F391633

General Info

Members Datasets Scaffolds Average Seq Length
293 164 586 166

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0138516|Ga0439460_0138516_141_737
Length 198
Sequence MIYCRSYNGPFDRGVNTLEKNPSRYASKEENTMPMTAEKAHVSLPSDREVKVTRSFKAAKTLVYRAYTEPALVQRWLLGPPGWSMPVCEMDVRVGGKYKWRWRNDEDGSEFGFAGTFREVVPASKLVHTERYDPGSVGGGFPDQDAIITVAFEEQAGVTTVTSLMDFGSKEIRDAAIATGMTDGMEQSYQLLEKVLAS

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
119 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
120 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
121 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
149 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0138516 3300042461 Unclassified 806
2 Ga0065715_10004419 3300005293 Bacteria 4354
3 Ga0065707_10003051 3300005295 Bacteria 5201
4 Ga0065707_10104600 3300005295 Unclassified 2687
5 Ga0070658_10539036 3300005327 Bacteria 1010
6 Ga0070676_10084843 3300005328 Bacteria 1929
7 Ga0070683_100004065 3300005329 Bacteria 11984
8 Ga0070690_100011696 3300005330 Bacteria 5142
9 Ga0068869_100347699 3300005334 Bacteria 1208
10 Ga0070682_100025556 3300005337 Bacteria 3526
11 Ga0070689_100008809 3300005340 Bacteria 7125
12 Ga0070689_100020430 3300005340 Bacteria 4913
13 Ga0070692_10347707 3300005345 Unclassified 920
14 Ga0070669_100000539 3300005353 Bacteria 28214
15 Ga0070675_100887384 3300005354 Bacteria 817
16 Ga0070674_100017783 3300005356 Bacteria 4479
17 Ga0070674_101816218 3300005356 Bacteria 553
18 Ga0070701_10007792 3300005438 Bacteria 4598
19 Ga0070705_100195277 3300005440 Bacteria 1383
20 Ga0070700_100051581 3300005441 Bacteria 2561
21 Ga0070700_100137993 3300005441 Bacteria 1654
22 Ga0070694_100016867 3300005444 Bacteria 4606
23 Ga0070694_100386192 3300005444 Bacteria 1093
24 Ga0070694_100859948 3300005444 Bacteria 747
25 Ga0070708_100676232 3300005445 Bacteria 972
26 Ga0070662_100027542 3300005457 Unclassified 3946
27 Ga0070681_10413222 3300005458 Bacteria 1261
28 Ga0068867_100001747 3300005459 Bacteria 15132
29 Ga0070685_10330352 3300005466 Bacteria 1036
30 Ga0070707_100180604 3300005468 Bacteria 2057
31 Ga0070707_100207325 3300005468 Bacteria 1910
32 Ga0070707_100234301 3300005468 Bacteria 1787
33 Ga0070707_100287148 3300005468 Bacteria 1599
34 Ga0070698_100024131 3300005471 Bacteria 6346
35 Ga0070698_100275479 3300005471 Bacteria 1614
36 Ga0070699_100027582 3300005518 Bacteria 4897
37 Ga0070699_100032270 3300005518 Bacteria 4521
38 Ga0070699_100139575 3300005518 Unclassified 2139
39 Ga0070699_100941156 3300005518 Bacteria 792
40 Ga0070679_100014902 3300005530 Bacteria 7466
41 Ga0070679_100093523 3300005530 Bacteria 2994
42 Ga0070679_100336568 3300005530 Bacteria 1457
43 Ga0070679_101182161 3300005530 Bacteria 710
44 Ga0070684_100035461 3300005535 Bacteria 4269
45 Ga0070697_100079240 3300005536 Bacteria 2704
46 Ga0070697_100099133 3300005536 Bacteria 2418
