F391500

General Info

Members Datasets Scaffolds Average Seq Length
293 178 286 240

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10134868|Ga0157369_101348682
Length 283
Sequence MSDLTDKVVLVTGASRGIGYQAALEAARRGAHIIALARTVGGLEDLDDDIKTLGGSATLVPLDLRDGDGIDRLGASIFERWRRLDGLVANAAQLGVLSPVAHLEPREFEQTFALNVTANYRLIRSLDVLLRQSAAGRAVFLTSGAAHGVMPFWGLYASSKAALETLVRSYAEELTVSQAKANVFNPGHTRTQMHAKAFPGADPDDFQWPAAVAPALIDMIMPGYAENSIYYNFPTGETRPLYPALATSTLSMRRPSRSSTSKRHGSRVKLSPATGRWLSSAST

Samples

Sample ID Description Type Environment
1 2643221591 Devosia sp. Root685 Isolate Unclassified
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
5 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
178 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.34
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0
Rhizoplane 2.73
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10005555 3300003215 Bacteria 6592
2 Ga0070658_10001548 3300005327 Bacteria 19486
3 Ga0070658_10004382 3300005327 Bacteria 11516
4 Ga0070658_10360938 3300005327 Bacteria 1244
5 Ga0070683_100229420 3300005329 Bacteria 1765
6 Ga0070683_100319892 3300005329 Bacteria 1477
7 Ga0070683_100697103 3300005329 Bacteria 972
8 Ga0070670_100657192 3300005331 Bacteria 941
9 Ga0068869_100041594 3300005334 Bacteria 3292
10 Ga0068869_100516476 3300005334 Unclassified 999
11 Ga0070666_10029868 3300005335 Bacteria 3587
12 Ga0070682_100052520 3300005337 Bacteria 2551
13 Ga0068868_100096777 3300005338 Bacteria 2385
14 Ga0070660_100020624 3300005339 Bacteria 4848
15 Ga0070660_100634866 3300005339 Bacteria 894
16 Ga0070661_100002236 3300005344 Bacteria 13278
17 Ga0070661_100142450 3300005344 Bacteria 1807
18 Ga0070661_100322374 3300005344 Bacteria 1207
19 Ga0070661_100567776 3300005344 Bacteria 914
20 Ga0070671_100110353 3300005355 Bacteria 2310
21 Ga0070674_100214781 3300005356 Bacteria 1493
22 Ga0070673_100347330 3300005364 Unclassified 1316
23 Ga0070659_100184924 3300005366 Bacteria 1711
24 Ga0070667_100847790 3300005367 Bacteria 849
25 Ga0070701_10188889 3300005438 Bacteria 1211
26 Ga0070705_100320996 3300005440 Bacteria 1118
27 Ga0070700_100323861 3300005441 Bacteria 1133
28 Ga0070663_100452807 3300005455 Bacteria 1058
29 Ga0070678_100114586 3300005456 Bacteria 2115
30 Ga0070681_10189508 3300005458 Bacteria 1976
31 Ga0068867_100026101 3300005459 Bacteria 4193
32 Ga0070679_100028966 3300005530 Bacteria 5463
33 Ga0070679_100726272 3300005530 Bacteria 936
34 Ga0070684_100025766 3300005535 Bacteria 4946
35 Ga0070684_100108999 3300005535 Bacteria 2481
36 Ga0068853_100002747 3300005539 Bacteria 13282
37 Ga0068853_100013822 3300005539 Bacteria 6599
38 Ga0068853_100044864 3300005539 Bacteria 3785
39 Ga0068853_100257390 3300005539 Bacteria 1603
40 Ga0070672_100082966 3300005543 Bacteria 2572
41 Ga0070665_100008851 3300005548 Bacteria 10193
42 Ga0070665_100336403 3300005548 Bacteria 1514
43 Ga0070665_100438396 3300005548 Bacteria 1316
44 Ga0068855_100067252 3300005563 Bacteria 4175
45 Ga0068855_100315028 3300005563 Bacteria 1730
46 Ga0068855_100448879 3300005563 Bacteria 1407
47 Ga0068855_100868873 3300005563 Bacteria 954
48 Ga0068857_100491212 3300005577 Bacteria 1151
49 Ga0068854_100049869 3300005578 Bacteria 2993
50 Ga0068856_100390292 3300005614 Bacteria 1412
51 Ga0068856_100490743 3300005614 Bacteria 1249
52 Ga0068856_100724509 3300005614 Bacteria 1015
53 Ga0068852_100007260 3300005616 Bacteria 8079
54 Ga0068852_100018105 3300005616 Bacteria 5543
55 Ga0068852_100025094 3300005616 Bacteria 4825
56 Ga0068852_100873163 3300005616 Bacteria 916
57 Ga0068864_100062045 3300005618 Bacteria 3238
58 Ga0068864_100068977 3300005618 Bacteria 3073
59 Ga0068866_10038688 3300005718 Bacteria 2351
60 Ga0068861_100154486 3300005719 Bacteria 1886
61 Ga0068851_10000619 3300005834 Bacteria 15212
62 Ga0068860_100228873 3300005843 Bacteria 1806
63 Ga0068860_100359841 3300005843 Bacteria 1433
64 Ga0068862_100236027 3300005844 Bacteria 1661
65 Ga0075364_10107293 3300006051 Bacteria 1861
66 Ga0075362_10002066 3300006177 Bacteria 6624
67 Ga0097621_100000068 3300006237 Bacteria 53385
68 Ga0097621_100080715 3300006237 Bacteria 2706
69 Ga0097621_100278591 3300006237 Bacteria 1472
70 Ga0068871_100000446 3300006358 Bacteria 28382
71 Ga0068871_100036761 3300006358 Bacteria 3900
72 Ga0068871_100078419 3300006358 Bacteria 2731
73 Ga0068871_100183758 3300006358 Unclassified 1798
74 Ga0099795_10080654 3300007788 Bacteria 1244
75 Ga0105240_10219790 3300009093 Bacteria 2214
76 Ga0105240_10557657 3300009093 Bacteria 1267
77 Ga0111539_10044839 3300009094 Bacteria 5295
78 Ga0105245_10079176 3300009098 Bacteria 3000
