F391494

General Info

Members Datasets Scaffolds Average Seq Length
293 176 270 150

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10010039|Ga0157370_1001003912
Length 174
Sequence VAAALRKAKSEAGRHSMTTPHGSTGSSRRRLPRSVLVLGMLWTLPNSLAGLLLGVLGLAFGARLRWQAGELAWVVRRWPWGAGGAMTLGNVILHTGERLDRPCLTYAHRAGRCVEPAVSLAAHERAHVYQYMVLGPLFLPLYLLCGGISARNRFERAADRYALHGRGWWPWSAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
5 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
6 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
7 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
8 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
9 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
10 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
11 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
12 2919513703 Luteimonas sp. 3794 Isolate Unclassified
13 2919675420 Luteimonas terrae 4099 Isolate Unclassified
14 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
15 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
16 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
17 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
18 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
19 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
20 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
21 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
22 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
23 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
57 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
58 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
109 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
175 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
176 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.15
Metatranscriptomes 0
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 0
Rhizoplane 11.26
Rhizosphere 50.85
Stem 0
Stem Tuber 0
Unclassified 30.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1421531 2162886007 Bacteria 5530
2 JGI24735J21928_10002507 3300002067 Bacteria 6364
3 rootH2_10156621 3300003320 Bacteria 2727
4 rootH1_10185769 3300003323 Bacteria 2981
5 Ga0055533_1000388 3300003756 Bacteria 17503
6 Ga0055535_1011111 3300003761 Bacteria 1442
7 Ga0055536_1000926 3300003781 Bacteria 18920
8 Ga0055531_10008422 3300003794 Bacteria 5440
9 Ga0065704_10070486 3300005289 Bacteria 22767
10 Ga0065704_10089651 3300005289 Bacteria 2843
11 Ga0070658_10906506 3300005327 Bacteria 766
12 Ga0068868_100094043 3300005338 Bacteria 2417
13 Ga0070689_100350055 3300005340 Bacteria 1239
14 Ga0070661_100027146 3300005344 Bacteria 4121
15 Ga0070692_10248549 3300005345 Bacteria 1064
16 Ga0070668_100176432 3300005347 Bacteria 1743
17 Ga0070675_100782274 3300005354 Bacteria 872
18 Ga0070671_100469580 3300005355 Bacteria 1080
19 Ga0070671_100639760 3300005355 Bacteria 920
20 Ga0070714_100000148 3300005435 Bacteria 55926
21 Ga0070662_100098281 3300005457 Bacteria 2210
22 Ga0068853_100149641 3300005539 Bacteria 2101
23 Ga0070665_100138304 3300005548 Bacteria 2439
24 Ga0068855_100998511 3300005563 Bacteria 879
25 Ga0068855_101038349 3300005563 Bacteria 859
26 Ga0068855_101448541 3300005563 Bacteria 706
27 Ga0068856_100613608 3300005614 Bacteria 1109
28 Ga0068856_100884002 3300005614 Bacteria 912
29 Ga0068863_100806074 3300005841 Bacteria 937
30 Ga0068858_101162628 3300005842 Bacteria 758
31 Ga0075364_10020389 3300006051 Bacteria 4168
32 Ga0075364_10233763 3300006051 Bacteria 1248
33 Ga0105244_10059022 3300009036 Bacteria 1934
34 Ga0105244_10060166 3300009036 Bacteria 1914
35 Ga0105240_10000254 3300009093 Bacteria 106067
36 Ga0105247_10863649 3300009101 Bacteria 696
37 Ga0105241_12003568 3300009174 Bacteria 570
38 Ga0105248_10346048 3300009177 Bacteria 1674
39 Ga0105237_11474614 3300009545 Bacteria 687
40 Ga0105239_10000020 3300010375 Bacteria 264435
41 Ga0157317_1017138 3300012475 Bacteria 616
42 Ga0157318_1001380 3300012482 Bacteria 1209
43 Ga0157327_1002289 3300012512 Bacteria 1306
44 Ga0157373_10135248 3300013100 Bacteria 1733
45 Ga0157371_10002677 3300013102 Bacteria 16855
46 Ga0157371_10004386 3300013102 Bacteria 12336
47 Ga0157371_10466560 3300013102 Bacteria 930
48 Ga0157370_10010039 3300013104 Bacteria 10016
