F391575

General Info

Members Datasets Scaffolds Average Seq Length
293 163 586 132

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10334995|Ga0307514_103349952
Length 146
Sequence MILSLDMDSEVPIYQQIRDRIVEAIASGQLIEGSSLPSTRQLAVDLGINFHTVNKAYDLLRREGLVRVNRKSGALVQRDPRSGPPEPGFTAEWETRLRTLLAEAVAHGNGDPAVLDNCRSVLISFASPEPASRHAKPSAEQGDSAL

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 2558860280 Kutzneria sp. 744 Isolate Unclassified
149 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
150 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
151 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
152 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
153 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
154 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
155 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
156 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
157 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
158 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
159 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
160 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
161 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
162 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
163 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.54
Metatranscriptomes 0
Isolates 5.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 27.3
Rhizosphere 58.36
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10334995 3300031649 Bacteria 819
2 rootH2_10166364 3300003320 Bacteria 1145
3 rootH1_10149529 3300003323 Bacteria 1690
4 Ga0065714_10133872 3300005288 Bacteria 1226
5 Ga0070683_100027069 3300005329 Bacteria 5169
6 Ga0070683_100652650 3300005329 Bacteria 1007
7 Ga0070670_100070446 3300005331 Bacteria 3002
8 Ga0070670_100718733 3300005331 Bacteria 899
9 Ga0070680_101697657 3300005336 Bacteria 547
10 Ga0070682_100236661 3300005337 Bacteria 1309
11 Ga0068868_100725125 3300005338 Bacteria 891
12 Ga0070671_101439930 3300005355 Bacteria 609
13 Ga0070659_101476396 3300005366 Bacteria 605
14 Ga0070709_10868117 3300005434 Bacteria 712
15 Ga0070709_11689845 3300005434 Bacteria 517
16 Ga0070714_100018330 3300005435 Bacteria 5685
17 Ga0070714_100639350 3300005435 Bacteria 1023
18 Ga0070714_100699421 3300005435 Bacteria 978
19 Ga0070714_100752566 3300005435 Bacteria 942
20 Ga0070714_101210569 3300005435 Bacteria 737
21 Ga0070714_101266184 3300005435 Bacteria 720
22 Ga0070711_100769090 3300005439 Bacteria 815
23 Ga0070678_100285115 3300005456 Unclassified 1398
24 Ga0070684_100016236 3300005535 Bacteria 6082
25 Ga0068853_100009079 3300005539 Bacteria 8005
26 Ga0070664_100085125 3300005564 Bacteria 2730
27 Ga0070664_101293248 3300005564 Bacteria 689
28 Ga0068857_101878762 3300005577 Bacteria 587
29 Ga0068859_101517188 3300005617 Bacteria 740
30 Ga0068864_100128741 3300005618 Bacteria 2271
31 Ga0068864_100325788 3300005618 Bacteria 1444
32 Ga0068864_100770269 3300005618 Bacteria 944
33 Ga0068863_100004942 3300005841 Bacteria 13145
34 Ga0068863_100064759 3300005841 Bacteria 3457
35 Ga0070716_100520910 3300006173 Bacteria 881
36 Ga0070712_100536479 3300006175 Bacteria 984
37 Ga0097620_101516740 3300006931 Bacteria 740
38 Ga0105251_10187948 3300009011 Bacteria 930
39 Ga0105245_10688711 3300009098 Bacteria 1055