47 Ga0070672_100110977 3300005543 Unclassified 2235
48 Ga0070672_100219293 3300005543 Bacteria 1595
49 Ga0070686_100100130 3300005544 Bacteria 1956
50 Ga0070696_100038216 3300005546 Bacteria 3312
51 Ga0070696_100122797 3300005546 Bacteria 1881
52 Ga0070696_100371035 3300005546 Bacteria 1113
53 Ga0070704_100000465 3300005549 Bacteria 19123
54 Ga0070704_100107946 3300005549 Unclassified 2112
55 Ga0070704_100449726 3300005549 Bacteria 1109
56 Ga0068855_100171099 3300005563 Bacteria 2460
57 Ga0068857_100008379 3300005577 Bacteria 8935
58 Ga0070702_100774242 3300005615 Unclassified 739
59 Ga0068852_100147142 3300005616 Bacteria 2186
60 Ga0068859_100001000 3300005617 Bacteria 28965
61 Ga0068864_100038609 3300005618 Bacteria 4079
62 Ga0068861_100001453 3300005719 Bacteria 14995
63 Ga0068870_10000576 3300005840 Bacteria 13934
64 Ga0068858_100563403 3300005842 Bacteria 1103
65 Ga0068860_100196392 3300005843 Bacteria 1954
66 Ga0068860_100404270 3300005843 Bacteria 1351
67 Ga0068862_100001300 3300005844 Bacteria 23311
68 Ga0081455_10038849 3300005937 Bacteria 4212
69 Ga0081455_10158645 3300005937 Bacteria 1736
70 Ga0075428_100001243 3300006844 Bacteria 27231
71 Ga0075428_100017565 3300006844 Bacteria 7902
72 Ga0075428_100020589 3300006844 Bacteria 7305
73 Ga0075428_100313057 3300006844 Bacteria 1687
74 Ga0075430_100006146 3300006846 Bacteria 10113
75 Ga0075430_100078097 3300006846 Bacteria 2775
76 Ga0075431_100013824 3300006847 Bacteria 8152
77 Ga0075431_100299898 3300006847 Bacteria 1624
78 Ga0075431_100576062 3300006847 Unclassified 1111
79 Ga0075433_10011972 3300006852 Bacteria 6994
80 Ga0075433_10032962 3300006852 Bacteria 4439
81 Ga0075433_10120354 3300006852 Bacteria 2331
82 Ga0075433_10122724 3300006852 Bacteria 2307
83 Ga0075433_10370505 3300006852 Bacteria 1265
84 Ga0075434_100042353 3300006871 Unclassified 4514
85 Ga0075434_100052397 3300006871 Bacteria 4054
86 Ga0075434_100356152 3300006871 Bacteria 1484
87 Ga0075434_100743010 3300006871 Bacteria 998
88 Ga0075434_101098742 3300006871 Bacteria 808
89 Ga0075429_100016571 3300006880 Bacteria 6384
90 Ga0075429_100021683 3300006880 Bacteria 5569
91 Ga0075429_100401492 3300006880 Bacteria 1200
92 Ga0068865_100000146 3300006881 Bacteria 37910
93 Ga0075436_100031282 3300006914 Bacteria 3664
94 Ga0075436_100607093 3300006914 Bacteria 806
95 Ga0097620_100001000 3300006931 Bacteria 28965
96 Ga0075435_100049858 3300007076 Bacteria 3368
97 Ga0075435_100163939 3300007076 Bacteria 1873
98 Ga0075435_100243376 3300007076 Bacteria 1530
99 Ga0105240_10051672 3300009093 Bacteria 5170
100 Ga0111539_10013369 3300009094 Bacteria 10260
101 Ga0111539_10048141 3300009094 Bacteria 5091
102 Ga0111539_10145167 3300009094 Unclassified 2778
103 Ga0111539_10201719 3300009094 Bacteria 2319
104 Ga0111539_11962075 3300009094 Unclassified 679
105 Ga0114129_10003640 3300009147 Bacteria 21691