79 Ga0105245_10259577 3300009098 Bacteria 1690
80 Ga0114129_10425947 3300009147 Bacteria 1745
81 Ga0105243_10007717 3300009148 Bacteria 8272
82 Ga0105241_10295178 3300009174 Bacteria 1389
83 Ga0105241_10327570 3300009174 Bacteria 1323
84 Ga0105241_10705938 3300009174 Bacteria 921
85 Ga0105242_10040314 3300009176 Bacteria 3763
86 Ga0105248_10149630 3300009177 Bacteria 2634
87 Ga0105237_10021955 3300009545 Bacteria 6554
88 Ga0105237_10044767 3300009545 Bacteria 4456
89 Ga0105237_10362886 3300009545 Bacteria 1453
90 Ga0105238_10033297 3300009551 Bacteria 5245
91 Ga0105238_10044688 3300009551 Bacteria 4478
92 Ga0105238_10579855 3300009551 Bacteria 1128
93 Ga0105239_10023078 3300010375 Bacteria 6860
94 Ga0105239_10342685 3300010375 Bacteria 1687
95 Ga0105239_10531233 3300010375 Bacteria 1339
96 Ga0105239_10564400 3300010375 Bacteria 1297
97 Ga0105246_10054541 3300011119 Bacteria 2755
98 Ga0105246_10322094 3300011119 Bacteria 1256
99 Ga0105246_10341693 3300011119 Bacteria 1224
100 Ga0157373_10069352 3300013100 Bacteria 2493
101 Ga0157370_10146795 3300013104 Bacteria 2196
102 Ga0157370_10175332 3300013104 Bacteria 1993
103 Ga0157369_10134868 3300013105 Bacteria 2614
104 Ga0157369_10336195 3300013105 Bacteria 1569
105 Ga0157369_10768760 3300013105 Bacteria 990
106 Ga0157374_10401157 3300013296 Bacteria 1368
107 Ga0157378_10003042 3300013297 Bacteria 14909
108 Ga0157378_10116441 3300013297 Bacteria 2457
109 Ga0157378_10158634 3300013297 Bacteria 2114
110 Ga0157378_10468698 3300013297 Bacteria 1253
111 Ga0157378_10975962 3300013297 Bacteria 881
112 Ga0163162_10277656 3300013306 Bacteria 1807
113 Ga0157372_10031225 3300013307 Bacteria 5832
114 Ga0157372_10129511 3300013307 Bacteria 2902
115 Ga0157375_10061235 3300013308 Bacteria 3736
116 Ga0157375_10437813 3300013308 Bacteria 1473
117 Ga0157375_10725227 3300013308 Bacteria 1146
118 Ga0163163_10000996 3300014325 Bacteria 23978
119 Ga0163163_10034697 3300014325 Bacteria 4888
120 Ga0163163_10316615 3300014325 Bacteria 1614
121 Ga0157377_10082320 3300014745 Bacteria 1884
122 Ga0157379_10027986 3300014968 Bacteria 5017
123 Ga0157379_10545292 3300014968 Bacteria 1078
124 Ga0206353_10426122 3300020082 Bacteria 1297
125 Ga0209233_1001358 3300025261 Bacteria 9758
126 Ga0209758_1000036 3300025297 Bacteria 441671
127 Ga0207656_10000640 3300025321 Bacteria 11434
128 Ga0207688_10072637 3300025901 Bacteria 1955
129 Ga0207680_10024647 3300025903 Bacteria 3305
130 Ga0207705_10003586 3300025909 Bacteria 11827
131 Ga0207705_10051641 3300025909 Bacteria 2959
132 Ga0207654_10193797 3300025911 Bacteria 1334
133 Ga0207654_10318237 3300025911 Bacteria 1063
134 Ga0207695_10201494 3300025913 Bacteria 1904
135 Ga0207695_10450154 3300025913 Bacteria 1171
136 Ga0207671_10013060 3300025914 Bacteria 6639
137 Ga0207671_10180360 3300025914 Bacteria 1643
138 Ga0207662_10162638 3300025918 Bacteria 1427
139 Ga0207657_10111344 3300025919 Bacteria 2260
140 Ga0207657_10141722 3300025919 Bacteria 1963
141 Ga0207649_10001587 3300025920 Bacteria 13215
142 Ga0207649_10013877 3300025920 Bacteria 4506
143 Ga0207649_10129719 3300025920 Bacteria 1711
144 Ga0207652_10007765 3300025921 Bacteria 8618
145 Ga0207694_10028667 3300025924 Bacteria 4245
146 Ga0207694_10235859 3300025924 Bacteria 1494
147 Ga0207650_10675653 3300025925 Bacteria 871
148 Ga0207687_10204555 3300025927 Bacteria 1545
149 Ga0207687_10321348 3300025927 Bacteria 1253
150 Ga0207687_10438791 3300025927 Bacteria 1081
151 Ga0207700_10722900 3300025928 Bacteria 889
152 Ga0207686_10081881 3300025934 Bacteria 2108
153 Ga0207686_10140486 3300025934 Bacteria 1668
154 Ga0207670_10099037 3300025936 Bacteria 2079
155 Ga0207669_10131855 3300025937 Bacteria 1719
156 Ga0207669_10420982 3300025937 Bacteria 1051
157 Ga0207689_10011149 3300025942 Bacteria 7714
158 Ga0207661_10161400 3300025944 Bacteria 1945
159 Ga0207661_10234867 3300025944 Bacteria 1625
160 Ga0207667_10030507 3300025949 Bacteria 5832
161 Ga0207667_10280162 3300025949 Bacteria 1704
162 Ga0207651_10232931 3300025960 Bacteria 1496
163 Ga0207640_10006439 3300025981 Bacteria 6444
164 Ga0207640_10611955 3300025981 Bacteria 924
165 Ga0207658_10084981 3300025986 Bacteria 2436
166 Ga0207658_10234629 3300025986 Bacteria 1550
167 Ga0207639_10002221 3300026041 Bacteria 13071
168 Ga0207639_10015532 3300026041 Bacteria 5374
169 Ga0207639_10105993 3300026041 Bacteria 2281
170 Ga0207708_10199844 3300026075 Bacteria 1595
171 Ga0207702_10167922 3300026078 Bacteria 2009
172 Ga0207702_10168311 3300026078 Bacteria 2007
173 Ga0207702_11038811 3300026078 Bacteria 813
174 Ga0207648_10012692 3300026089 Bacteria 7875