49 Ga0157370_10149757 3300013104 Bacteria 2172
50 Ga0157370_10230995 3300013104 Bacteria 1712
51 Ga0157370_10711971 3300013104 Bacteria 916
52 Ga0157370_11008510 3300013104 Bacteria 753
53 Ga0157369_10107725 3300013105 Bacteria 2964
54 Ga0157369_10824463 3300013105 Bacteria 953
55 Ga0157369_11889490 3300013105 Bacteria 606
56 Ga0157378_10284058 3300013297 Bacteria 1596
57 Ga0157375_10883376 3300013308 Unclassified 1039
58 Ga0157375_11626284 3300013308 Bacteria 764
59 Ga0157380_10186292 3300014326 Bacteria 1828
60 Ga0182008_10001077 3300014497 Bacteria 18839
61 Ga0182006_1022347 3300015261 Bacteria 2630
62 Ga0182007_10000004 3300015262 Bacteria 485875
63 Ga0182007_10022320 3300015262 Bacteria 2237
64 Ga0182007_10027187 3300015262 Bacteria 1975
65 Ga0182005_1002477 3300015265 Bacteria 6571
66 Ga0183368_1003 3300015687 Bacteria 1276390
67 Ga0163161_10003402 3300017792 Bacteria 11167
68 Ga0163161_10042955 3300017792 Bacteria 3253
69 Ga0163161_10197462 3300017792 Bacteria 1549
70 Ga0209674_100012 3300025226 Bacteria 950162
71 Ga0209258_100930 3300025242 Bacteria 14465
72 Ga0209676_1000024 3300025292 Bacteria 578839
73 Ga0209676_1001642 3300025292 Bacteria 19640
74 Ga0209676_1064683 3300025292 Bacteria 894
75 Ga0209050_1013450 3300025298 Bacteria 3630
76 Ga0209050_1103393 3300025298 Bacteria 559
77 Ga0209257_1000647 3300025304 Bacteria 55358
78 Ga0209257_1039272 3300025304 Bacteria 1424
79 Ga0207655_1081739 3300025728 Bacteria 1163
80 Ga0207688_10370070 3300025901 Bacteria 885
81 Ga0207647_10015275 3300025904 Bacteria 5269
82 Ga0207647_10215503 3300025904 Bacteria 1108
83 Ga0207705_10606495 3300025909 Bacteria 851
84 Ga0207695_10001526 3300025913 Bacteria 38277
85 Ga0207657_10017620 3300025919 Bacteria 6842
86 Ga0207694_10596005 3300025924 Bacteria 929
87 Ga0207659_10447377 3300025926 Bacteria 1088
88 Ga0207644_10361885 3300025931 Bacteria 1180
89 Ga0207644_11121024 3300025931 Bacteria 661
90 Ga0207690_10004536 3300025932 Bacteria 8200
91 Ga0207690_10660533 3300025932 Bacteria 857
92 Ga0207706_10047632 3300025933 Bacteria 3792
93 Ga0207709_10131642 3300025935 Bacteria 1706
94 Ga0207704_10814000 3300025938 Bacteria 781
95 Ga0207668_10446447 3300025972 Bacteria 1103
96 Ga0207703_11162442 3300026035 Bacteria 742
97 Ga0207674_10248054 3300026116 Bacteria 1727
98 Ga0209974_10256356 3300027876 Bacteria 659
99 Ga0268266_10150166 3300028379 Bacteria 2099
100 Ga0316181_1274844 3300030744 Bacteria 2433
101 Ga0307413_10009102 3300031824 Bacteria 4733
102 Ga0307413_10377667 3300031824 Bacteria 1103
103 Ga0307413_10396126 3300031824 Bacteria 1080
104 Ga0307413_11494256 3300031824 Bacteria 597
105 Ga0307406_10484403 3300031901 Bacteria 1000
106 Ga0307412_10006859 3300031911 Bacteria 6462
107 Ga0307412_10281456 3300031911 Bacteria 1306
108 Ga0307416_100046796 3300032002 Bacteria 3418
109 Ga0307414_10000547 3300032004 Bacteria 19620
110 Ga0307414_10195490 3300032004 Bacteria 1640
111 Ga0307414_10910724 3300032004 Bacteria 806
112 Ga0307411_10813118 3300032005 Bacteria 824
113 Ga0395905_0543149 3300037471 Bacteria 1063
114 Ga0439439_0017549 3300041406 Bacteria 1761
115 Ga0439465_0000843 3300041413 Bacteria 9658
116 Ga0451789_0173018 3300041443 Bacteria 805
117 Ga0451791_1258231 3300041451 Bacteria 577
118 Ga0451791_1757079 3300041451 Bacteria 3401
119 Ga0451793_1770209 3300041452 Bacteria 903
120 Ga0451797_0513310 3300041453 Bacteria 1825
121 Ga0451795_1326518 3300041456 Bacteria 760
122 Ga0451802_0873171 3300041460 Bacteria 1313
123 Ga0451807_0658056 3300041486 Bacteria 632
124 Ga0451807_0873608 3300041486 Bacteria 3035
125 Ga0451837_0639722 3300041494 Bacteria 2998
126 Ga0451841_0565539 3300041498 Bacteria 989
127 Ga0451855_1775093 3300041511 Bacteria 549
128 Ga0451853_0709230 3300041512 Bacteria 1305
129 Ga0439431_0018591 3300041997 Bacteria 1646
130 Ga0439445_0062156 3300042004 Bacteria 1023
131 Ga0439449_0009280 3300042007 Bacteria 3729
132 Ga0439462_0031353 3300042015 Bacteria 1407
133 Ga0439462_0079694 3300042015 Bacteria 894
134 Ga0450911_001586 3300042115 Bacteria 5123
135 Ga0453684_0439503 3300044712 Bacteria 1454
136 Ga0466967_0242772 3300045976 Bacteria 1719
137 Ga0495638_0003195 3300046460 Bacteria 12954
138 Ga0495638_0032286 3300046460 Bacteria 3358
139 Ga0495638_0106981 3300046460 Bacteria 1666