106 Ga0114129_10032738 3300009147 Bacteria 7346
107 Ga0114129_10060765 3300009147 Bacteria 5283
108 Ga0114129_10102081 3300009147 Bacteria 3967
109 Ga0114129_10120604 3300009147 Bacteria 3610
110 Ga0114129_10149659 3300009147 Bacteria 3195
111 Ga0114129_10264680 3300009147 Bacteria 2302
112 Ga0114129_10955437 3300009147 Unclassified 1082
113 Ga0114129_12147458 3300009147 Unclassified 673
114 Ga0105249_10010537 3300009553 Bacteria 8121
115 Ga0157371_10490737 3300013102 Bacteria 906
116 Ga0157374_11529183 3300013296 Unclassified 691
117 Ga0157372_10011282 3300013307 Bacteria 9507
118 Ga0157372_10368725 3300013307 Bacteria 1673
119 Ga0157375_10001688 3300013308 Bacteria 18955
120 Ga0163163_10753351 3300014325 Bacteria 1037
121 Ga0157380_10119173 3300014326 Unclassified 2232
122 Ga0157380_10290600 3300014326 Bacteria 1501
123 Ga0213872_10000206 3300021361 Bacteria 52479
124 Ga0207645_10173213 3300025907 Bacteria 1415
125 Ga0207643_10004084 3300025908 Bacteria 7852
126 Ga0207707_10090854 3300025912 Bacteria 2668
127 Ga0207707_10496756 3300025912 Bacteria 1041
128 Ga0207695_10007468 3300025913 Bacteria 13889
129 Ga0207660_10160530 3300025917 Bacteria 1734
130 Ga0207662_10011856 3300025918 Unclassified 4846
131 Ga0207657_10079746 3300025919 Bacteria 2753
132 Ga0207657_10231228 3300025919 Unclassified 1479
133 Ga0207649_10123025 3300025920 Bacteria 1752
134 Ga0207649_10550231 3300025920 Bacteria 883
135 Ga0207652_10201524 3300025921 Bacteria 1791
136 Ga0207652_10205760 3300025921 Bacteria 1771
137 Ga0207646_10142326 3300025922 Bacteria 2160
138 Ga0207646_10213557 3300025922 Bacteria 1742
139 Ga0207646_10216828 3300025922 Bacteria 1729
140 Ga0207646_10365941 3300025922 Bacteria 1303
141 Ga0207681_10001065 3300025923 Bacteria 17802
142 Ga0207659_10254717 3300025926 Bacteria 1425
143 Ga0207690_10093366 3300025932 Bacteria 2132
144 Ga0207690_11137763 3300025932 Bacteria 651
145 Ga0207706_10091349 3300025933 Unclassified 2677
146 Ga0207670_10001183 3300025936 Bacteria 13781
147 Ga0207670_10025033 3300025936 Bacteria 3740
148 Ga0207669_10159442 3300025937 Bacteria 1591
149 Ga0207704_10000529 3300025938 Bacteria 16999
150 Ga0207691_10119980 3300025940 Bacteria 2332
151 Ga0207691_10342787 3300025940 Bacteria 1279
152 Ga0207661_10001438 3300025944 Bacteria 16058
153 Ga0207712_10006433 3300025961 Bacteria 7407
154 Ga0207708_10003937 3300026075 Bacteria 10930
155 Ga0207708_10970099 3300026075 Bacteria 738
156 Ga0207708_11510142 3300026075 Bacteria 590
157 Ga0207648_10000486 3300026089 Bacteria 44160
158 Ga0207676_10030028 3300026095 Bacteria 4075
159 Ga0207674_10009086 3300026116 Bacteria 11408
160 Ga0207675_100001736 3300026118 Bacteria 21818
161 Ga0207683_11630398 3300026121 Unclassified 594
162 Ga0209971_1027812 3300027682 Bacteria 1352
163 Ga0207428_10000231 3300027907 Bacteria 77049
164 Ga0207428_10024235 3300027907 Bacteria 5097