40 Ga0105247_10858946 3300009101 Bacteria 697
41 Ga0105243_11132967 3300009148 Bacteria 792
42 Ga0105243_11370645 3300009148 Bacteria 727
43 Ga0105242_11121826 3300009176 Bacteria 802
44 Ga0105248_11854455 3300009177 Bacteria 684
45 Ga0105237_10358558 3300009545 Bacteria 1462
46 Ga0105237_10474695 3300009545 Bacteria 1257
47 Ga0105237_12529645 3300009545 Bacteria 524
48 Ga0105238_10043677 3300009551 Bacteria 4534
49 Ga0105239_10568224 3300010375 Bacteria 1292
50 Ga0105239_11169435 3300010375 Bacteria 886
51 Ga0157370_11185573 3300013104 Bacteria 689
52 Ga0157369_10012362 3300013105 Bacteria 9692
53 Ga0157369_10085950 3300013105 Bacteria 3360
54 Ga0157369_10254815 3300013105 Bacteria 1831
55 Ga0157369_10459214 3300013105 Bacteria 1319
56 Ga0157374_10621006 3300013296 Bacteria 1091
57 Ga0157374_12326651 3300013296 Bacteria 563
58 Ga0163162_10024243 3300013306 Bacteria 5988
59 Ga0163162_10531775 3300013306 Bacteria 1305
60 Ga0157372_10739745 3300013307 Bacteria 1144
61 Ga0157375_10201484 3300013308 Bacteria 2146
62 Ga0157375_10573241 3300013308 Bacteria 1289
63 Ga0157375_11038909 3300013308 Bacteria 957
64 Ga0163163_10012770 3300014325 Bacteria 7663
65 Ga0163163_11307332 3300014325 Bacteria 787
66 Ga0157379_10010685 3300014968 Bacteria 7998
67 Ga0157379_10192784 3300014968 Bacteria 1841
68 Ga0157376_10422277 3300014969 Bacteria 1294
69 Ga0157376_10956168 3300014969 Bacteria 877
70 Ga0213873_10235204 3300021358 Bacteria 577
71 Ga0213872_10171316 3300021361 Bacteria 941
72 Ga0213876_10042912 3300021384 Bacteria 2390
73 Ga0213876_10063993 3300021384 Bacteria 1942
74 Ga0213875_10010790 3300021388 Bacteria 4567
75 Ga0213875_10044746 3300021388 Bacteria 2078
76 Ga0213875_10061332 3300021388 Bacteria 1759
77 Ga0213875_10150311 3300021388 Bacteria 1091
78 Ga0207655_1041652 3300025728 Bacteria 1966
79 Ga0207647_10737617 3300025904 Bacteria 534
80 Ga0207699_11094807 3300025906 Bacteria 590
81 Ga0207660_11489653 3300025917 Bacteria 547
82 Ga0207694_10258362 3300025924 Bacteria 1426
83 Ga0207650_10486915 3300025925 Bacteria 1030
84 Ga0207650_10973371 3300025925 Bacteria 721
85 Ga0207687_10086367 3300025927 Bacteria 2278
86 Ga0207664_10035280 3300025929 Bacteria 3858
87 Ga0207664_10317212 3300025929 Bacteria 1375
88 Ga0207664_11033708 3300025929 Bacteria 736
89 Ga0207664_11236358 3300025929 Bacteria 665
90 Ga0207709_10358498 3300025935 Bacteria 1103
91 Ga0207709_10405017 3300025935 Bacteria 1044
92 Ga0207665_10472566 3300025939 Bacteria 965
93 Ga0207689_10481122 3300025942 Bacteria 1039
94 Ga0207661_10010643 3300025944 Bacteria 6628
95 Ga0207661_10770612 3300025944 Bacteria 886
96 Ga0207679_10058535 3300025945 Bacteria 2856
97 Ga0207679_10726211 3300025945 Bacteria 902
98 Ga0207677_10680900 3300026023 Bacteria 911
99 Ga0207641_10060147 3300026088 Bacteria 3237
100 Ga0207641_11304552 3300026088 Bacteria 726
101 Ga0207676_10274610 3300026095 Bacteria 1528
102 Ga0207676_10601220 3300026095 Bacteria 1056
103 Ga0207674_10152903 3300026116 Bacteria 2264
104 Ga0207683_10588410 3300026121 Unclassified 1030
105 Ga0207698_10254322 3300026142 Bacteria 1610
106 Ga0307511_10001388 3300030521 Bacteria 25591
107 Ga0307511_10009003 3300030521 Bacteria 9961
108 Ga0307508_10012699 3300031616 Bacteria 7704
109 Ga0373925_0172833 3300037068 Bacteria 1706
