F391357

General Info

Members Datasets Scaffolds Average Seq Length
293 155 293 272

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100157187|Ga0070688_1001571873
Length 300
Sequence LLSCTSNAAATGNLAAALVCGARLSQIRSLANVPLQILGIIAGNGVYPRLLADAARNVGVKKIIAAAFTNETDPALKKHVDLIEWMRVGQLNRLLKFFNEHRVHHAIMAGQIAPKNLFDLRPDLKALLLLGKLKQRNAESIFAAIADELARIDVDLLPATTFLEDSLAAAGLIAGAKLSRREEEGVDLGWKIAKEIARLDIGQTVIVKNGTVVAVEAFEGTNDAIKRGGALARQGAIMVKVAKPNQDVRFDVPVIGVETISVAAHAKLRVIAVEAGKTLLLENDDVVDLANRAKISIVAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000003 3300003203 Bacteria 161718
2 rootH2_10068846 3300003320 Bacteria 1544
3 rootH2_10074728 3300003320 Bacteria 6484
4 JGI25405J52794_10000240 3300003911 Bacteria 7270
5 JGI25405J52794_10021727 3300003911 Unclassified 1298
6 Ga0065704_10012119 3300005289 Bacteria 1887
7 Ga0065704_10018117 3300005289 Bacteria 2265
8 Ga0065712_10130611 3300005290 Unclassified 1554
9 Ga0065712_10222916 3300005290 Bacteria 1035
10 Ga0065715_10092454 3300005293 Bacteria 5110
11 Ga0065715_10123697 3300005293 Bacteria 2171
12 Ga0065707_10127632 3300005295 Bacteria 1918
13 Ga0070676_10000452 3300005328 Bacteria 19584
14 Ga0070683_100019469 3300005329 Bacteria 6028
15 Ga0070690_100123811 3300005330 Bacteria 1738
16 Ga0068869_100031345 3300005334 Bacteria 3740
17 Ga0070666_10059663 3300005335 Bacteria 2581
18 Ga0068868_100062836 3300005338 Bacteria 2944
19 Ga0070689_100085608 3300005340 Bacteria 2479
20 Ga0070689_100211114 3300005340 Bacteria 1589
21 Ga0070689_100250460 3300005340 Bacteria 1461
22 Ga0070668_100001099 3300005347 Bacteria 19079
23 Ga0070668_100022917 3300005347 Bacteria 4721
24 Ga0070669_100000651 3300005353 Bacteria 25699
25 Ga0070675_100002406 3300005354 Bacteria 13964
26 Ga0070675_100003054 3300005354 Bacteria 12645
27 Ga0070675_100143083 3300005354 Bacteria 2045
28 Ga0070671_100052873 3300005355 Bacteria 3377
29 Ga0070673_100042865 3300005364 Bacteria 3492
30 Ga0070673_100052541 3300005364 Bacteria 3197
31 Ga0070688_100001171 3300005365 Bacteria 13052
32 Ga0070688_100025402 3300005365 Bacteria 3507
33 Ga0070688_100157187 3300005365 Bacteria 1559
34 Ga0070659_100273674 3300005366 Bacteria 1403
35 Ga0070659_100340383 3300005366 Bacteria 1257
36 Ga0070667_100000546 3300005367 Bacteria 37542
37 Ga0070667_100790683 3300005367 Unclassified 881
38 Ga0070709_10100797 3300005434 Bacteria 1923
39 Ga0070709_10147284 3300005434 Unclassified 1623
40 Ga0070711_100006941 3300005439 Bacteria 6865
41 Ga0070700_100037541 3300005441 Bacteria 2947
42 Ga0070708_100008719 3300005445 Bacteria 8148
43 Ga0070708_100015781 3300005445 Bacteria 6243
44 Ga0070708_100168855 3300005445 Unclassified 2041
45 Ga0070708_100361613 3300005445 Bacteria 1368
46 Ga0070708_100505990 3300005445 Unclassified 1139
47 Ga0070708_100637979 3300005445 Unclassified 1004
48 Ga0070662_100003137 3300005457 Bacteria 10267
49 Ga0070662_100105570 3300005457 Bacteria 2138
50 Ga0070662_100113988 3300005457 Bacteria 2063
51 Ga0070685_10044740 3300005466 Bacteria 2535
52 Ga0070685_10198150 3300005466 Bacteria 1304
53 Ga0070706_100000244 3300005467 Bacteria 66317
54 Ga0070706_100001850 3300005467 Bacteria 21899