165 Ga0207428_10047319 3300027907 Bacteria 3454
166 Ga0207428_10368063 3300027907 Unclassified 1056
167 Ga0268265_10000222 3300028380 Bacteria 65954
168 Ga0268264_10783526 3300028381 Bacteria 952
169 Ga0307511_10022927 3300030521 Bacteria 5834
170 Ga0307408_100043730 3300031548 Bacteria 3188
171 Ga0307408_100101579 3300031548 Bacteria 2192
172 Ga0307408_100269900 3300031548 Bacteria 1412
173 Ga0307408_100297380 3300031548 Bacteria 1351
174 Ga0307408_100311038 3300031548 Bacteria 1324
175 Ga0307408_100544253 3300031548 Bacteria 1023
176 Ga0307405_10186883 3300031731 Bacteria 1492
177 Ga0307405_10361447 3300031731 Bacteria 1123
178 Ga0307405_11292165 3300031731 Unclassified 634
179 Ga0307413_10009863 3300031824 Bacteria 4595
180 Ga0307413_10059621 3300031824 Bacteria 2346
181 Ga0307413_10543240 3300031824 Bacteria 941
182 Ga0307410_10104476 3300031852 Bacteria 2037
183 Ga0307410_10155473 3300031852 Bacteria 1707
184 Ga0307406_10088533 3300031901 Bacteria 2077
185 Ga0307406_10872841 3300031901 Unclassified 764
186 Ga0307407_10036666 3300031903 Bacteria 2704
187 Ga0307407_10217223 3300031903 Bacteria 1290
188 Ga0307407_10494809 3300031903 Bacteria 895
189 Ga0307412_10557535 3300031911 Bacteria 963
190 Ga0307409_100192042 3300031995 Bacteria 1819
191 Ga0307409_101098387 3300031995 Bacteria 816
192 Ga0307416_100071186 3300032002 Bacteria 2887
193 Ga0307416_100109938 3300032002 Bacteria 2426
194 Ga0307416_100123877 3300032002 Unclassified 2311
195 Ga0307416_100126529 3300032002 Bacteria 2290
196 Ga0307416_100395677 3300032002 Bacteria 1417
197 Ga0307414_10318088 3300032004 Bacteria 1323
198 Ga0307411_10014353 3300032005 Bacteria 4404
199 Ga0307411_10128823 3300032005 Bacteria 1846
200 Ga0307411_10523203 3300032005 Bacteria 1007
201 Ga0307411_10623127 3300032005 Bacteria 930
202 Ga0307411_10858720 3300032005 Unclassified 803
203 Ga0307415_100013866 3300032126 Bacteria 4718
204 Ga0307415_100727584 3300032126 Bacteria 898
205 Ga0373939_0437173 3300035114 Bacteria 548
206 Ga0373956_0165002 3300035119 Bacteria 1044
207 Ga0373957_0048543 3300035120 Bacteria 1618
208 Ga0373931_0524406 3300035691 Bacteria 767
209 Ga0373933_0193359 3300035724 Bacteria 1300
210 Ga0373937_0032837 3300036401 Bacteria 4709
211 Ga0436361_0079738 3300039447 Bacteria 122121
212 Ga0439453_0021990 3300041408 Bacteria 1153
213 Ga0439453_0033693 3300041408 Bacteria 980
214 Ga0439453_0107293 3300041408 Unclassified 628
215 Ga0450919_024850 3300042121 Unclassified 679
216 Ga0450894_011822 3300042131 Bacteria 1137
217 Ga0450895_011817 3300042132 Bacteria 756
218 Ga0450896_001248 3300042133 Bacteria 3072
219 Ga0450898_014368 3300042134 Bacteria 1330
220 Ga0450908_004434 3300042184 Bacteria 2704
221 Ga0439435_0008609 3300042436 Bacteria 2370
222 Ga0439435_0020919 3300042436 Bacteria 1692
223 Ga0439435_0084844 3300042436 Unclassified 955
224 Ga0439444_0113823 3300042437 Unclassified 625