110 Ga0395899_0325264 3300037312 Bacteria 1034
111 Ga0395900_0148793 3300037418 Bacteria 2393
112 Ga0395898_0687007 3300037466 Bacteria 965
113 Ga0395905_0093197 3300037471 Bacteria 2825
114 Ga0436364_0087813 3300037853 Bacteria 2906
115 Ga0436364_1270103 3300037853 Bacteria 1885
116 Ga0436364_1332727 3300037853 Bacteria 4981
117 Ga0395901_0724859 3300038443 Bacteria 989
118 Ga0395901_0966687 3300038443 Bacteria 829
119 Ga0436365_0331794 3300039437 Bacteria 508
120 Ga0436365_1029714 3300039437 Bacteria 659
121 Ga0436365_1097639 3300039437 Bacteria 6991
122 Ga0436365_1452685 3300039437 Bacteria 2066
123 Ga0436365_1707344 3300039437 Bacteria 1634
124 Ga0436361_0148491 3300039447 Bacteria 2026
125 Ga0436362_0279381 3300039453 Bacteria 1323
126 Ga0436362_0526389 3300039453 Bacteria 838
127 Ga0451833_0603406 3300041491 Bacteria 1024
128 Ga0451837_1160618 3300041494 Bacteria 522
129 Ga0466969_0005163 3300044656 Bacteria 6941
130 Ga0466969_0053087 3300044656 Bacteria 1990
131 Ga0466969_0088999 3300044656 Bacteria 1465
132 Ga0466966_0080888 3300044684 Bacteria 2023
133 Ga0466966_0110629 3300044684 Bacteria 1693
134 Ga0466966_0157742 3300044684 Bacteria 1382
135 Ga0466961_0059006 3300044693 Bacteria 2440
136 Ga0466961_0585591 3300044693 Bacteria 671
137 Ga0466971_0410147 3300044719 Bacteria 661
138 Ga0466970_0004767 3300044765 Bacteria 6699
139 Ga0466970_0008586 3300044765 Bacteria 5145
140 Ga0466970_0034694 3300044765 Bacteria 2672
141 Ga0466957_0285851 3300044842 Bacteria 1105
142 Ga0466960_0054546 3300044901 Bacteria 1941
143 Ga0466959_0002278 3300045049 Bacteria 12242
144 Ga0466959_0007150 3300045049 Bacteria 7813
145 Ga0466958_0032290 3300045836 Bacteria 3115
146 Ga0466967_0051616 3300045976 Bacteria 3605
147 Ga0495603_0338044 3300046455 Bacteria 864
148 Ga0495629_0181894 3300046459 Bacteria 1457
149 Ga0495629_0239366 3300046459 Bacteria 1250
150 Ga0495629_0465691 3300046459 Unclassified 855
151 Ga0495651_0413159 3300046462 Bacteria 879
152 Ga0495653_0001194 3300046463 Bacteria 20132
153 Ga0495580_0003197 3300046472 Bacteria 14030
154 Ga0495582_0062910 3300046473 Bacteria 2050
155 Ga0495664_0322585 3300046477 Bacteria 931
156 Ga0495594_0192880 3300046499 Bacteria 1161
157 Ga0495665_0001149 3300046531 Bacteria 14052
158 Ga0495640_0681016 3300046533 Bacteria 618
159 Ga0495586_0000685 3300046535 Bacteria 19319
160 Ga0495586_0085124 3300046535 Bacteria 1741
161 Ga0495587_0005356 3300046536 Bacteria 8391
162 Ga0495645_0001843 3300046543 Bacteria 14401
163 Ga0495667_0000411 3300046559 Bacteria 27443
164 Ga0495634_0442438 3300046642 Bacteria 768
165 Ga0495635_0234308 3300046663 Bacteria 1240
166 Ga0495588_0063134 3300046674 Bacteria 1920
167 Ga0495657_0126569 3300046675 Bacteria 1604
168 Ga0495623_0025238 3300046679 Bacteria 3828
169 Ga0495658_0147563 3300046683 Bacteria 1443
170 Ga0495624_0155100 3300046690 Bacteria 1400
171 Ga0495600_0001462 3300046809 Bacteria 13100
172 Ga0495581_0000682 3300047315 Bacteria 17823
173 Ga0495581_0102464 3300047315 Bacteria 1663
174 Ga0495581_0373141 3300047315 Bacteria 833
175 Ga0495676_0363603 3300047321 Bacteria 966
176 Ga0495680_0025790 3300047322 Bacteria 4859
177 Ga0495680_0579034 3300047322 Bacteria 753
178 Ga0495687_029897 3300047443 Bacteria 2514