175 Ga0207674_10266390 3300026116 Bacteria 1661
176 Ga0207683_10262490 3300026121 Bacteria 1577
177 Ga0207698_10154394 3300026142 Bacteria 1997
178 Ga0207428_10108911 3300027907 Bacteria 2133
179 Ga0268266_10000442 3300028379 Bacteria 61975
180 Ga0268266_10001133 3300028379 Bacteria 33200
181 Ga0268266_10277466 3300028379 Bacteria 1557
182 Ga0268264_10165485 3300028381 Bacteria 1996
183 Ga0265338_10021190 3300028800 Bacteria 6789
184 Ga0265338_10468987 3300028800 Bacteria 890
185 Ga0265330_10093485 3300031235 Bacteria 1290
186 Ga0265332_10048063 3300031238 Bacteria 1836
187 Ga0265325_10001298 3300031241 Bacteria 17692
188 Ga0265325_10055075 3300031241 Bacteria 2035
189 Ga0265325_10082835 3300031241 Bacteria 1592
190 Ga0265340_10021246 3300031247 Bacteria 3329
191 Ga0265339_10000187 3300031249 Bacteria 52396
192 Ga0265331_10000006 3300031250 Bacteria 418907
193 Ga0265331_10002117 3300031250 Bacteria 13683
194 Ga0265327_10000430 3300031251 Bacteria 76023
195 Ga0265316_10006747 3300031344 Bacteria 10941
196 Ga0265316_10417634 3300031344 Bacteria 965
197 Ga0265313_10002689 3300031595 Bacteria 15053
198 Ga0265313_10102548 3300031595 Bacteria 1268
199 Ga0265313_10111284 3300031595 Bacteria 1204
200 Ga0307508_10175645 3300031616 Bacteria 1745
201 Ga0265314_10021654 3300031711 Bacteria 4937
202 Ga0265314_10097695 3300031711 Bacteria 1896
203 Ga0265342_10030119 3300031712 Bacteria 3367
204 Ga0265342_10035379 3300031712 Bacteria 3058
205 Ga0316577_10062704 3300031733 Bacteria 2076
206 Ga0307510_10182476 3300033180 Bacteria 1659
207 Ga0373932_0015014 3300035112 Bacteria 1958
208 Ga0373931_0005844 3300035691 Bacteria 5725
209 Ga0373937_0401388 3300036401 Bacteria 1301
210 Ga0316582_0295106 3300036647 Bacteria 1113
211 Ga0395899_0034102 3300037312 Bacteria 3821
212 Ga0395900_0433704 3300037418 Bacteria 1273
213 Ga0395901_0486725 3300038443 Bacteria 1258
214 Ga0436363_0663968 3300039450 Bacteria 4857
215 Ga0466967_0049938 3300045976 Bacteria 3661
216 Ga0495638_0171771 3300046460 Bacteria 1243
217 Ga0495585_0192435 3300046492 Bacteria 1043
218 Ga0495640_0116633 3300046533 Bacteria 1739
219 Ga0495586_0044007 3300046535 Bacteria 2404
220 Ga0495611_0120338 3300046648 Bacteria 1224
221 Ga0495635_0318840 3300046663 Bacteria 1041
222 Ga0495658_0181495 3300046683 Bacteria 1306
223 Ga0495686_0023745 3300047472 Bacteria 4038
224 Ga0496104_0063562 3300048907 Bacteria 3501
225 Ga0496108_0005992 3300048911 Bacteria 9848
226 Ga0496109_0041675 3300048912 Bacteria 4158
227 Ga0496109_0648672 3300048912 Bacteria 993
228 Ga0496110_0001652 3300048913 Bacteria 16361
229 Ga0496111_0004073 3300048914 Bacteria 9182
230 Ga0496112_0289626 3300048915 Bacteria 1584
231 Ga0496113_0032095 3300048916 Bacteria 3815
232 Ga0496119_0000208 3300048922 Bacteria 83742
233 Ga0496121_0033431 3300048924 Bacteria 4653
234 Ga0496121_0183806 3300048924 Bacteria 1506
235 Ga0496122_0005441 3300048925 Bacteria 15166
236 Ga0496123_0001102 3300048926 Bacteria 40509
237 Ga0496124_0325649 3300048927 Bacteria 1098
238 Ga0501032_0212987 3300049569 Bacteria 1259
239 Ga0501033_0054964 3300049570 Bacteria 2944
240 Ga0501034_0018569 3300049571 Bacteria 7128
241 Ga0501034_0026906 3300049571 Bacteria 5852
242 Ga0501034_0170498 3300049571 Bacteria 2144
243 Ga0501034_0205169 3300049571 Bacteria 1928
244 Ga0501034_0223034 3300049571 Bacteria 1837
245 Ga0501034_0363510 3300049571 Bacteria 1374
246 Ga0501034_0425063 3300049571 Bacteria 1249
247 Ga0501036_0335809 3300049572 Bacteria 1262
248 Ga0501036_0668804 3300049572 Bacteria 859
249 Ga0501038_0103669 3300049574 Bacteria 2365
250 Ga0501043_0128642 3300049579 Bacteria 1985
251 Ga0501043_0161931 3300049579 Bacteria 1748
252 Ga0501047_0026827 3300049581 Bacteria 5545
253 Ga0501047_0047663 3300049581 Bacteria 4139
254 Ga0501047_0163894 3300049581 Bacteria 2094
255 Ga0501047_0215759 3300049581 Bacteria 1776
256 Ga0501047_0459003 3300049581 Bacteria 1103
257 Ga0501047_0644776 3300049581 Bacteria 879
258 Ga0501067_0123159 3300049583 Bacteria 1443
259 Ga0501068_0068262 3300049584 Bacteria 2167
260 Ga0501069_0070875 3300049585 Bacteria 1953
261 Ga0501070_0012455 3300049586 Bacteria 7173
262 Ga0501070_0021967 3300049586 Bacteria 5346
263 Ga0501070_0133154 3300049586 Bacteria 2053
264 Ga0501073_0038171 3300049589 Bacteria 3409
265 Ga0501073_0066237 3300049589 Bacteria 2518
266 Ga0501073_0173542 3300049589 Bacteria 1492
267 Ga0501073_0219376 3300049589 Bacteria 1314
268 Ga0501080_0015353 3300049742 Bacteria 7058
269 Ga0501080_0108792 3300049742 Bacteria 2569
270 Ga0501080_0227436 3300049742 Bacteria 1706