140 Ga0495606_0011683 3300046507 Bacteria 7130
141 Ga0495610_0006329 3300046512 Bacteria 8191
142 Ga0495616_0082508 3300046513 Bacteria 1535
143 Ga0495616_0082880 3300046513 Bacteria 1531
144 Ga0495631_0006482 3300046518 Bacteria 6038
145 Ga0495663_0000490 3300046525 Bacteria 14358
146 Ga0495663_0004854 3300046525 Bacteria 3757
147 Ga0495663_0014547 3300046525 Bacteria 2206
148 Ga0495598_0013315 3300046537 Bacteria 2036
149 Ga0495609_0104091 3300046538 Bacteria 1228
150 Ga0495633_0036628 3300046558 Bacteria 2350
151 Ga0495633_0056937 3300046558 Bacteria 1837
152 Ga0495656_0063756 3300046615 Bacteria 1616
153 Ga0495671_0008942 3300046692 Bacteria 5624
154 Ga0495672_0136725 3300047320 Bacteria 1284
155 Ga0495681_0074769 3300047470 Bacteria 1527
156 Ga0496101_0355358 3300048904 Bacteria 1152
157 Ga0496101_0396586 3300048904 Bacteria 1086
158 Ga0496102_0854001 3300048905 Bacteria 832
159 Ga0496102_0915969 3300048905 Bacteria 798
160 Ga0496103_0238332 3300048906 Bacteria 1170
161 Ga0496104_0095397 3300048907 Bacteria 2846
162 Ga0496104_0119623 3300048907 Bacteria 2529
163 Ga0496104_0923746 3300048907 Bacteria 777
164 Ga0496105_0010092 3300048908 Bacteria 7415
165 Ga0496105_0043517 3300048908 Bacteria 3703
166 Ga0496105_0204319 3300048908 Bacteria 1612
167 Ga0496106_0719501 3300048909 Bacteria 795
168 Ga0496107_0024572 3300048910 Bacteria 4263
169 Ga0496107_0192135 3300048910 Bacteria 1517
170 Ga0496110_0152077 3300048913 Bacteria 2096
171 Ga0496110_0165013 3300048913 Bacteria 2008
172 Ga0496110_0610636 3300048913 Bacteria 989
173 Ga0496111_0216017 3300048914 Bacteria 1424
174 Ga0496112_0318641 3300048915 Bacteria 1499
175 Ga0496113_0157996 3300048916 Bacteria 1791
176 Ga0496113_0304498 3300048916 Bacteria 1276
177 Ga0496114_0003316 3300048917 Bacteria 12370
178 Ga0496114_0245103 3300048917 Bacteria 1576
179 Ga0496115_0000206 3300048918 Bacteria 54824
180 Ga0496116_0002042 3300048919 Bacteria 21635
181 Ga0496116_0011635 3300048919 Bacteria 7260
182 Ga0496116_0024083 3300048919 Bacteria 4511
183 Ga0496116_0120471 3300048919 Bacteria 1520
184 Ga0496117_0000227 3300048920 Bacteria 106119
185 Ga0496117_0002919 3300048920 Bacteria 20686
186 Ga0496117_0090262 3300048920 Bacteria 1975
187 Ga0496117_0097544 3300048920 Bacteria 1871
188 Ga0496117_0125549 3300048920 Bacteria 1567
189 Ga0496117_0136769 3300048920 Bacteria 1474
190 Ga0496117_0231757 3300048920 Bacteria 1020
191 Ga0496118_0001432 3300048921 Bacteria 35924
192 Ga0496118_0003293 3300048921 Bacteria 20529
193 Ga0496118_0022169 3300048921 Bacteria 5563
194 Ga0496118_0057283 3300048921 Bacteria 2922
195 Ga0496118_0067646 3300048921 Bacteria 2599
196 Ga0496118_0085295 3300048921 Bacteria 2200
197 Ga0496118_0125204 3300048921 Bacteria 1665
198 Ga0496118_0154349 3300048921 Bacteria 1431
199 Ga0496118_0290233 3300048921 Bacteria 904
200 Ga0496119_0000047 3300048922 Bacteria 188401
201 Ga0496119_0000058 3300048922 Bacteria 173131
202 Ga0496119_0067358 3300048922 Bacteria 2111
203 Ga0496119_0104861 3300048922 Bacteria 1580
204 Ga0496119_0160106 3300048922 Bacteria 1198
205 Ga0496120_0000184 3300048923 Bacteria 106643
206 Ga0496120_0000260 3300048923 Bacteria 88375
207 Ga0496120_0060812 3300048923 Bacteria 2111
208 Ga0496121_0000369 3300048924 Bacteria 92541
209 Ga0496121_0016135 3300048924 Bacteria 7739
210 Ga0496121_0025179 3300048924 Bacteria 5658
211 Ga0496121_0041724 3300048924 Bacteria 4005
212 Ga0496121_0064931 3300048924 Bacteria 2973
213 Ga0496121_0120702 3300048924 Bacteria 1980
214 Ga0496121_0214338 3300048924 Bacteria 1361
215 Ga0496122_0019087 3300048925 Bacteria 6286
216 Ga0496122_0135239 3300048925 Bacteria 1555
217 Ga0496122_0142868 3300048925 Bacteria 1493
218 Ga0496122_0164658 3300048925 Bacteria 1346
219 Ga0496122_0306719 3300048925 Bacteria 852
220 Ga0496122_0375799 3300048925 Bacteria 731
221 Ga0496123_0011315 3300048926 Bacteria 7750
222 Ga0496123_0019316 3300048926 Bacteria 5376
223 Ga0496123_0049120 3300048926 Bacteria 2832
224 Ga0496123_0074413 3300048926 Bacteria 2102
225 Ga0496123_0105659 3300048926 Bacteria 1624
226 Ga0496123_0296566 3300048926 Bacteria 774
227 Ga0496123_0305121 3300048926 Bacteria 758
228 Ga0496124_0003653 3300048927 Bacteria 18616
229 Ga0496124_0004085 3300048927 Bacteria 17267