179 Ga0495675_0015366 3300047444 Bacteria 4841
180 Ga0495593_0183804 3300047673 Bacteria 1052
181 Ga0495593_0307993 3300047673 Bacteria 792
182 Ga0495593_0394339 3300047673 Bacteria 692
183 Ga0495602_0680804 3300048088 Bacteria 700
184 Ga0495614_0299549 3300048089 Bacteria 743
185 Ga0496100_0000861 3300048903 Bacteria 14513
186 Ga0496100_0012410 3300048903 Bacteria 4884
187 Ga0496100_0086588 3300048903 Bacteria 2128
188 Ga0496100_0167970 3300048903 Bacteria 1577
189 Ga0496100_0293859 3300048903 Bacteria 1214
190 Ga0496100_0584166 3300048903 Bacteria 866
191 Ga0496101_0007857 3300048904 Bacteria 6940
192 Ga0496101_0038485 3300048904 Bacteria 3397
193 Ga0496101_0045317 3300048904 Bacteria 3150
194 Ga0496102_0000552 3300048905 Bacteria 40219
195 Ga0496102_0000835 3300048905 Bacteria 29574
196 Ga0496102_0006233 3300048905 Bacteria 10169
197 Ga0496102_0020620 3300048905 Bacteria 5825
198 Ga0496102_0193547 3300048905 Bacteria 1916
199 Ga0496102_0445752 3300048905 Bacteria 1214
200 Ga0496102_0630894 3300048905 Bacteria 995
201 Ga0496103_0000374 3300048906 Bacteria 40177
202 Ga0496103_0001008 3300048906 Bacteria 19706
203 Ga0496103_0023413 3300048906 Bacteria 3724
204 Ga0496103_0118224 3300048906 Bacteria 1687
205 Ga0496103_0209184 3300048906 Bacteria 1254
206 Ga0496103_0249123 3300048906 Bacteria 1143
207 Ga0496103_0466576 3300048906 Bacteria 809
208 Ga0496103_0587279 3300048906 Bacteria 710
209 Ga0496103_1007548 3300048906 Bacteria 518
210 Ga0496104_0008358 3300048907 Bacteria 9199
211 Ga0496104_0032087 3300048907 Bacteria 4888
212 Ga0496104_0047307 3300048907 Bacteria 4054
213 Ga0496104_0073574 3300048907 Bacteria 3251
214 Ga0496104_0103437 3300048907 Bacteria 2728
215 Ga0496105_0002508 3300048908 Bacteria 13313
216 Ga0496105_0105026 3300048908 Bacteria 2332
217 Ga0496105_0117106 3300048908 Bacteria 2197
218 Ga0496105_0173292 3300048908 Bacteria 1768
219 Ga0496106_0004726 3300048909 Bacteria 10078
220 Ga0496106_0019454 3300048909 Bacteria 5036
221 Ga0496107_0011353 3300048910 Bacteria 6200
222 Ga0496107_0042446 3300048910 Bacteria 3266
223 Ga0496107_0275380 3300048910 Bacteria 1252
224 Ga0496107_0302007 3300048910 Bacteria 1191
225 Ga0496107_1237440 3300048910 Bacteria 536
226 Ga0496108_0002510 3300048911 Bacteria 14672
227 Ga0496108_0031747 3300048911 Bacteria 4384
228 Ga0496108_0049649 3300048911 Bacteria 3509
229 Ga0496108_0138945 3300048911 Bacteria 2092
230 Ga0496108_0675814 3300048911 Bacteria 896
231 Ga0496109_0000167 3300048912 Bacteria 64493
232 Ga0496109_0014028 3300048912 Bacteria 6965
233 Ga0496109_0156257 3300048912 Bacteria 2136
234 Ga0496109_0186936 3300048912 Bacteria 1946
235 Ga0496109_0869257 3300048912 Bacteria 839
236 Ga0496110_0000220 3300048913 Bacteria 37013
237 Ga0496110_0007186 3300048913 Bacteria 8865
238 Ga0496110_0025442 3300048913 Bacteria 5058
239 Ga0496110_0031438 3300048913 Bacteria 4580
240 Ga0496110_0083177 3300048913 Bacteria 2855
241 Ga0496110_0392765 3300048913 Bacteria 1264
242 Ga0496110_1565324 3300048913 Bacteria 569
243 Ga0496111_0003323 3300048914 Bacteria 9942
244 Ga0496111_0014499 3300048914 Bacteria 5386
245 Ga0496111_0016393 3300048914 Bacteria 5103
246 Ga0496111_0049046 3300048914 Bacteria 3044
247 Ga0496111_0114904 3300048914 Bacteria 1984
248 Ga0496111_0206838 3300048914 Bacteria 1458