271 Ga0501080_0625196 3300049742 Bacteria 954
272 Ga0501035_0014427 3300049822 Bacteria 7292
273 Ga0501035_0076136 3300049822 Bacteria 2967
274 Ga0501044_0003617 3300049823 Bacteria 17394
275 Ga0501044_0010805 3300049823 Bacteria 9905
276 Ga0501044_0069993 3300049823 Bacteria 3571
277 Ga0501044_0235570 3300049823 Bacteria 1776
278 nmdc:mga00v17_112853_c1 3300050491 Bacteria 1725
279 nmdc:mga0k408_368692_c1 3300050493 Bacteria 856
280 nmdc:mga07m45_154981_c1 3300050496 Bacteria 1329
281 nmdc:mga08y16_31069_c1 3300050511 Bacteria 5618
282 Ga0500556_0001366 3300053104 Bacteria 10729
283 Ga0500568_0097498 3300053139 Bacteria 1105
284 Ga0500616_0015621 3300053153 Bacteria 4336
285 Ga0500645_074694 3300053730 Bacteria 971
286 Ga0530510_0064258 3300061734 Bacteria 2658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0648672 Ga0496109_0648672_232_876 200
2 3300049742 Ga0501080_0108792 Ga0501080_0108792_1918_2556 202
3 3300049571 Ga0501034_0363510 Ga0501034_0363510_150_893 223
4 3300049584 Ga0501068_0068262 Ga0501068_0068262_46_789 223
5 3300049585 Ga0501069_0070875 Ga0501069_0070875_1167_1910 223
6 3300049742 Ga0501080_0227436 Ga0501080_0227436_785_1528 223
7 3300028800 Ga0265338_10021190 Ga0265338_100211902 224
8 3300031241 Ga0265325_10001298 Ga0265325_1000129821 224
9 3300031249 Ga0265339_10000187 Ga0265339_1000018726 224
10 3300031344 Ga0265316_10006747 Ga0265316_1000674710 224
11 3300031595 Ga0265313_10002689 Ga0265313_1000268914 224
12 3300031711 Ga0265314_10021654 Ga0265314_100216542 224
13 3300031712 Ga0265342_10035379 Ga0265342_100353792 224
14 3300049589 Ga0501073_0219376 Ga0501073_0219376_481_1185 228
15 3300031241 Ga0265325_10082835 Ga0265325_100828352 230
16 3300009093 Ga0105240_10557657 Ga0105240_105576572 232
17 3300009148 Ga0105243_10007717 Ga0105243_100077176 232
18 3300009174 Ga0105241_10327570 Ga0105241_103275702 232
19 3300009176 Ga0105242_10040314 Ga0105242_100403142 232
20 3300009545 Ga0105237_10362886 Ga0105237_103628862 232
21 3300009551 Ga0105238_10033297 Ga0105238_100332974 232
22 3300010375 Ga0105239_10023078 Ga0105239_100230782 232
23 3300010375 Ga0105239_10564400 Ga0105239_105644001 232
24 3300011119 Ga0105246_10322094 Ga0105246_103220942 232
25 3300011119 Ga0105246_10341693 Ga0105246_103416932 232
26 3300013297 Ga0157378_10003042 Ga0157378_100030428 232
27 3300013308 Ga0157375_10061235 Ga0157375_100612352 232
28 3300014745 Ga0157377_10082320 Ga0157377_100823202 232
29 3300014968 Ga0157379_10027986 Ga0157379_100279863 232
30 3300048907 Ga0496104_0063562 Ga0496104_0063562_2676_3404 232
31 3300048911 Ga0496108_0005992 Ga0496108_0005992_2943_3671 232
32 3300048912 Ga0496109_0041675 Ga0496109_0041675_2652_3380 232
33 3300048913 Ga0496110_0001652 Ga0496110_0001652_10558_11286 232
34 3300048914 Ga0496111_0004073 Ga0496111_0004073_185_913 232
35 3300048916 Ga0496113_0032095 Ga0496113_0032095_1702_2430 232
36 iso_pu_bacteria 2837678835 2837681513 232
37 iso_pu_bacteria 8045864390 8045865912 232
38 iso_pu_bacteria 2643221591 2643964110 233
39 iso_pu_bacteria 2643221629 2644166660 233
40 iso_pu_bacteria 2643221662 2644347768 233
41 3300005530 Ga0070679_100726272 Ga0070679_1007262722 234
42 3300005327 Ga0070658_10004382 Ga0070658_100043828 235
43 3300005327 Ga0070658_10360938 Ga0070658_103609382 235
44 3300005329 Ga0070683_100697103 Ga0070683_1006971031 235
45 3300005331 Ga0070670_100657192 Ga0070670_1006571921 235
46 3300005334 Ga0068869_100516476 Ga0068869_1005164762 235
47 3300005335 Ga0070666_10029868 Ga0070666_100298684 235
48 3300005338 Ga0068868_100096777 Ga0068868_1000967772 235
49 3300005339 Ga0070660_100634866 Ga0070660_1006348661 235
50 3300005344 Ga0070661_100142450 Ga0070661_1001424502 235
51 3300005344 Ga0070661_100322374 Ga0070661_1003223742 235
52 3300005344 Ga0070661_100567776 Ga0070661_1005677762 235
53 3300005355 Ga0070671_100110353 Ga0070671_1001103532 235
54 3300005366 Ga0070659_100184924 Ga0070659_1001849242 235
55 3300005367 Ga0070667_100847790 Ga0070667_1008477901 235
56 3300005455 Ga0070663_100452807 Ga0070663_1004528071 235
57 3300005530 Ga0070679_100028966 Ga0070679_1000289662 235
58 3300005535 Ga0070684_100025766 Ga0070684_1000257664 235
59 3300005539 Ga0068853_100044864 Ga0068853_1000448644 235
60 3300005539 Ga0068853_100257390 Ga0068853_1002573902 235
61 3300005548 Ga0070665_100438396 Ga0070665_1004383962 235
62 3300005563 Ga0068855_100067252 Ga0068855_1000672524 235
63 3300005563 Ga0068855_100448879 Ga0068855_1004488792 235
64 3300005614 Ga0068856_100390292 Ga0068856_1003902922 235
65 3300005614 Ga0068856_100724509 Ga0068856_1007245091 235