230 Ga0496124_0007749 3300048927 Bacteria 11345
231 Ga0496124_0036285 3300048927 Bacteria 4302
232 Ga0496124_0040471 3300048927 Bacteria 4030
233 Ga0496124_0114938 3300048927 Bacteria 2160
234 Ga0496124_0120030 3300048927 Bacteria 2102
235 Ga0496124_0146055 3300048927 Bacteria 1861
236 Ga0496124_0569229 3300048927 Bacteria 744
237 Ga0496124_0654700 3300048927 Bacteria 673
238 Ga0496125_0001130 3300048928 Bacteria 40721
239 Ga0496125_0005256 3300048928 Bacteria 14501
240 Ga0496125_0016660 3300048928 Bacteria 7046
241 Ga0496125_0066835 3300048928 Bacteria 2837
242 Ga0496125_0154532 3300048928 Bacteria 1569
243 Ga0496125_0209944 3300048928 Bacteria 1265
244 Ga0496125_0412320 3300048928 Bacteria 786
245 Ga0496126_0003344 3300048929 Bacteria 20370
246 Ga0496126_0275112 3300048929 Bacteria 1396
247 Ga0496126_0375471 3300048929 Bacteria 1158
248 Ga0496126_0858929 3300048929 Bacteria 691
249 Ga0496126_1013172 3300048929 Bacteria 622
250 Ga0501033_0150534 3300049570 Bacteria 1679
251 Ga0501034_0001096 3300049571 Bacteria 38061
252 Ga0501034_0031172 3300049571 Bacteria 5418
253 Ga0501034_0276071 3300049571 Bacteria 1620
254 Ga0501036_0134530 3300049572 Bacteria 2086
255 Ga0501037_0025922 3300049573 Bacteria 4330
256 Ga0501038_0020989 3300049574 Bacteria 5868
257 Ga0501039_0068869 3300049575 Bacteria 2747
258 Ga0501043_0201348 3300049579 Bacteria 1545
259 Ga0501068_0024500 3300049584 Bacteria 3545
260 Ga0501070_0194945 3300049586 Bacteria 1664
261 Ga0501073_0030607 3300049589 Bacteria 3842
262 Ga0501080_0244139 3300049742 Bacteria 1638
263 Ga0501035_0170966 3300049822 Bacteria 1877
264 Ga0501044_0061329 3300049823 Bacteria 3847
265 nmdc:mga00v17_33707_c1 3300050491 Bacteria 3036
266 nmdc:mga00v17_697068_c1 3300050491 Bacteria 651
267 nmdc:mga00v17_74453_c1 3300050491 Bacteria 1793
268 nmdc:mga00v17_893811_c1 3300050491 Bacteria 563
269 Ga0500577_0071866 3300053142 Bacteria 1359
270 Ga0500565_001159 3300053734 Bacteria 1695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015261 Ga0182006_1022347 Ga0182006_10223473 129
2 3300015262 Ga0182007_10027187 Ga0182007_100271872 129
3 3300046460 Ga0495638_0106981 Ga0495638_0106981_36_488 134
4 3300005548 Ga0070665_100138304 Ga0070665_1001383043 136
5 3300013102 Ga0157371_10004386 Ga0157371_100043868 136
6 3300013102 Ga0157371_10466560 Ga0157371_104665602 136
7 3300013104 Ga0157370_10230995 Ga0157370_102309951 136
8 3300013104 Ga0157370_11008510 Ga0157370_110085101 136
9 3300028379 Ga0268266_10150166 Ga0268266_101501662 136
10 3300031911 Ga0307412_10006859 Ga0307412_1000685910 136
11 3300032004 Ga0307414_10195490 Ga0307414_101954901 136
12 3300042115 Ga0450911_001586 Ga0450911_001586_3207_3659 136
13 3300046525 Ga0495663_0004854 Ga0495663_0004854_257_709 136
14 3300048919 Ga0496116_0002042 Ga0496116_0002042_14576_15028 136
15 3300048920 Ga0496117_0136769 Ga0496117_0136769_446_898 136
16 3300048921 Ga0496118_0290233 Ga0496118_0290233_156_608 136
17 3300048922 Ga0496119_0160106 Ga0496119_0160106_128_580 136
18 3300048924 Ga0496121_0214338 Ga0496121_0214338_757_1209 136
19 3300048925 Ga0496122_0306719 Ga0496122_0306719_277_729 136
20 3300048927 Ga0496124_0654700 Ga0496124_0654700_111_563 136
21 3300048928 Ga0496125_0016660 Ga0496125_0016660_6457_6909 136
22 3300048929 Ga0496126_0375471 Ga0496126_0375471_574_1026 136
23 3300050491 nmdc:mga00v17_74453_c1 nmdc:mga00v17_74453_c1_929_1381 136
24 3300005347 Ga0070668_100176432 Ga0070668_1001764324 137
25 3300030744 Ga0316181_1274844 Ga0316181_12748443 140
26 3300041494 Ga0451837_0639722 Ga0451837_0639722_788_1234 140
27 iso_pu_bacteria 2643221579 2643908801 140
28 iso_pu_bacteria 2643221581 2643916230 141
29 3300005340 Ga0070689_100350055 Ga0070689_1003500551 142
30 3300025938 Ga0207704_10814000 Ga0207704_108140002 142
31 iso_pu_bacteria 2923516293 2923518011 142
32 3300005338 Ga0068868_100094043 Ga0068868_1000940433 143
33 3300013297 Ga0157378_10284058 Ga0157378_102840583 143
34 3300048928 Ga0496125_0412320 Ga0496125_0412320_191_625 143
35 3300003320 rootH2_10156621 rootH2_101566214 144
36 3300003323 rootH1_10185769 rootH1_101857694 144
37 3300003794 Ga0055531_10008422 Ga0055531_100084224 144
38 3300005289 Ga0065704_10089651 Ga0065704_100896511 144
39 3300005327 Ga0070658_10906506 Ga0070658_109065061 144