225 Ga0495641_0246665 3300046461 Unclassified 803
226 Ga0495594_0205417 3300046499 Bacteria 1123
227 Ga0495596_0155171 3300046500 Bacteria 889
228 Ga0495637_0099668 3300046520 Bacteria 1137
229 Ga0495656_0159641 3300046615 Bacteria 1095
230 Ga0495634_0040776 3300046642 Bacteria 3155
231 Ga0495659_0002090 3300046664 Bacteria 6533
232 Ga0495659_0009374 3300046664 Bacteria 3124
233 Ga0495659_0223422 3300046664 Unclassified 778
234 Ga0495589_0031864 3300046794 Unclassified 2653
235 Ga0496102_1277281 3300048905 Bacteria 653
236 Ga0496108_1283142 3300048911 Bacteria 616
237 Ga0496110_1143478 3300048913 Bacteria 687
238 Ga0496112_0257485 3300048915 Bacteria 1695
239 Ga0501031_0197187 3300049568 Bacteria 1314
240 Ga0501036_0278156 3300049572 Bacteria 1401
241 Ga0501036_1366838 3300049572 Bacteria 575
242 Ga0501037_0651596 3300049573 Unclassified 704
243 Ga0501040_0766020 3300049576 Bacteria 698
244 Ga0501042_0257410 3300049578 Bacteria 1260
245 Ga0501048_0192613 3300049582 Bacteria 1445
246 Ga0501072_0244257 3300049588 Bacteria 1430
247 Ga0501072_0400655 3300049588 Bacteria 1088
248 Ga0501075_0037030 3300049591 Bacteria 3643
249 Ga0501209_071380 3300049656 Bacteria 988
250 Ga0501217_152747 3300049661 Unclassified 691
251 Ga0501233_025135 3300049668 Bacteria 1307
252 Ga0501245_077277 3300049708 Unclassified 637
253 Ga0501081_0086964 3300049743 Bacteria 2195
254 Ga0501045_0018848 3300049824 Bacteria 4913
255 nmdc:mga05p37_14452_c1 3300050507 Bacteria 9477
256 nmdc:mga05p37_175896_c1 3300050507 Bacteria 2608
257 nmdc:mga05p37_180868_c1 3300050507 Bacteria 2565
258 nmdc:mga05p37_18525_c1 3300050507 Bacteria 8413
259 nmdc:mga05p37_197517_c1 3300050507 Bacteria 2439
260 nmdc:mga05p37_316513_c1 3300050507 Bacteria 1848
261 nmdc:mga05p37_343346_c1 3300050507 Unclassified 1760
262 nmdc:mga09592_47013_c1 3300050508 Bacteria 3636
263 nmdc:mga09592_9479_c1 3300050508 Bacteria 7913
264 nmdc:mga0qj67_5649_c1 3300050509 Bacteria 9148
265 nmdc:mga06r32_299394_c1 3300050510 Bacteria 1595
266 nmdc:mga06r32_378932_c1 3300050510 Bacteria 1398
267 nmdc:mga08y16_11058_c1 3300050511 Bacteria 9476
268 nmdc:mga08y16_115062_c1 3300050511 Unclassified 2800
269 nmdc:mga08y16_1837951_c1 3300050511 Unclassified 558
270 nmdc:mga08y16_38871_c1 3300050511 Bacteria 4994
271 nmdc:mga08y16_449_c1 3300050511 Bacteria 38214
272 nmdc:mga08y16_57666_c1 3300050511 Bacteria 4057
273 nmdc:mga0n895_19286_c1 3300050512 Bacteria 6335
274 nmdc:mga0n895_412829_c1 3300050512 Bacteria 1365
275 nmdc:mga0n895_629245_c1 3300050512 Bacteria 1073
276 nmdc:mga0n895_826322_c1 3300050512 Bacteria 916
277 nmdc:mga0n895_913619_c1 3300050512 Bacteria 863
278 nmdc:mga0rr50_28624_c1 3300050513 Bacteria 3919
279 nmdc:mga0rr50_70357_c1 3300050513 Bacteria 2666
280 nmdc:mga08x19_109561_c1 3300050514 Bacteria 1841
281 nmdc:mga08x19_537944_c1 3300050514 Bacteria 826