66 3300005616 Ga0068852_100018105 Ga0068852_1000181052 235
67 3300005616 Ga0068852_100025094 Ga0068852_1000250944 235
68 3300005616 Ga0068852_100873163 Ga0068852_1008731632 235
69 3300005618 Ga0068864_100062045 Ga0068864_1000620454 235
70 3300005843 Ga0068860_100228873 Ga0068860_1002288732 235
71 3300006051 Ga0075364_10107293 Ga0075364_101072932 235
72 3300006177 Ga0075362_10002066 Ga0075362_100020667 235
73 3300009093 Ga0105240_10219790 Ga0105240_102197902 235
74 3300009098 Ga0105245_10079176 Ga0105245_100791762 235
75 3300009174 Ga0105241_10295178 Ga0105241_102951782 235
76 3300009551 Ga0105238_10044688 Ga0105238_100446884 235
77 3300009551 Ga0105238_10579855 Ga0105238_105798552 235
78 3300010375 Ga0105239_10342685 Ga0105239_103426852 235
79 3300010375 Ga0105239_10531233 Ga0105239_105312332 235
80 3300013100 Ga0157373_10069352 Ga0157373_100693522 235
81 3300013104 Ga0157370_10146795 Ga0157370_101467952 235
82 3300013105 Ga0157369_10134868 Ga0157369_101348682 235
83 3300013296 Ga0157374_10401157 Ga0157374_104011572 235
84 3300013297 Ga0157378_10116441 Ga0157378_101164412 235
85 3300013306 Ga0163162_10277656 Ga0163162_102776562 235
86 3300013307 Ga0157372_10031225 Ga0157372_100312254 235
87 3300013307 Ga0157372_10129511 Ga0157372_101295112 235
88 3300014325 Ga0163163_10034697 Ga0163163_100346973 235
89 3300014325 Ga0163163_10316615 Ga0163163_103166152 235
90 3300014968 Ga0157379_10545292 Ga0157379_105452921 235
91 3300020082 Ga0206353_10426122 Ga0206353_104261222 235
92 3300025261 Ga0209233_1001358 Ga0209233_10013589 235
93 3300025903 Ga0207680_10024647 Ga0207680_100246473 235
94 3300025909 Ga0207705_10051641 Ga0207705_100516412 235
95 3300025913 Ga0207695_10450154 Ga0207695_104501542 235
96 3300025914 Ga0207671_10180360 Ga0207671_101803602 235
97 3300025919 Ga0207657_10141722 Ga0207657_101417221 235
98 3300025920 Ga0207649_10013877 Ga0207649_100138772 235
99 3300025920 Ga0207649_10129719 Ga0207649_101297191 235
100 3300025924 Ga0207694_10235859 Ga0207694_102358591 235
101 3300025925 Ga0207650_10675653 Ga0207650_106756531 235
102 3300025949 Ga0207667_10030507 Ga0207667_100305074 235
103 3300025986 Ga0207658_10084981 Ga0207658_100849812 235
104 3300026041 Ga0207639_10105993 Ga0207639_101059932 235
105 3300026078 Ga0207702_10168311 Ga0207702_101683111 235
106 3300026078 Ga0207702_11038811 Ga0207702_110388111 235
107 3300028379 Ga0268266_10277466 Ga0268266_102774662 235
108 3300028381 Ga0268264_10165485 Ga0268264_101654851 235
109 3300031733 Ga0316577_10062704 Ga0316577_100627042 235
110 3300035112 Ga0373932_0015014 Ga0373932_0015014_774_1499 235
111 3300036647 Ga0316582_0295106 Ga0316582_0295106_224_964 235
112 3300037312 Ga0395899_0034102 Ga0395899_0034102_2914_3639 235
113 3300046460 Ga0495638_0171771 Ga0495638_0171771_284_1021 235
114 3300047472 Ga0495686_0023745 Ga0495686_0023745_3012_3737 235
115 3300048924 Ga0496121_0183806 Ga0496121_0183806_203_958 235
116 3300049571 Ga0501034_0018569 Ga0501034_0018569_5481_6206 235
117 3300049571 Ga0501034_0205169 Ga0501034_0205169_1034_1759 235
118 3300049571 Ga0501034_0223034 Ga0501034_0223034_843_1568 235
119 3300049571 Ga0501034_0425063 Ga0501034_0425063_250_975 235
120 3300049581 Ga0501047_0459003 Ga0501047_0459003_377_1084 235
121 3300050491 nmdc:mga00v17_112853_c1 nmdc:mga00v17_112853_c1_972_1697 235
122 3300050493 nmdc:mga0k408_368692_c1 nmdc:mga0k408_368692_c1_21_746 235
123 3300050496 nmdc:mga07m45_154981_c1 nmdc:mga07m45_154981_c1_440_1165 235
124 3300053730 Ga0500645_074694 Ga0500645_074694_170_907 235
125 3300003215 JGI25153J46596_10005555 JGI25153J46596_100055557 236
126 3300005327 Ga0070658_10001548 Ga0070658_1000154810 236
127 3300005329 Ga0070683_100229420 Ga0070683_1002294202 236
128 3300005329 Ga0070683_100319892 Ga0070683_1003198922 236
129 3300005334 Ga0068869_100041594 Ga0068869_1000415943 236
130 3300005337 Ga0070682_100052520 Ga0070682_1000525202 236
131 3300005339 Ga0070660_100020624 Ga0070660_1000206241 236
132 3300005344 Ga0070661_100002236 Ga0070661_10000223611 236
133 3300005356 Ga0070674_100214781 Ga0070674_1002147812 236
134 3300005364 Ga0070673_100347330 Ga0070673_1003473301 236
135 3300005438 Ga0070701_10188889 Ga0070701_101888892 236
136 3300005440 Ga0070705_100320996 Ga0070705_1003209962 236
137 3300005441 Ga0070700_100323861 Ga0070700_1003238611 236
138 3300005456 Ga0070678_100114586 Ga0070678_1001145862 236
139 3300005458 Ga0070681_10189508 Ga0070681_101895082 236
140 3300005459 Ga0068867_100026101 Ga0068867_1000261013 236
141 3300005535 Ga0070684_100108999 Ga0070684_1001089992 236
142 3300005539 Ga0068853_100002747 Ga0068853_1000027474 236