40 3300005344 Ga0070661_100027146 Ga0070661_1000271464 144
41 3300005345 Ga0070692_10248549 Ga0070692_102485491 144
42 3300005457 Ga0070662_100098281 Ga0070662_1000982812 144
43 3300005539 Ga0068853_100149641 Ga0068853_1001496412 144
44 3300005563 Ga0068855_100998511 Ga0068855_1009985112 144
45 3300005563 Ga0068855_101038349 Ga0068855_1010383492 144
46 3300005563 Ga0068855_101448541 Ga0068855_1014485411 144
47 3300005614 Ga0068856_100884002 Ga0068856_1008840022 144
48 3300009036 Ga0105244_10059022 Ga0105244_100590222 144
49 3300009545 Ga0105237_11474614 Ga0105237_114746142 144
50 3300013100 Ga0157373_10135248 Ga0157373_101352481 144
51 3300013104 Ga0157370_10711971 Ga0157370_107119712 144
52 3300013105 Ga0157369_10824463 Ga0157369_108244632 144
53 3300013105 Ga0157369_11889490 Ga0157369_118894901 144
54 3300017792 Ga0163161_10042955 Ga0163161_100429552 144
55 3300025292 Ga0209676_1001642 Ga0209676_100164223 144
56 3300025298 Ga0209050_1013450 Ga0209050_10134504 144
57 3300025298 Ga0209050_1103393 Ga0209050_11033931 144
58 3300025304 Ga0209257_1000647 Ga0209257_100064719 144
59 3300025304 Ga0209257_1039272 Ga0209257_10392724 144
60 3300025728 Ga0207655_1081739 Ga0207655_10817391 144
61 3300025901 Ga0207688_10370070 Ga0207688_103700702 144
62 3300025904 Ga0207647_10215503 Ga0207647_102155032 144
63 3300025909 Ga0207705_10606495 Ga0207705_106064952 144
64 3300025919 Ga0207657_10017620 Ga0207657_100176203 144
65 3300025924 Ga0207694_10596005 Ga0207694_105960052 144
66 3300025932 Ga0207690_10004536 Ga0207690_100045367 144
67 3300025932 Ga0207690_10660533 Ga0207690_106605332 144
68 3300025933 Ga0207706_10047632 Ga0207706_100476324 144
69 3300025935 Ga0207709_10131642 Ga0207709_101316421 144
70 3300026116 Ga0207674_10248054 Ga0207674_102480541 144
71 3300032004 Ga0307414_10000547 Ga0307414_100005478 144
72 3300041406 Ga0439439_0017549 Ga0439439_0017549_247_681 144
73 3300041413 Ga0439465_0000843 Ga0439465_0000843_7559_7993 144
74 3300041443 Ga0451789_0173018 Ga0451789_0173018_110_544 144
75 3300041451 Ga0451791_1258231 Ga0451791_1258231_38_472 144
76 3300041451 Ga0451791_1757079 Ga0451791_1757079_568_1002 144
77 3300041452 Ga0451793_1770209 Ga0451793_1770209_137_571 144
78 3300041453 Ga0451797_0513310 Ga0451797_0513310_324_758 144
79 3300041456 Ga0451795_1326518 Ga0451795_1326518_11_445 144
80 3300041460 Ga0451802_0873171 Ga0451802_0873171_294_728 144
81 3300041486 Ga0451807_0658056 Ga0451807_0658056_72_506 144
82 3300041486 Ga0451807_0873608 Ga0451807_0873608_1167_1601 144
83 3300041498 Ga0451841_0565539 Ga0451841_0565539_419_889 144
84 3300041511 Ga0451855_1775093 Ga0451855_1775093_56_490 144
85 3300041997 Ga0439431_0018591 Ga0439431_0018591_213_647 144
86 3300042004 Ga0439445_0062156 Ga0439445_0062156_526_960 144
87 3300042015 Ga0439462_0031353 Ga0439462_0031353_696_1130 144
88 3300045976 Ga0466967_0242772 Ga0466967_0242772_589_1056 144
89 3300046512 Ga0495610_0006329 Ga0495610_0006329_7213_7653 144
90 3300046518 Ga0495631_0006482 Ga0495631_0006482_543_983 144
91 3300046525 Ga0495663_0000490 Ga0495663_0000490_7180_7614 144
92 3300046692 Ga0495671_0008942 Ga0495671_0008942_2236_2670 144
93 3300048920 Ga0496117_0002919 Ga0496117_0002919_12166_12606 144
94 3300048920 Ga0496117_0125549 Ga0496117_0125549_1009_1449 144
95 3300048921 Ga0496118_0003293 Ga0496118_0003293_11995_12435 144
96 3300048921 Ga0496118_0067646 Ga0496118_0067646_1124_1564 144
97 3300048922 Ga0496119_0067358 Ga0496119_0067358_965_1417 144
98 3300048922 Ga0496119_0104861 Ga0496119_0104861_966_1418 144
99 3300048923 Ga0496120_0060812 Ga0496120_0060812_964_1416 144
100 3300048924 Ga0496121_0016135 Ga0496121_0016135_833_1285 144
101 3300048925 Ga0496122_0135239 Ga0496122_0135239_133_585 144
102 3300048925 Ga0496122_0375799 Ga0496122_0375799_139_573 144
103 3300048926 Ga0496123_0011315 Ga0496123_0011315_3240_3674 144
104 3300048926 Ga0496123_0105659 Ga0496123_0105659_1044_1496 144
105 3300048927 Ga0496124_0004085 Ga0496124_0004085_4583_5023 144
106 3300048927 Ga0496124_0120030 Ga0496124_0120030_720_1160 144
107 3300048927 Ga0496124_0146055 Ga0496124_0146055_877_1311 144
108 3300048928 Ga0496125_0154532 Ga0496125_0154532_99_551 144
109 3300048929 Ga0496126_1013172 Ga0496126_1013172_68_508 144