249 Ga0496112_0009181 3300048915 Bacteria 8885
250 Ga0496112_0056378 3300048915 Bacteria 3867
251 Ga0496112_0322421 3300048915 Bacteria 1489
252 Ga0496112_0325650 3300048915 Bacteria 1480
253 Ga0496113_0032868 3300048916 Bacteria 3772
254 Ga0496113_0060427 3300048916 Bacteria 2857
255 Ga0496113_0212211 3300048916 Bacteria 1541
256 Ga0496113_0233897 3300048916 Bacteria 1465
257 Ga0496113_0953053 3300048916 Unclassified 677
258 Ga0496114_0022624 3300048917 Bacteria 5124
259 Ga0496114_0049210 3300048917 Bacteria 3507
260 Ga0496114_0064675 3300048917 Bacteria 3063
261 Ga0496114_0126627 3300048917 Bacteria 2202
262 Ga0496114_0979272 3300048917 Unclassified 728
263 Ga0496115_0102672 3300048918 Bacteria 2345
264 Ga0496115_0288333 3300048918 Bacteria 1347
265 Ga0496116_0000790 3300048919 Bacteria 40219
266 Ga0496117_0000487 3300048920 Bacteria 65641
267 Ga0496118_0000063 3300048921 Bacteria 214325
268 Ga0496119_0000053 3300048922 Bacteria 182875
269 Ga0496120_0003030 3300048923 Bacteria 15882
270 Ga0496121_0011965 3300048924 Bacteria 9545
271 Ga0496121_0014147 3300048924 Bacteria 8499
272 Ga0496124_0312052 3300048927 Bacteria 1130
273 Ga0496125_0025693 3300048928 Bacteria 5387
274 Ga0496125_0028552 3300048928 Bacteria 5035
275 Ga0496126_0001286 3300048929 Bacteria 40219
276 Ga0501031_0013419 3300049568 Bacteria 5344
277 Ga0466962_0167190 3300061719 Bacteria 1070
278 2559423834 2558860280 Bacteria 11429938
279 2586060926 2585427649 Bacteria 9053857
280 2616902434 2616644941 Bacteria 8510691
281 2729906744 2728369276 Bacteria 5610032
282 2795783517 2795385470 Bacteria 8317180
283 2808877997 2808606366 Bacteria 4415912
284 2808895500 2808606371 Bacteria 4251511
285 2809590051 2808606522 Bacteria 9488490
286 2827633926 2827628540 Bacteria 6858585
287 2880490565 2880489317 Bacteria 7096270
288 2915770445 2915768154 Bacteria 8424322
289 2917743197 2917736166 Bacteria 9690793
290 2919053847 2919051321 Bacteria 4210889
291 8004027314 8004025490 Bacteria 4327753
292 8025416065 8025413630 Bacteria 7014048
293 8056062360 8056060235 Bacteria 7259403
294 Ga0307514_10334995
295 rootH2_10166364
296 rootH1_10149529
297 Ga0065714_10133872
298 Ga0070683_100027069
299 Ga0070683_100652650
300 Ga0070670_100070446
301 Ga0070670_100718733
302 Ga0070680_101697657
303 Ga0070682_100236661
304 Ga0068868_100725125
305 Ga0070671_101439930
306 Ga0070659_101476396
307 Ga0070709_10868117
308 Ga0070709_11689845
309 Ga0070714_100018330
310 Ga0070714_100639350
311 Ga0070714_100699421
312 Ga0070714_100752566
313 Ga0070714_101210569
314 Ga0070714_101266184
315 Ga0070711_100769090
316 Ga0070678_100285115
317 Ga0070684_100016236
318 Ga0068853_100009079
319 Ga0070664_100085125
320 Ga0070664_101293248
321 Ga0068857_101878762
322 Ga0068859_101517188
323 Ga0068864_100128741
324 Ga0068864_100325788
325 Ga0068864_100770269
326 Ga0068863_100004942
327 Ga0068863_100064759
328 Ga0070716_100520910
329 Ga0070712_100536479
330 Ga0097620_101516740
331 Ga0105251_10187948
332 Ga0105245_10688711
333 Ga0105247_10858946
334 Ga0105243_11132967
335 Ga0105243_11370645
336 Ga0105242_11121826
337 Ga0105248_11854455
338 Ga0105237_10358558
339 Ga0105237_10474695
340 Ga0105237_12529645
341 Ga0105238_10043677
342 Ga0105239_10568224
343 Ga0105239_11169435
344 Ga0157370_11185573
345 Ga0157369_10012362