55 Ga0070706_100008554 3300005467 Bacteria 9538
56 Ga0070706_100099310 3300005467 Bacteria 2705
57 Ga0070706_100245583 3300005467 Unclassified 1671
58 Ga0070706_100267803 3300005467 Bacteria 1594
59 Ga0070706_100324042 3300005467 Bacteria 1437
60 Ga0070706_100332664 3300005467 Bacteria 1416
61 Ga0070706_100363825 3300005467 Bacteria 1348
62 Ga0070706_100414110 3300005467 Bacteria 1255
63 Ga0070707_100002040 3300005468 Bacteria 19324
64 Ga0070707_100006608 3300005468 Bacteria 10758
65 Ga0070707_100010431 3300005468 Bacteria 8653
66 Ga0070707_100060910 3300005468 Unclassified 3620
67 Ga0070707_100065904 3300005468 Bacteria 3480
68 Ga0070707_100083187 3300005468 Bacteria 3092
69 Ga0070698_100016650 3300005471 Bacteria 7758
70 Ga0070698_100184803 3300005471 Bacteria 2022
71 Ga0070698_100296097 3300005471 Bacteria 1549
72 Ga0070698_100434223 3300005471 Unclassified 1248
73 Ga0070699_100059776 3300005518 Bacteria 3301
74 Ga0070679_100093486 3300005530 Bacteria 2994
75 Ga0070684_100054552 3300005535 Bacteria 3482
76 Ga0070697_100004444 3300005536 Bacteria 10772
77 Ga0070697_100004688 3300005536 Bacteria 10485
78 Ga0070697_100079330 3300005536 Bacteria 2703
79 Ga0070697_100092066 3300005536 Bacteria 2508
80 Ga0070697_100104196 3300005536 Bacteria 2359
81 Ga0070697_100104747 3300005536 Bacteria 2352
82 Ga0070697_100194845 3300005536 Unclassified 1721
83 Ga0070697_100241891 3300005536 Unclassified 1541
84 Ga0070697_100243084 3300005536 Bacteria 1537
85 Ga0070697_100284768 3300005536 Bacteria 1418
86 Ga0070697_100334182 3300005536 Unclassified 1306
87 Ga0070697_100370107 3300005536 Unclassified 1240
88 Ga0070695_100093330 3300005545 Unclassified 2014
89 Ga0070665_100027376 3300005548 Bacteria 5743
90 Ga0070665_100332684 3300005548 Bacteria 1523
91 Ga0070704_100071049 3300005549 Bacteria 2528
92 Ga0070664_100713814 3300005564 Unclassified 935
93 Ga0068861_100150409 3300005719 Bacteria 1910
94 Ga0068858_100037774 3300005842 Bacteria 4478
95 Ga0068862_100020819 3300005844 Bacteria 5480
96 Ga0081455_10000205 3300005937 Bacteria 75563
97 Ga0081455_10002389 3300005937 Bacteria 22414
98 Ga0081455_10004835 3300005937 Bacteria 14953
99 Ga0081455_10005310 3300005937 Bacteria 14147
100 Ga0081455_10071275 3300005937 Unclassified 2881
101 Ga0081540_1002718 3300005983 Bacteria 14392
102 Ga0081540_1004643 3300005983 Bacteria 10390
103 Ga0081540_1054178 3300005983 Bacteria 1962
104 Ga0081539_10000077 3300005985 Bacteria 228125
105 Ga0081539_10044251 3300005985 Bacteria 2572
106 Ga0070715_10029839 3300006163 Unclassified 2199
107 Ga0070715_10137279 3300006163 Unclassified 1183
108 Ga0070716_100091961 3300006173 Bacteria 1838
109 Ga0070716_100104271 3300006173 Bacteria 1745
110 Ga0070716_100285074 3300006173 Unclassified 1142
111 Ga0070712_100048483 3300006175 Bacteria 2944
112 Ga0070712_100096037 3300006175 Bacteria 2181
113 Ga0070712_100296275 3300006175 Unclassified 1308
114 Ga0070712_100430097 3300006175 Bacteria 1095
115 Ga0097621_100266563 3300006237 Bacteria 1504
116 Ga0075434_100327423 3300006871 Bacteria 1553
117 Ga0075436_100043540 3300006914 Bacteria 3095
118 Ga0105245_10008295 3300009098 Bacteria 9075
119 Ga0105245_10039438 3300009098 Bacteria 4204