110 3300049571 Ga0501034_0031172 Ga0501034_0031172_823_1263 144
111 3300053142 Ga0500577_0071866 Ga0500577_0071866_662_1096 144
112 iso_pu_bacteria 2747842428 2747949372 144
113 iso_pu_bacteria 2765235840 2765579507 144
114 iso_pu_bacteria 2816332141 2816517573 144
115 iso_pu_bacteria 2842757796 2842758165 144
116 iso_pu_bacteria 2874220319 2874222148 144
117 iso_pu_bacteria 2919089067 2919090959 144
118 iso_pu_bacteria 2919134579 2919135562 144
119 iso_pu_bacteria 2919513703 2919515921 144
120 iso_pu_bacteria 2919675420 2919677244 144
121 iso_pu_bacteria 2928496128 2928497512 144
122 iso_pu_bacteria 2931380184 2931380264 144
123 iso_pu_bacteria 2937610967 2937613160 144
124 iso_pu_bacteria 2939611941 2939614183 144
125 iso_pu_bacteria 2939626828 2939629160 144
126 iso_pu_bacteria 2961047084 2961048915 144
127 iso_pu_bacteria 2961064222 2961067823 144
128 3300003781 Ga0055536_1000926 Ga0055536_100092611 145
129 3300013308 Ga0157375_10883376 Ga0157375_108833762 145
130 3300025292 Ga0209676_1000024 Ga0209676_1000024223 145
131 3300027876 Ga0209974_10256356 Ga0209974_102563561 145
132 3300032002 Ga0307416_100046796 Ga0307416_1000467963 145
133 3300032005 Ga0307411_10813118 Ga0307411_108131181 145
134 3300048924 Ga0496121_0120702 Ga0496121_0120702_1067_1510 145
135 3300048926 Ga0496123_0296566 Ga0496123_0296566_258_701 145
136 3300048928 Ga0496125_0001130 Ga0496125_0001130_33683_34126 145
137 3300049570 Ga0501033_0150534 Ga0501033_0150534_984_1448 145
138 3300049571 Ga0501034_0276071 Ga0501034_0276071_564_1028 145
139 3300049572 Ga0501036_0134530 Ga0501036_0134530_537_1001 145
140 3300049573 Ga0501037_0025922 Ga0501037_0025922_2152_2616 145
141 3300049574 Ga0501038_0020989 Ga0501038_0020989_4053_4517 145
142 3300049575 Ga0501039_0068869 Ga0501039_0068869_1727_2191 145
143 3300049579 Ga0501043_0201348 Ga0501043_0201348_897_1361 145
144 3300049584 Ga0501068_0024500 Ga0501068_0024500_2790_3254 145
145 3300049586 Ga0501070_0194945 Ga0501070_0194945_552_1016 145
146 3300049589 Ga0501073_0030607 Ga0501073_0030607_1601_2065 145
147 3300049742 Ga0501080_0244139 Ga0501080_0244139_763_1227 145
148 3300049822 Ga0501035_0170966 Ga0501035_0170966_348_812 145
149 3300049823 Ga0501044_0061329 Ga0501044_0061329_2179_2643 145
150 iso_pu_bacteria 2939622612 2939624055 145
151 3300005614 Ga0068856_100613608 Ga0068856_1006136081 146
152 3300006051 Ga0075364_10020389 Ga0075364_100203893 146
153 3300009093 Ga0105240_10000254 Ga0105240_1000025484 146
154 3300009174 Ga0105241_12003568 Ga0105241_120035681 146
155 3300010375 Ga0105239_10000020 Ga0105239_100000201 146
156 3300025913 Ga0207695_10001526 Ga0207695_1000152631 146
157 3300048904 Ga0496101_0396586 Ga0496101_0396586_283_723 146
158 3300048905 Ga0496102_0854001 Ga0496102_0854001_53_493 146
159 3300048907 Ga0496104_0095397 Ga0496104_0095397_2232_2672 146
160 3300048908 Ga0496105_0043517 Ga0496105_0043517_213_653 146
161 3300048909 Ga0496106_0719501 Ga0496106_0719501_145_585 146
162 3300048910 Ga0496107_0024572 Ga0496107_0024572_1963_2403 146
163 3300048917 Ga0496114_0003316 Ga0496114_0003316_10649_11089 146
164 3300048920 Ga0496117_0097544 Ga0496117_0097544_714_1154 146
165 3300048921 Ga0496118_0022169 Ga0496118_0022169_4406_4846 146
166 3300048922 Ga0496119_0000058 Ga0496119_0000058_22995_23435 146
167 3300048923 Ga0496120_0000184 Ga0496120_0000184_83202_83642 146
168 3300048924 Ga0496121_0000369 Ga0496121_0000369_62049_62489 146
169 3300048924 Ga0496121_0025179 Ga0496121_0025179_484_924 146
170 3300049571 Ga0501034_0001096 Ga0501034_0001096_14008_14463 146
171 iso_pu_bacteria 2852649853 2852650455 146
172 iso_pu_bacteria 2941475908 2941476176 146
173 3300013104 Ga0157370_10149757 Ga0157370_101497574 147
174 3300014497 Ga0182008_10001077 Ga0182008_1000107710 147
175 3300017792 Ga0163161_10003402 Ga0163161_100034023 147
176 3300025292 Ga0209676_1064683 Ga0209676_10646832 147
177 3300031901 Ga0307406_10484403 Ga0307406_104844032 147
178 3300046460 Ga0495638_0003195 Ga0495638_0003195_11211_11660 147
179 3300046513 Ga0495616_0082880 Ga0495616_0082880_965_1414 147
180 3300046525 Ga0495663_0014547 Ga0495663_0014547_646_1095 147
181 3300046538 Ga0495609_0104091 Ga0495609_0104091_298_747 147
182 3300046558 Ga0495633_0056937 Ga0495633_0056937_622_1071 147