282 nmdc:mga0a205_107362_c1 3300050515 Bacteria 2689
283 nmdc:mga0a205_127695_c1 3300050515 Bacteria 2443
284 nmdc:mga0a205_129424_c1 3300050515 Unclassified 2425
285 nmdc:mga0a205_154656_c1 3300050515 Bacteria 2192
286 nmdc:mga0a205_4801_c1 3300050515 Bacteria 12154
287 nmdc:mga0a205_52857_c1 3300050515 Bacteria 3921
288 Ga0590071_076367 3300059421 Bacteria 830
289 Ga0590071_110976 3300059421 Bacteria 696
290 Ga0590075_111866 3300059424 Bacteria 713
291 Ga0501082_0634582 3300060353 Bacteria 935
292 Ga0501082_1083106 3300060353 Unclassified 700
293 Ga0530510_0982733 3300061734 Bacteria 646
294 Ga0439460_0138516
295 Ga0065715_10004419
296 Ga0065707_10003051
297 Ga0065707_10104600
298 Ga0070658_10539036
299 Ga0070676_10084843
300 Ga0070683_100004065
301 Ga0070690_100011696
302 Ga0068869_100347699
303 Ga0070682_100025556
304 Ga0070689_100008809
305 Ga0070689_100020430
306 Ga0070692_10347707
307 Ga0070669_100000539
308 Ga0070675_100887384
309 Ga0070674_100017783
310 Ga0070674_101816218
311 Ga0070701_10007792
312 Ga0070705_100195277
313 Ga0070700_100051581
314 Ga0070700_100137993
315 Ga0070694_100016867
316 Ga0070694_100386192
317 Ga0070694_100859948
318 Ga0070708_100676232
319 Ga0070662_100027542
320 Ga0070681_10413222
321 Ga0068867_100001747
322 Ga0070685_10330352
323 Ga0070707_100180604
324 Ga0070707_100207325
325 Ga0070707_100234301
326 Ga0070707_100287148
327 Ga0070698_100024131
328 Ga0070698_100275479
329 Ga0070699_100027582
330 Ga0070699_100032270
331 Ga0070699_100139575
332 Ga0070699_100941156
333 Ga0070679_100014902
334 Ga0070679_100093523
335 Ga0070679_100336568
336 Ga0070679_101182161
337 Ga0070684_100035461
338 Ga0070697_100079240
339 Ga0070697_100099133
340 Ga0070672_100110977
341 Ga0070672_100219293
342 Ga0070686_100100130
343 Ga0070696_100038216
344 Ga0070696_100122797
345 Ga0070696_100371035
346 Ga0070704_100000465
347 Ga0070704_100107946
348 Ga0070704_100449726
349 Ga0068855_100171099
350 Ga0068857_100008379
351 Ga0070702_100774242
352 Ga0068852_100147142
353 Ga0068859_100001000
354 Ga0068864_100038609
355 Ga0068861_100001453
356 Ga0068870_10000576
357 Ga0068858_100563403
358 Ga0068860_100196392
359 Ga0068860_100404270
360 Ga0068862_100001300
361 Ga0081455_10038849
362 Ga0081455_10158645
363 Ga0075428_100001243
364 Ga0075428_100017565
365 Ga0075428_100020589
366 Ga0075428_100313057
367 Ga0075430_100006146
368 Ga0075430_100078097
369 Ga0075431_100013824
370 Ga0075431_100299898
371 Ga0075431_100576062
372 Ga0075433_10011972
373 Ga0075433_10032962
374 Ga0075433_10120354
375 Ga0075433_10122724
376 Ga0075433_10370505
377 Ga0075434_100042353
378 Ga0075434_100052397
379 Ga0075434_100356152
380 Ga0075434_100743010
381 Ga0075434_101098742
382 Ga0075429_100016571
383 Ga0075429_100021683
384 Ga0075429_100401492
385 Ga0068865_100000146
386 Ga0075436_100031282
387 Ga0075436_100607093
388 Ga0097620_100001000
389 Ga0075435_100049858