143 3300005539 Ga0068853_100013822 Ga0068853_1000138226 236
144 3300005543 Ga0070672_100082966 Ga0070672_1000829662 236
145 3300005548 Ga0070665_100008851 Ga0070665_1000088512 236
146 3300005548 Ga0070665_100336403 Ga0070665_1003364032 236
147 3300005563 Ga0068855_100315028 Ga0068855_1003150282 236
148 3300005563 Ga0068855_100868873 Ga0068855_1008688731 236
149 3300005577 Ga0068857_100491212 Ga0068857_1004912122 236
150 3300005578 Ga0068854_100049869 Ga0068854_1000498692 236
151 3300005614 Ga0068856_100490743 Ga0068856_1004907432 236
152 3300005616 Ga0068852_100007260 Ga0068852_1000072604 236
153 3300005618 Ga0068864_100068977 Ga0068864_1000689772 236
154 3300005718 Ga0068866_10038688 Ga0068866_100386882 236
155 3300005719 Ga0068861_100154486 Ga0068861_1001544862 236
156 3300005834 Ga0068851_10000619 Ga0068851_1000061913 236
157 3300005843 Ga0068860_100359841 Ga0068860_1003598412 236
158 3300005844 Ga0068862_100236027 Ga0068862_1002360272 236
159 3300006237 Ga0097621_100000068 Ga0097621_1000000687 236
160 3300006237 Ga0097621_100080715 Ga0097621_1000807152 236
161 3300006237 Ga0097621_100278591 Ga0097621_1002785912 236
162 3300006358 Ga0068871_100000446 Ga0068871_10000044626 236
163 3300006358 Ga0068871_100036761 Ga0068871_1000367611 236
164 3300006358 Ga0068871_100078419 Ga0068871_1000784194 236
165 3300006358 Ga0068871_100183758 Ga0068871_1001837583 236
166 3300007788 Ga0099795_10080654 Ga0099795_100806541 236
167 3300009094 Ga0111539_10044839 Ga0111539_100448394 236
168 3300009098 Ga0105245_10259577 Ga0105245_102595772 236
169 3300009147 Ga0114129_10425947 Ga0114129_104259472 236
170 3300009174 Ga0105241_10705938 Ga0105241_107059382 236
171 3300009177 Ga0105248_10149630 Ga0105248_101496302 236
172 3300009545 Ga0105237_10021955 Ga0105237_100219555 236
173 3300009545 Ga0105237_10044767 Ga0105237_100447672 236
174 3300011119 Ga0105246_10054541 Ga0105246_100545411 236
175 3300013104 Ga0157370_10175332 Ga0157370_101753322 236
176 3300013105 Ga0157369_10336195 Ga0157369_103361951 236
177 3300013105 Ga0157369_10768760 Ga0157369_107687602 236
178 3300013297 Ga0157378_10158634 Ga0157378_101586342 236
179 3300013297 Ga0157378_10468698 Ga0157378_104686982 236
180 3300013297 Ga0157378_10975962 Ga0157378_109759621 236
181 3300013308 Ga0157375_10437813 Ga0157375_104378132 236
182 3300013308 Ga0157375_10725227 Ga0157375_107252271 236
183 3300014325 Ga0163163_10000996 Ga0163163_100009962 236
184 3300025297 Ga0209758_1000036 Ga0209758_1000036149 236
185 3300025321 Ga0207656_10000640 Ga0207656_100006404 236
186 3300025901 Ga0207688_10072637 Ga0207688_100726372 236
187 3300025909 Ga0207705_10003586 Ga0207705_100035867 236
188 3300025911 Ga0207654_10193797 Ga0207654_101937972 236
189 3300025911 Ga0207654_10318237 Ga0207654_103182372 236
190 3300025913 Ga0207695_10201494 Ga0207695_102014942 236
191 3300025914 Ga0207671_10013060 Ga0207671_100130605 236
192 3300025918 Ga0207662_10162638 Ga0207662_101626381 236
193 3300025919 Ga0207657_10111344 Ga0207657_101113441 236
194 3300025920 Ga0207649_10001587 Ga0207649_100015874 236
195 3300025921 Ga0207652_10007765 Ga0207652_100077653 236
196 3300025924 Ga0207694_10028667 Ga0207694_100286672 236
197 3300025927 Ga0207687_10204555 Ga0207687_102045552 236
198 3300025927 Ga0207687_10321348 Ga0207687_103213482 236
199 3300025927 Ga0207687_10438791 Ga0207687_104387912 236
200 3300025928 Ga0207700_10722900 Ga0207700_107229001 236
201 3300025934 Ga0207686_10081881 Ga0207686_100818812 236
202 3300025934 Ga0207686_10140486 Ga0207686_101404862 236
203 3300025936 Ga0207670_10099037 Ga0207670_100990372 236
204 3300025937 Ga0207669_10131855 Ga0207669_101318552 236
205 3300025937 Ga0207669_10420982 Ga0207669_104209822 236
206 3300025942 Ga0207689_10011149 Ga0207689_100111495 236
207 3300025944 Ga0207661_10161400 Ga0207661_101614002 236
208 3300025944 Ga0207661_10234867 Ga0207661_102348672 236
209 3300025949 Ga0207667_10280162 Ga0207667_102801622 236
210 3300025960 Ga0207651_10232931 Ga0207651_102329312 236
211 3300025981 Ga0207640_10006439 Ga0207640_100064397 236
212 3300025981 Ga0207640_10611955 Ga0207640_106119552 236
213 3300025986 Ga0207658_10234629 Ga0207658_102346291 236
214 3300026041 Ga0207639_10002221 Ga0207639_1000222111 236
215 3300026041 Ga0207639_10015532 Ga0207639_100155325 236
216 3300026075 Ga0207708_10199844 Ga0207708_101998442 236
217 3300026078 Ga0207702_10167922 Ga0207702_101679222 236
218 3300026089 Ga0207648_10012692 Ga0207648_100126923 236
219 3300026116 Ga0207674_10266390 Ga0207674_102663902 236
220 3300026121 Ga0207683_10262490 Ga0207683_102624902 236