183 3300048913 Ga0496110_0152077 Ga0496110_0152077_477_926 147
184 3300048916 Ga0496113_0157996 Ga0496113_0157996_244_693 147
185 3300048920 Ga0496117_0000227 Ga0496117_0000227_97296_97745 147
186 3300048921 Ga0496118_0001432 Ga0496118_0001432_27118_27567 147
187 3300048921 Ga0496118_0125204 Ga0496118_0125204_1138_1587 147
188 3300048924 Ga0496121_0041724 Ga0496121_0041724_1070_1519 147
189 3300048925 Ga0496122_0142868 Ga0496122_0142868_219_668 147
190 3300048925 Ga0496122_0164658 Ga0496122_0164658_679_1128 147
191 3300048926 Ga0496123_0019316 Ga0496123_0019316_2177_2626 147
192 3300048926 Ga0496123_0074413 Ga0496123_0074413_679_1128 147
193 3300048927 Ga0496124_0114938 Ga0496124_0114938_1317_1766 147
194 3300048929 Ga0496126_0858929 Ga0496126_0858929_205_654 147
195 3300053734 Ga0500565_001159 Ga0500565_001159_810_1259 147
196 2162886007 SwRhRL2b_contig_1421531 SwRhRL2b_0291.00007210 148
197 3300002067 JGI24735J21928_10002507 JGI24735J21928_100025075 148
198 3300003756 Ga0055533_1000388 Ga0055533_100038815 148
199 3300003761 Ga0055535_1011111 Ga0055535_10111112 148
200 3300005289 Ga0065704_10070486 Ga0065704_1007048630 148
201 3300005354 Ga0070675_100782274 Ga0070675_1007822741 148
202 3300005355 Ga0070671_100469580 Ga0070671_1004695801 148
203 3300005355 Ga0070671_100639760 Ga0070671_1006397602 148
204 3300005435 Ga0070714_100000148 Ga0070714_10000014831 148
205 3300005841 Ga0068863_100806074 Ga0068863_1008060742 148
206 3300005842 Ga0068858_101162628 Ga0068858_1011626282 148
207 3300006051 Ga0075364_10233763 Ga0075364_102337631 148
208 3300009036 Ga0105244_10060166 Ga0105244_100601663 148
209 3300009101 Ga0105247_10863649 Ga0105247_108636492 148
210 3300009177 Ga0105248_10346048 Ga0105248_103460482 148
211 3300012475 Ga0157317_1017138 Ga0157317_10171381 148
212 3300012482 Ga0157318_1001380 Ga0157318_10013802 148
213 3300012512 Ga0157327_1002289 Ga0157327_10022892 148
214 3300013102 Ga0157371_10002677 Ga0157371_1000267710 148
215 3300013104 Ga0157370_10010039 Ga0157370_1001003912 148
216 3300013105 Ga0157369_10107725 Ga0157369_101077253 148
217 3300013308 Ga0157375_11626284 Ga0157375_116262841 148
218 3300014326 Ga0157380_10186292 Ga0157380_101862921 148
219 3300015262 Ga0182007_10000004 Ga0182007_1000000411 148
220 3300015262 Ga0182007_10022320 Ga0182007_100223202 148
221 3300015265 Ga0182005_1002477 Ga0182005_10024773 148
222 3300015687 Ga0183368_1003 Ga0183368_1003782 148
223 3300017792 Ga0163161_10197462 Ga0163161_101974623 148
224 3300025226 Ga0209674_100012 Ga0209674_100012533 148
225 3300025242 Ga0209258_100930 Ga0209258_1009309 148
226 3300025904 Ga0207647_10015275 Ga0207647_100152753 148
227 3300025926 Ga0207659_10447377 Ga0207659_104473772 148
228 3300025931 Ga0207644_10361885 Ga0207644_103618852 148
229 3300025931 Ga0207644_11121024 Ga0207644_111210241 148
230 3300025972 Ga0207668_10446447 Ga0207668_104464473 148
231 3300026035 Ga0207703_11162442 Ga0207703_111624422 148
232 3300031824 Ga0307413_10009102 Ga0307413_100091025 148
233 3300031824 Ga0307413_10377667 Ga0307413_103776672 148
234 3300031824 Ga0307413_10396126 Ga0307413_103961263 148
235 3300031824 Ga0307413_11494256 Ga0307413_114942562 148
236 3300031911 Ga0307412_10281456 Ga0307412_102814562 148
237 3300032004 Ga0307414_10910724 Ga0307414_109107242 148
238 3300037471 Ga0395905_0543149 Ga0395905_0543149_173_691 148
239 3300041512 Ga0451853_0709230 Ga0451853_0709230_38_496 148
240 3300042007 Ga0439449_0009280 Ga0439449_0009280_1052_1516 148
241 3300042015 Ga0439462_0079694 Ga0439462_0079694_350_814 148
242 3300044712 Ga0453684_0439503 Ga0453684_0439503_884_1393 148
243 3300046460 Ga0495638_0032286 Ga0495638_0032286_279_725 148
244 3300046507 Ga0495606_0011683 Ga0495606_0011683_763_1212 148
245 3300046513 Ga0495616_0082508 Ga0495616_0082508_211_660 148
246 3300046537 Ga0495598_0013315 Ga0495598_0013315_1062_1514 148
247 3300046558 Ga0495633_0036628 Ga0495633_0036628_1126_1584 148
248 3300046615 Ga0495656_0063756 Ga0495656_0063756_175_657 148
249 3300047320 Ga0495672_0136725 Ga0495672_0136725_653_1105 148
250 3300047470 Ga0495681_0074769 Ga0495681_0074769_22_471 148
251 3300048904 Ga0496101_0355358 Ga0496101_0355358_29_511 148
252 3300048905 Ga0496102_0915969 Ga0496102_0915969_91_537 148
