379_10692757
384 Ga0157376_10043441
385 Ga0163161_10201293
386 Ga0209129_1003151
387 Ga0209025_1000230
388 Ga0209025_1030304
389 Ga0207656_10090805
390 Ga0207682_10022003
391 Ga0207688_10158572
392 Ga0207680_10259335
393 Ga0207705_11406991
394 Ga0207662_10721086
395 Ga0207657_10835417
396 Ga0207649_10183705
397 Ga0207650_10007739
398 Ga0207650_10372921
399 Ga0207659_10087200
400 Ga0207687_10086401
401 Ga0207644_10050325
402 Ga0207690_10560766
403 Ga0207706_11584802
404 Ga0207709_10012331
405 Ga0207669_10191279
406 Ga0207691_10015077
407 Ga0207711_10043174
408 Ga0207689_10560779
409 Ga0207661_10186410
410 Ga0207679_10031855
411 Ga0207640_10198562
412 Ga0207658_10133795
413 Ga0207677_10005102
414 Ga0207677_10397657
415 Ga0207639_10975360
416 Ga0207678_11345724
417 Ga0207648_10111156
418 Ga0207676_10043963
419 Ga0207676_10196260
420 Ga0207676_12047231
421 Ga0207683_10005909
422 Ga0207683_10150455
423 Ga0207698_10038927
424 Ga0207698_10586124
425 Ga0268266_10000272
426 Ga0268264_10117324
427 Ga0307517_10004027
428 Ga0307517_10071813
429 Ga0307515_10000378
430 Ga0307515_10001006
431 Ga0307515_10029956
432 Ga0307515_10220073
433 Ga0307511_10328554
434 Ga0265327_10000512
435 Ga0307513_10074068
436 Ga0307513_10088835
437 Ga0307513_10147632
438 Ga0307513_10190990
439 Ga0307509_10008345
440 Ga0307509_10045445
441 Ga0307509_10050073
442 Ga0307408_101475480
443 Ga0307408_101972691
444 Ga0307508_10001018
445 Ga0307508_10001804
446 Ga0307508_10173394
447 Ga0307508_10182815
448 Ga0307508_10523803
449 Ga0307514_10473869
450 Ga0307516_10000312
451 Ga0307516_10207374
452 Ga0307516_10293077
453 Ga0307516_10354128
454 Ga0307416_102842476
455 Ga0307507_10632925
456 Ga0307510_10372378
457 Ga0307510_10387956
458 Ga0373960_0194924
459 Ga0395905_0089826
460 Ga0395905_0204881
461 Ga0439436_0082775
462 Ga0439461_0041896
463 Ga0451787_088151
464 Ga0451797_0496613
465 Ga0451807_2342355
466 Ga0451841_0562838
467 Ga0451841_0730296
468 Ga0451847_0075689
469 Ga0451843_1023015
470 Ga0451853_2512098
471 Ga0439431_0055785
472 Ga0439431_0062492
473 Ga0439437_002000
474 Ga0439437_004768
475 Ga0439441_034856
476 Ga0439455_0154059
477 Ga0439462_0053841
478 Ga0439462_0061532
479 Ga0439463_081270
480 Ga0450891_000144
481 Ga0450894_016970
482 Ga0439446_0030710
483 Ga0450909_010704
484 Ga0439434_0260516
485 Ga0439459_0221039
486 Ga0439464_0022784
487 Ga0451577_0000489
488 Ga0451577_0191504
489 Ga0451577_1347175
490 Ga0466969_0004483
491 Ga0466972_0074431
492 Ga0466972_0120316
493 Ga0453683_0007768
494 Ga0453683_0467900
495 Ga0466966_0126455
496 Ga0466961_0020158
497 Ga0453684_0000014
498 Ga0453684_0052715
499 Ga0453684_0128679
500 Ga0453684_0544038
501 Ga0466968_0569907
502 Ga0466970_0093872
503 Ga0466970_0376825
504 Ga0451576_0000943
505 Ga0451576_0067797
506 Ga0451576_0068911
507 Ga0451576_0101052
508 Ga0495627_014338
509 Ga0495638_0209176
510 Ga0495606_0082942
511 Ga0495608_0808609
512 Ga0495620_0047877
513 Ga0495620_0232119
514 Ga0495632_0099390
515 Ga0495637_0041868
516 Ga0495663_0058841
517 Ga0495666_0202671
518 Ga0495654_0202038
519 Ga0495597_0000083
520 Ga0495634_0684928
521 Ga0495625_0115885
522 Ga0495657_0298586
523 Ga0495658_0063388
524 Ga0495670_0040184
525 Ga0495671_0053425
526 Ga0495660_0055944
527 Ga0495660_0274622
528 Ga0495676_0073371
529 Ga0495673_0292152
530 Ga0495681_0122231
531 Ga0495593_0300484
532 Ga0495615_0020334
533 Ga0496100_0254172
534 Ga0496101_0519272
535 Ga0496102_0307489
536 Ga0496102_0459681
537 Ga0496104_0038890
538 Ga0496105_0114391
539 Ga0496108_0204635
540 Ga0496109_0062316
541 Ga0496109_0131198
542 Ga0496110_0057830
543 Ga0496110_0296164
544 Ga0496111_0397609
545 Ga0496112_0013273
546 Ga0496113_0031546
547 Ga0496115_0584879
548 Ga0496118_0366965
549 Ga0496121_0010604
550 Ga0496124_0446082
551 Ga0496125_0467489
552 Ga0496125_0581021
553 Ga0501038_0740735
554 Ga0501041_0016704
555 Ga0501075_0422788
556 Ga0501080_0523562
557 Ga0501263_021659
558 nmdc:mga0k408_121444_c1
559 nmdc:mga0k408_3321_c1
560 nmdc:mga0k408_582106_c1
561 nmdc:mga0k408_66721_c1
562 nmdc:mga0k408_805104_c1
563 nmdc:mga07m45_143851_c1
564 nmdc:mga07m45_191596_c1
565 nmdc:mga07m45_202921_c1
566 nmdc:mga07m45_255201_c1
567 nmdc:mga07m45_282_c1
568 nmdc:mga07m45_337072_c1
569 nmdc:mga0qj67_100077_c1
570 nmdc:mga0qj67_1110375_c1
571 nmdc:mga0qj67_854164_c1
572 nmdc:mga08y16_977914_c1
573 Ga0500610_0000115
574 Ga0500610_0000411
575 Ga0495619_0798498
576 Ga0500646_0006562
577 Ga0500583_0193091
578 Ga0500641_0364323
579 Ga0500593_000096
580 Ga0500593_000944
581 Ga0500607_000146
582 Ga0500627_0001531
583 Ga0500633_0100172
584 2548497977
585 2919708640
586 2945948465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

150

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.8151 5 125
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.7977 2 123
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7887 1 124
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.786 1 128
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7824 2 128
ID Description Score Start End Superfamily
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.799 6 55 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7932 6 53 3.30.720.120
4n04B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7711 7 124 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7593 6 125 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7533 66 129 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7T7XBV1-F1-model_v4 deleted 0.9871 2 127
AF-A0A4Q7ZR34-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9786 1 127 GO:0016020
GO:0051213
AF-A0A520FYZ3-F1-model_v4 VOC family protein 0.9762 1 128
AF-A0A3N1GCJ6-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9758 1 127 GO:0016829
AF-A0A501WHB5-F1-model_v4 VOC family protein 0.9757 1 129

Map