221 3300026142 Ga0207698_10154394 Ga0207698_101543942 236
222 3300027907 Ga0207428_10108911 Ga0207428_101089112 236
223 3300028379 Ga0268266_10000442 Ga0268266_1000044262 236
224 3300028379 Ga0268266_10001133 Ga0268266_1000113324 236
225 3300028800 Ga0265338_10468987 Ga0265338_104689871 236
226 3300031235 Ga0265330_10093485 Ga0265330_100934852 236
227 3300031238 Ga0265332_10048063 Ga0265332_100480632 236
228 3300031241 Ga0265325_10055075 Ga0265325_100550752 236
229 3300031247 Ga0265340_10021246 Ga0265340_100212463 236
230 3300031250 Ga0265331_10000006 Ga0265331_1000000618 236
231 3300031250 Ga0265331_10002117 Ga0265331_1000211712 236
232 3300031251 Ga0265327_10000430 Ga0265327_1000043044 236
233 3300031344 Ga0265316_10417634 Ga0265316_104176342 236
234 3300031595 Ga0265313_10102548 Ga0265313_101025481 236
235 3300031595 Ga0265313_10111284 Ga0265313_101112841 236
236 3300031616 Ga0307508_10175645 Ga0307508_101756451 236
237 3300031711 Ga0265314_10097695 Ga0265314_100976952 236
238 3300031712 Ga0265342_10030119 Ga0265342_100301192 236
239 3300033180 Ga0307510_10182476 Ga0307510_101824762 236
240 3300035691 Ga0373931_0005844 Ga0373931_0005844_2584_3303 236
241 3300036401 Ga0373937_0401388 Ga0373937_0401388_324_1034 236
242 3300037418 Ga0395900_0433704 Ga0395900_0433704_149_865 236
243 3300038443 Ga0395901_0486725 Ga0395901_0486725_84_818 236
244 3300039450 Ga0436363_0663968 Ga0436363_0663968_861_1583 236
245 3300045976 Ga0466967_0049938 Ga0466967_0049938_241_951 236
246 3300046492 Ga0495585_0192435 Ga0495585_0192435_219_929 236
247 3300046533 Ga0495640_0116633 Ga0495640_0116633_721_1434 236
248 3300046535 Ga0495586_0044007 Ga0495586_0044007_210_923 236
249 3300046648 Ga0495611_0120338 Ga0495611_0120338_125_874 236
250 3300046663 Ga0495635_0318840 Ga0495635_0318840_314_1024 236
251 3300046683 Ga0495658_0181495 Ga0495658_0181495_335_1048 236
252 3300048915 Ga0496112_0289626 Ga0496112_0289626_172_903 236
253 3300048922 Ga0496119_0000208 Ga0496119_0000208_15822_16568 236
254 3300048924 Ga0496121_0033431 Ga0496121_0033431_2309_3043 236
255 3300048925 Ga0496122_0005441 Ga0496122_0005441_9685_10431 236
256 3300048926 Ga0496123_0001102 Ga0496123_0001102_4583_5329 236
257 3300048927 Ga0496124_0325649 Ga0496124_0325649_301_1035 236
258 3300049569 Ga0501032_0212987 Ga0501032_0212987_80_814 236
259 3300049570 Ga0501033_0054964 Ga0501033_0054964_1917_2651 236
260 3300049571 Ga0501034_0026906 Ga0501034_0026906_3999_4739 236
261 3300049571 Ga0501034_0170498 Ga0501034_0170498_1165_1899 236
262 3300049572 Ga0501036_0335809 Ga0501036_0335809_476_1189 236
263 3300049572 Ga0501036_0668804 Ga0501036_0668804_43_753 236
264 3300049574 Ga0501038_0103669 Ga0501038_0103669_1609_2343 236
265 3300049579 Ga0501043_0128642 Ga0501043_0128642_403_1113 236
266 3300049579 Ga0501043_0161931 Ga0501043_0161931_533_1267 236
267 3300049581 Ga0501047_0026827 Ga0501047_0026827_2427_3137 236
268 3300049581 Ga0501047_0047663 Ga0501047_0047663_3309_4043 236
269 3300049581 Ga0501047_0163894 Ga0501047_0163894_396_1106 236
270 3300049581 Ga0501047_0215759 Ga0501047_0215759_656_1369 236
271 3300049581 Ga0501047_0644776 Ga0501047_0644776_32_757 236
272 3300049583 Ga0501067_0123159 Ga0501067_0123159_218_949 236
273 3300049586 Ga0501070_0012455 Ga0501070_0012455_3187_3990 236
274 3300049586 Ga0501070_0021967 Ga0501070_0021967_769_1488 236
275 3300049586 Ga0501070_0133154 Ga0501070_0133154_455_1192 236
276 3300049589 Ga0501073_0038171 Ga0501073_0038171_1233_1949 236
277 3300049589 Ga0501073_0066237 Ga0501073_0066237_1603_2343 236
278 3300049589 Ga0501073_0173542 Ga0501073_0173542_449_1189 236
279 3300049742 Ga0501080_0015353 Ga0501080_0015353_5319_6053 236
280 3300049742 Ga0501080_0625196 Ga0501080_0625196_182_901 236
281 3300049822 Ga0501035_0014427 Ga0501035_0014427_4976_5710 236
282 3300049822 Ga0501035_0076136 Ga0501035_0076136_891_1601 236
283 3300049823 Ga0501044_0003617 Ga0501044_0003617_12698_13432 236
284 3300049823 Ga0501044_0010805 Ga0501044_0010805_3752_4486 236
285 3300049823 Ga0501044_0069993 Ga0501044_0069993_2774_3484 236
286 3300049823 Ga0501044_0235570 Ga0501044_0235570_368_1078 236
287 3300050511 nmdc:mga08y16_31069_c1 nmdc:mga08y16_31069_c1_4120_4833 236
288 3300053104 Ga0500556_0001366 Ga0500556_0001366_7141_7887 236
289 3300053139 Ga0500568_0097498 Ga0500568_0097498_202_936 236
290 3300053153 Ga0500616_0015621 Ga0500616_0015621_743_1477 236
291 3300061734 Ga0530510_0064258 Ga0530510_0064258_1645_2385 236
292 iso_pu_bacteria 2919450847 2919452072 236
293 iso_pu_bacteria 8001845381 8001849843 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