253 3300048906 Ga0496103_0238332 Ga0496103_0238332_308_790 148
254 3300048907 Ga0496104_0119623 Ga0496104_0119623_1016_1468 148
255 3300048907 Ga0496104_0923746 Ga0496104_0923746_104_571 148
256 3300048908 Ga0496105_0010092 Ga0496105_0010092_5124_5582 148
257 3300048908 Ga0496105_0204319 Ga0496105_0204319_1021_1488 148
258 3300048910 Ga0496107_0192135 Ga0496107_0192135_270_752 148
259 3300048913 Ga0496110_0165013 Ga0496110_0165013_30_512 148
260 3300048913 Ga0496110_0610636 Ga0496110_0610636_496_948 148
261 3300048914 Ga0496111_0216017 Ga0496111_0216017_155_637 148
262 3300048915 Ga0496112_0318641 Ga0496112_0318641_723_1205 148
263 3300048916 Ga0496113_0304498 Ga0496113_0304498_61_543 148
264 3300048917 Ga0496114_0245103 Ga0496114_0245103_431_913 148
265 3300048918 Ga0496115_0000206 Ga0496115_0000206_49025_49492 148
266 3300048919 Ga0496116_0011635 Ga0496116_0011635_1046_1510 148
267 3300048919 Ga0496116_0024083 Ga0496116_0024083_95_565 148
268 3300048919 Ga0496116_0120471 Ga0496116_0120471_1020_1478 148
269 3300048920 Ga0496117_0090262 Ga0496117_0090262_1238_1708 148
270 3300048920 Ga0496117_0231757 Ga0496117_0231757_270_728 148
271 3300048921 Ga0496118_0057283 Ga0496118_0057283_1733_2191 148
272 3300048921 Ga0496118_0085295 Ga0496118_0085295_433_903 148
273 3300048921 Ga0496118_0154349 Ga0496118_0154349_784_1242 148
274 3300048922 Ga0496119_0000047 Ga0496119_0000047_7214_7666 148
275 3300048923 Ga0496120_0000260 Ga0496120_0000260_8122_8574 148
276 3300048924 Ga0496121_0064931 Ga0496121_0064931_1784_2242 148
277 3300048925 Ga0496122_0019087 Ga0496122_0019087_4074_4544 148
278 3300048926 Ga0496123_0049120 Ga0496123_0049120_1780_2250 148
279 3300048926 Ga0496123_0305121 Ga0496123_0305121_226_690 148
280 3300048927 Ga0496124_0003653 Ga0496124_0003653_12662_13114 148
281 3300048927 Ga0496124_0007749 Ga0496124_0007749_9663_10133 148
282 3300048927 Ga0496124_0036285 Ga0496124_0036285_3225_3689 148
283 3300048927 Ga0496124_0040471 Ga0496124_0040471_114_578 148
284 3300048927 Ga0496124_0569229 Ga0496124_0569229_100_582 148
285 3300048928 Ga0496125_0005256 Ga0496125_0005256_6466_6924 148
286 3300048928 Ga0496125_0066835 Ga0496125_0066835_2009_2479 148
287 3300048928 Ga0496125_0209944 Ga0496125_0209944_406_870 148
288 3300048929 Ga0496126_0003344 Ga0496126_0003344_11765_12217 148
289 3300048929 Ga0496126_0275112 Ga0496126_0275112_299_763 148
290 3300050491 nmdc:mga00v17_33707_c1 nmdc:mga00v17_33707_c1_557_1015 148
291 3300050491 nmdc:mga00v17_697068_c1 nmdc:mga00v17_697068_c1_156_614 148
292 3300050491 nmdc:mga00v17_893811_c1 nmdc:mga00v17_893811_c1_53_511 148
293 iso_pu_bacteria 8002869464 8002871773 148

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jw7-assembly1.cif.gz_A crystal structure of sopa-trim56 complex 0.2575 53 140
3s2x-assembly2.cif.gz_B structure of acetyl-coenzyme a synthase alpha subunit c-terminal domain 0.2042 36 142
5jw7-assembly1.cif.gz_A crystal structure of sopa-trim56 complex 0.1875 53 140
7xdd-assembly1.cif.gz_A cryo-em structure of eds1 and pad4 0.1832 11 148
3s2x-assembly2.cif.gz_B structure of acetyl-coenzyme a synthase alpha subunit c-terminal domain 0.1773 36 142
ID Description Score Start End Superfamily
af_Q9CAA6_1_302_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4838 36 68 2.130.10.10
af_Q9VYR2_398_592_3.60.20.40 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Gamma-glutamyltranspeptidase, small (S) subunit 0.3877 20 50 3.60.20.40
af_O17396_5_205_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2251 59 148 1.20.1070.10
af_Q8NCG7_269_526_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.1948 36 132 3.40.50.1820
af_Q8NCG7_269_526_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.1483 36 132 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4R0YWN3-F1-model_v4 Uncharacterized protein 0.991 11 144 GO:0016020
AF-A0A0Q8ENE8-F1-model_v4 DUF4157 domain-containing protein 0.9895 5 145 GO:0016020
AF-A0A4Q1CT03-F1-model_v4 Uncharacterized protein 0.9858 5 144 GO:0016020
AF-A0A149QIX3-F1-model_v4 Transmembrane protein 0.9856 4 144 GO:0016020
AF-A0A3S7KGC7-F1-model_v4 Uncharacterized protein 0.9852 4 144 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.4 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map