120 Ga0105245_10252077 3300009098 Bacteria 1715
121 Ga0114129_10161750 3300009147 Bacteria 3057
122 Ga0114129_10202647 3300009147 Bacteria 2686
123 Ga0105249_10031673 3300009553 Bacteria 4783
124 Ga0157374_10084300 3300013296 Bacteria 3020
125 Ga0157374_10336409 3300013296 Bacteria 1498
126 Ga0157378_10049186 3300013297 Bacteria 3751
127 Ga0157378_10273300 3300013297 Bacteria 1626
128 Ga0163162_10029605 3300013306 Bacteria 5420
129 Ga0163162_10398160 3300013306 Unclassified 1509
130 Ga0157372_10209454 3300013307 Unclassified 2259
131 Ga0157372_10342434 3300013307 Bacteria 1742
132 Ga0157375_10003883 3300013308 Bacteria 12969
133 Ga0157375_10015600 3300013308 Bacteria 6805
134 Ga0157375_10146140 3300013308 Bacteria 2495
135 Ga0157375_10412203 3300013308 Unclassified 1517
136 Ga0163163_10033355 3300014325 Bacteria 4980
137 Ga0182008_10011519 3300014497 Bacteria 4699
138 Ga0157377_10089312 3300014745 Bacteria 1816
139 Ga0157379_10005733 3300014968 Bacteria 10683
140 Ga0157376_10046089 3300014969 Bacteria 3593
141 Ga0157376_10063549 3300014969 Bacteria 3110
142 Ga0157376_10071577 3300014969 Bacteria 2947
143 Ga0213872_10008421 3300021361 Bacteria 4992
144 Ga0207666_1001032 3300025271 Bacteria 3306
145 Ga0207673_1001253 3300025290 Bacteria 2738
146 Ga0207697_10000202 3300025315 Bacteria 31881
147 Ga0207697_10007327 3300025315 Bacteria 4929
148 Ga0207697_10011419 3300025315 Bacteria 3756
149 Ga0207697_10011797 3300025315 Bacteria 3686
150 Ga0207692_10106830 3300025898 Bacteria 1546
151 Ga0207692_10133576 3300025898 Unclassified 1404
152 Ga0207688_10197172 3300025901 Unclassified 1206
153 Ga0207685_10021851 3300025905 Unclassified 2152
154 Ga0207685_10202723 3300025905 Bacteria 933
155 Ga0207645_10000396 3300025907 Bacteria 35936
156 Ga0207684_10000282 3300025910 Bacteria 73951
157 Ga0207684_10003752 3300025910 Bacteria 14682
158 Ga0207684_10006446 3300025910 Bacteria 10695
159 Ga0207684_10015666 3300025910 Bacteria 6525
160 Ga0207684_10053321 3300025910 Bacteria 3433
161 Ga0207684_10081591 3300025910 Bacteria 2752
162 Ga0207684_10124101 3300025910 Bacteria 2215
163 Ga0207693_10071612 3300025915 Unclassified 2714
164 Ga0207693_10077788 3300025915 Bacteria 2597
165 Ga0207693_10132098 3300025915 Bacteria 1962
166 Ga0207693_10289195 3300025915 Unclassified 1284
167 Ga0207693_10308002 3300025915 Unclassified 1240
168 Ga0207663_10016310 3300025916 Bacteria 4116
169 Ga0207663_10038151 3300025916 Bacteria 2901
170 Ga0207663_10113712 3300025916 Bacteria 1841
171 Ga0207663_10123889 3300025916 Bacteria 1774
172 Ga0207662_10004191 3300025918 Bacteria 7555
173 Ga0207657_10115419 3300025919 Bacteria 2213
174 Ga0207652_10379679 3300025921 Bacteria 1275
175 Ga0207646_10000130 3300025922 Bacteria 101961
176 Ga0207646_10005216 3300025922 Bacteria 13735
177 Ga0207646_10055950 3300025922 Bacteria 3527
178 Ga0207646_10163193 3300025922 Unclassified 2011
179 Ga0207646_10387434 3300025922 Bacteria 1262
180 Ga0207646_10423650 3300025922 Unclassified 1201
181 Ga0207681_10024024 3300025923 Bacteria 3906
182 Ga0207687_10360860 3300025927 Bacteria 1186
183 Ga0207664_10110312 3300025929 Bacteria 2288
184 Ga0207664_10253545 3300025929 Unclassified 1536