346 Ga0157369_10085950
347 Ga0157369_10254815
348 Ga0157369_10459214
349 Ga0157374_10621006
350 Ga0157374_12326651
351 Ga0163162_10024243
352 Ga0163162_10531775
353 Ga0157372_10739745
354 Ga0157375_10201484
355 Ga0157375_10573241
356 Ga0157375_11038909
357 Ga0163163_10012770
358 Ga0163163_11307332
359 Ga0157379_10010685
360 Ga0157379_10192784
361 Ga0157376_10422277
362 Ga0157376_10956168
363 Ga0213873_10235204
364 Ga0213872_10171316
365 Ga0213876_10042912
366 Ga0213876_10063993
367 Ga0213875_10010790
368 Ga0213875_10044746
369 Ga0213875_10061332
370 Ga0213875_10150311
371 Ga0207655_1041652
372 Ga0207647_10737617
373 Ga0207699_11094807
374 Ga0207660_11489653
375 Ga0207694_10258362
376 Ga0207650_10486915
377 Ga0207650_10973371
378 Ga0207687_10086367
379 Ga0207664_10035280
380 Ga0207664_10317212
381 Ga0207664_11033708
382 Ga0207664_11236358
383 Ga0207709_10358498
384 Ga0207709_10405017
385 Ga0207665_10472566
386 Ga0207689_10481122
387 Ga0207661_10010643
388 Ga0207661_10770612
389 Ga0207679_10058535
390 Ga0207679_10726211
391 Ga0207677_10680900
392 Ga0207641_10060147
393 Ga0207641_11304552
394 Ga0207676_10274610
395 Ga0207676_10601220
396 Ga0207674_10152903
397 Ga0207683_10588410
398 Ga0207698_10254322
399 Ga0307511_10001388
400 Ga0307511_10009003
401 Ga0307508_10012699
402 Ga0373925_0172833
403 Ga0395899_0325264
404 Ga0395900_0148793
405 Ga0395898_0687007
406 Ga0395905_0093197
407 Ga0436364_0087813
408 Ga0436364_1270103
409 Ga0436364_1332727
410 Ga0395901_0724859
411 Ga0395901_0966687
412 Ga0436365_0331794
413 Ga0436365_1029714
414 Ga0436365_1097639
415 Ga0436365_1452685
416 Ga0436365_1707344
417 Ga0436361_0148491
418 Ga0436362_0279381
419 Ga0436362_0526389
420 Ga0451833_0603406
421 Ga0451837_1160618
422 Ga0466969_0005163
423 Ga0466969_0053087
424 Ga0466969_0088999
425 Ga0466966_0080888
426 Ga0466966_0110629
427 Ga0466966_0157742
428 Ga0466961_0059006
429 Ga0466961_0585591
430 Ga0466971_0410147
431 Ga0466970_0004767
432 Ga0466970_0008586
433 Ga0466970_0034694
434 Ga0466957_0285851
435 Ga0466960_0054546
436 Ga0466959_0002278
437 Ga0466959_0007150
438 Ga0466958_0032290
439 Ga0466967_0051616
440 Ga0495603_0338044
441 Ga0495629_0181894
442 Ga0495629_0239366
443 Ga0495629_0465691
444 Ga0495651_0413159
445 Ga0495653_0001194
446 Ga0495580_0003197
447 Ga0495582_0062910
448 Ga0495664_0322585
449 Ga0495594_0192880
450 Ga0495665_0001149
451 Ga0495640_0681016
452 Ga0495586_0000685
453 Ga0495586_0085124
454 Ga0495587_0005356
455 Ga0495645_0001843
456 Ga0495667_0000411
457 Ga0495634_0442438
458 Ga0495635_0234308
459 Ga0495588_0063134
460 Ga0495657_0126569
461 Ga0495623_0025238
462 Ga0495658_0147563
463 Ga0495624_0155100
464 Ga0495600_0001462
465 Ga0495581_0000682
466 Ga0495581_0102464
467 Ga0495581_0373141
468 Ga0495676_0363603
469 Ga0495680_0025790
470 Ga0495680_0579034
471 Ga0495687_029897
472 Ga0495675_0015366
473 Ga0495593_0183804
474 Ga0495593_0307993
475 Ga0495593_0394339
476 Ga0495602_0680804
477 Ga0495614_0299549
478 Ga0496100_0000861
479 Ga0496100_0012410
480 Ga0496100_0086588
481 Ga0496100_0167970
482 Ga0496100_0293859
483 Ga0496100_0584166
484 Ga0496101_0007857
485 Ga0496101_0038485
486 Ga0496101_0045317
487 Ga0496102_0000552
488 Ga0496102_0000835
489 Ga0496102_0006233
490 Ga0496102_0020620
491 Ga0496102_0193547
492 Ga0496102_0445752