202

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

214

0.92

PF08659

KR

KR domain

7

182

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i1j-assembly1.cif.gz_A structure of a putative short chain dehydrogenase from pseudomonas syringae 0.9654 1 235
3g1t-assembly1.cif.gz_A-2 crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 0.9594 1 236
3i1j-assembly1.cif.gz_A structure of a putative short chain dehydrogenase from pseudomonas syringae 0.9575 1 235
3gy0-assembly1.cif.gz_A-2 crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 complexed with nadp 0.9557 1 236
3g1t-assembly1.cif.gz_A-2 crystal structure of short chain dehydrogenase from salmonella enterica subsp. enterica serovar typhi str. ct18 0.9554 1 236
ID Description Score Start End Superfamily
4z0tA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 5 233 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 5 164 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 5 198 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 2 186 3.40.50.720
3f1kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 2 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5N7YF35-F1-model_v4 deleted 0.9959 5 96
AF-B6JGX6-F1-model_v4 Short-chain dehydrogenase/reductase family 0.9958 1 235 GO:0016491
AF-A8U1S4-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9951 1 236 GO:0016491
AF-A0A3N1MDE4-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9936 13 234 GO:0008667
GO:0016020
GO:0019290
AF-B6JGX6-F1-model_v4 Short-chain dehydrogenase/reductase family 0.9874 1 235 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.17 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map