390 Ga0075435_100163939
391 Ga0075435_100243376
392 Ga0105240_10051672
393 Ga0111539_10013369
394 Ga0111539_10048141
395 Ga0111539_10145167
396 Ga0111539_10201719
397 Ga0111539_11962075
398 Ga0114129_10003640
399 Ga0114129_10032738
400 Ga0114129_10060765
401 Ga0114129_10102081
402 Ga0114129_10120604
403 Ga0114129_10149659
404 Ga0114129_10264680
405 Ga0114129_10955437
406 Ga0114129_12147458
407 Ga0105249_10010537
408 Ga0157371_10490737
409 Ga0157374_11529183
410 Ga0157372_10011282
411 Ga0157372_10368725
412 Ga0157375_10001688
413 Ga0163163_10753351
414 Ga0157380_10119173
415 Ga0157380_10290600
416 Ga0213872_10000206
417 Ga0207645_10173213
418 Ga0207643_10004084
419 Ga0207707_10090854
420 Ga0207707_10496756
421 Ga0207695_10007468
422 Ga0207660_10160530
423 Ga0207662_10011856
424 Ga0207657_10079746
425 Ga0207657_10231228
426 Ga0207649_10123025
427 Ga0207649_10550231
428 Ga0207652_10201524
429 Ga0207652_10205760
430 Ga0207646_10142326
431 Ga0207646_10213557
432 Ga0207646_10216828
433 Ga0207646_10365941
434 Ga0207681_10001065
435 Ga0207659_10254717
436 Ga0207690_10093366
437 Ga0207690_11137763
438 Ga0207706_10091349
439 Ga0207670_10001183
440 Ga0207670_10025033
441 Ga0207669_10159442
442 Ga0207704_10000529
443 Ga0207691_10119980
444 Ga0207691_10342787
445 Ga0207661_10001438
446 Ga0207712_10006433
447 Ga0207708_10003937
448 Ga0207708_10970099
449 Ga0207708_11510142
450 Ga0207648_10000486
451 Ga0207676_10030028
452 Ga0207674_10009086
453 Ga0207675_100001736
454 Ga0207683_11630398
455 Ga0209971_1027812
456 Ga0207428_10000231
457 Ga0207428_10024235
458 Ga0207428_10047319
459 Ga0207428_10368063
460 Ga0268265_10000222
461 Ga0268264_10783526
462 Ga0307511_10022927
463 Ga0307408_100043730
464 Ga0307408_100101579
465 Ga0307408_100269900
466 Ga0307408_100297380
467 Ga0307408_100311038
468 Ga0307408_100544253
469 Ga0307405_10186883
470 Ga0307405_10361447
471 Ga0307405_11292165
472 Ga0307413_10009863
473 Ga0307413_10059621
474 Ga0307413_10543240
475 Ga0307410_10104476
476 Ga0307410_10155473
477 Ga0307406_10088533
478 Ga0307406_10872841
479 Ga0307407_10036666
480 Ga0307407_10217223
481 Ga0307407_10494809
482 Ga0307412_10557535
483 Ga0307409_100192042
484 Ga0307409_101098387
485 Ga0307416_100071186
486 Ga0307416_100109938
487 Ga0307416_100123877
488 Ga0307416_100126529
489 Ga0307416_100395677
490 Ga0307414_10318088
491 Ga0307411_10014353
492 Ga0307411_10128823
493 Ga0307411_10523203
494 Ga0307411_10623127
495 Ga0307411_10858720
496 Ga0307415_100013866
497 Ga0307415_100727584
498 Ga0373939_0437173
499 Ga0373956_0165002
500 Ga0373957_0048543
501 Ga0373931_0524406
502 Ga0373933_0193359
503 Ga0373937_0032837
504 Ga0436361_0079738
505 Ga0439453_0021990
506 Ga0439453_0033693
507 Ga0439453_0107293
508 Ga0450919_024850
509 Ga0450894_011822
510 Ga0450895_011817
511 Ga0450896_001248
512 Ga0450898_014368
513 Ga0450908_004434
514 Ga0439435_0008609
515 Ga0439435_0020919