493 Ga0496102_0630894
494 Ga0496103_0000374
495 Ga0496103_0001008
496 Ga0496103_0023413
497 Ga0496103_0118224
498 Ga0496103_0209184
499 Ga0496103_0249123
500 Ga0496103_0466576
501 Ga0496103_0587279
502 Ga0496103_1007548
503 Ga0496104_0008358
504 Ga0496104_0032087
505 Ga0496104_0047307
506 Ga0496104_0073574
507 Ga0496104_0103437
508 Ga0496105_0002508
509 Ga0496105_0105026
510 Ga0496105_0117106
511 Ga0496105_0173292
512 Ga0496106_0004726
513 Ga0496106_0019454
514 Ga0496107_0011353
515 Ga0496107_0042446
516 Ga0496107_0275380
517 Ga0496107_0302007
518 Ga0496107_1237440
519 Ga0496108_0002510
520 Ga0496108_0031747
521 Ga0496108_0049649
522 Ga0496108_0138945
523 Ga0496108_0675814
524 Ga0496109_0000167
525 Ga0496109_0014028
526 Ga0496109_0156257
527 Ga0496109_0186936
528 Ga0496109_0869257
529 Ga0496110_0000220
530 Ga0496110_0007186
531 Ga0496110_0025442
532 Ga0496110_0031438
533 Ga0496110_0083177
534 Ga0496110_0392765
535 Ga0496110_1565324
536 Ga0496111_0003323
537 Ga0496111_0014499
538 Ga0496111_0016393
539 Ga0496111_0049046
540 Ga0496111_0114904
541 Ga0496111_0206838
542 Ga0496112_0009181
543 Ga0496112_0056378
544 Ga0496112_0322421
545 Ga0496112_0325650
546 Ga0496113_0032868
547 Ga0496113_0060427
548 Ga0496113_0212211
549 Ga0496113_0233897
550 Ga0496113_0953053
551 Ga0496114_0022624
552 Ga0496114_0049210
553 Ga0496114_0064675
554 Ga0496114_0126627
555 Ga0496114_0979272
556 Ga0496115_0102672
557 Ga0496115_0288333
558 Ga0496116_0000790
559 Ga0496117_0000487
560 Ga0496118_0000063
561 Ga0496119_0000053
562 Ga0496120_0003030
563 Ga0496121_0011965
564 Ga0496121_0014147
565 Ga0496124_0312052
566 Ga0496125_0025693
567 Ga0496125_0028552
568 Ga0496126_0001286
569 Ga0501031_0013419
570 Ga0466962_0167190
571 2559423834
572 2586060926
573 2616902434
574 2729906744
575 2795783517
576 2808877997
577 2808895500
578 2809590051
579 2827633926
580 2880490565
581 2915770445
582 2917743197
583 2919053847
584 8004027314
585 8025416065
586 8056062360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

13

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9504 11 85
2wv0-assembly3.cif.gz_E crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9493 13 86
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9445 12 86
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.943 11 84
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9195 11 84
ID Description Score Start End Superfamily
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9622 11 86 1.10.10.10
2wv0E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9462 19 86 1.10.10.10
4u0wA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9434 11 86 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 19 86 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 11 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G9CQD6-F1-model_v4 DNA-binding transcriptional regulator YhcF, GntR family 0.987 9 138 GO:0003677
GO:0003700
AF-A0A4R7PPS5-F1-model_v4 deleted 0.9838 9 133
AF-A0A544YVV0-F1-model_v4 GntR family transcriptional regulator 0.9797 11 85 GO:0003677
GO:0003700
GO:0045892
AF-A0A1M4DZX2-F1-model_v4 Transcriptional regulator, GntR family 0.9792 11 133 GO:0003677
GO:0003700
AF-A0A1H9R926-F1-model_v4 Transcriptional regulator, GntR family 0.9777 11 133 GO:0003677
GO:0003700

Map