516 Ga0439435_0084844
517 Ga0439444_0113823
518 Ga0495641_0246665
519 Ga0495594_0205417
520 Ga0495596_0155171
521 Ga0495637_0099668
522 Ga0495656_0159641
523 Ga0495634_0040776
524 Ga0495659_0002090
525 Ga0495659_0009374
526 Ga0495659_0223422
527 Ga0495589_0031864
528 Ga0496102_1277281
529 Ga0496108_1283142
530 Ga0496110_1143478
531 Ga0496112_0257485
532 Ga0501031_0197187
533 Ga0501036_0278156
534 Ga0501036_1366838
535 Ga0501037_0651596
536 Ga0501040_0766020
537 Ga0501042_0257410
538 Ga0501048_0192613
539 Ga0501072_0244257
540 Ga0501072_0400655
541 Ga0501075_0037030
542 Ga0501209_071380
543 Ga0501217_152747
544 Ga0501233_025135
545 Ga0501245_077277
546 Ga0501081_0086964
547 Ga0501045_0018848
548 nmdc:mga05p37_14452_c1
549 nmdc:mga05p37_175896_c1
550 nmdc:mga05p37_180868_c1
551 nmdc:mga05p37_18525_c1
552 nmdc:mga05p37_197517_c1
553 nmdc:mga05p37_316513_c1
554 nmdc:mga05p37_343346_c1
555 nmdc:mga09592_47013_c1
556 nmdc:mga09592_9479_c1
557 nmdc:mga0qj67_5649_c1
558 nmdc:mga06r32_299394_c1
559 nmdc:mga06r32_378932_c1
560 nmdc:mga08y16_11058_c1
561 nmdc:mga08y16_115062_c1
562 nmdc:mga08y16_1837951_c1
563 nmdc:mga08y16_38871_c1
564 nmdc:mga08y16_449_c1
565 nmdc:mga08y16_57666_c1
566 nmdc:mga0n895_19286_c1
567 nmdc:mga0n895_412829_c1
568 nmdc:mga0n895_629245_c1
569 nmdc:mga0n895_826322_c1
570 nmdc:mga0n895_913619_c1
571 nmdc:mga0rr50_28624_c1
572 nmdc:mga0rr50_70357_c1
573 nmdc:mga08x19_109561_c1
574 nmdc:mga08x19_537944_c1
575 nmdc:mga0a205_107362_c1
576 nmdc:mga0a205_127695_c1
577 nmdc:mga0a205_129424_c1
578 nmdc:mga0a205_154656_c1
579 nmdc:mga0a205_4801_c1
580 nmdc:mga0a205_52857_c1
581 Ga0590071_076367
582 Ga0590071_110976
583 Ga0590075_111866
584 Ga0501082_0634582
585 Ga0501082_1083106
586 Ga0530510_0982733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

57

197

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8696 7 161
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8663 7 161
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8642 9 161
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8621 7 161
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.8585 7 161
ID Description Score Start End Superfamily
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8376 9 159 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8364 8 162 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8307 16 160 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8285 17 160 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8282 17 159 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A853JF16-F1-model_v4 SRPBCC family protein 0.9016 4 162
AF-A0A838GF31-F1-model_v4 SRPBCC family protein 0.8879 11 163
AF-A0A348PDH4-F1-model_v4 ATPase 0.8876 7 161
AF-F0SG37-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.8831 6 160
AF-A0A1M6CPW5-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.8825 4 161

Map