185 Ga0207644_10432379 3300025931 Bacteria 1080
186 Ga0207706_10010484 3300025933 Bacteria 8468
187 Ga0207706_10155192 3300025933 Bacteria 2014
188 Ga0207670_10000992 3300025936 Bacteria 15012
189 Ga0207670_10015842 3300025936 Bacteria 4514
190 Ga0207670_10170861 3300025936 Bacteria 1630
191 Ga0207665_10105404 3300025939 Bacteria 1974
192 Ga0207665_10140333 3300025939 Bacteria 1722
193 Ga0207661_10014002 3300025944 Bacteria 5866
194 Ga0207651_10098666 3300025960 Bacteria 2161
195 Ga0207712_10042653 3300025961 Bacteria 3126
196 Ga0207668_10001471 3300025972 Bacteria 13808
197 Ga0207677_10114498 3300026023 Bacteria 2015
198 Ga0207703_10017185 3300026035 Bacteria 5645
199 Ga0207702_10209083 3300026078 Bacteria 1813
200 Ga0207675_100108387 3300026118 Unclassified 2619
201 Ga0207675_100215250 3300026118 Bacteria 1849
202 Ga0207683_10045083 3300026121 Bacteria 3855
203 Ga0207683_10139522 3300026121 Bacteria 2184
204 Ga0268266_10032687 3300028379 Bacteria 4420
205 Ga0268266_10503082 3300028379 Bacteria 1157
206 Ga0268265_10085211 3300028380 Bacteria 2507
207 Ga0265323_10017239 3300028653 Bacteria 2807
208 Ga0265316_10235888 3300031344 Unclassified 1346
209 Ga0307513_10029074 3300031456 Bacteria 6308
210 Ga0373934_0050504 3300035086 Unclassified 1648
211 Ga0373944_0092588 3300035089 Unclassified 1012
212 Ga0373945_0046292 3300035116 Unclassified 1587
213 Ga0373943_0046827 3300035170 Bacteria 2112
214 Ga0373943_0118556 3300035170 Unclassified 1404
215 Ga0373946_0167319 3300035171 Unclassified 1036
216 Ga0373931_0114095 3300035691 Unclassified 1537
217 Ga0373935_0075013 3300035692 Bacteria 2188
218 Ga0373935_0087855 3300035692 Bacteria 2030
219 Ga0373935_0169252 3300035692 Unclassified 1494
220 Ga0373927_0032645 3300035695 Bacteria 3391
221 Ga0373933_0036140 3300035724 Bacteria 2890
222 Ga0373947_0054863 3300035725 Bacteria 2406
223 Ga0373947_0056536 3300035725 Bacteria 2372
224 Ga0373947_0125081 3300035725 Unclassified 1636
225 Ga0373947_0132164 3300035725 Unclassified 1594
226 Ga0373947_0285564 3300035725 Bacteria 1098
227 Ga0373937_0485541 3300036401 Unclassified 1173
228 Ga0373937_0487915 3300036401 Bacteria 1170
229 Ga0373925_0085354 3300037068 Bacteria 2407
230 Ga0373925_0109317 3300037068 Bacteria 2134
231 Ga0373925_0279994 3300037068 Bacteria 1343
232 Ga0395899_0061365 3300037312 Bacteria 2769
233 Ga0395900_0003244 3300037418 Bacteria 17611
234 Ga0395900_0111305 3300037418 Bacteria 2813
235 Ga0395900_0200776 3300037418 Bacteria 2018
236 Ga0395900_0250260 3300037418 Bacteria 1774
237 Ga0395898_0002180 3300037466 Bacteria 23936
238 Ga0395898_0669614 3300037466 Bacteria 980
239 Ga0395905_0011399 3300037471 Bacteria 8591
240 Ga0395905_0591193 3300037471 Viruses 1012
241 Ga0436364_1554999 3300037853 Bacteria 1204
242 Ga0436364_1562084 3300037853 Unclassified 1258
243 Ga0395901_0003824 3300038443 Bacteria 15174
244 Ga0395901_0262525 3300038443 Unclassified 1797
245 Ga0436361_0102443 3300039447 Unclassified 4091
246 Ga0436361_0106607 3300039447 Bacteria 2843
247 Ga0436362_0229777 3300039453 Bacteria 2761
248 Ga0495603_0072403 3300046455 Bacteria 2025
249 Ga0495629_0016883 3300046459 Bacteria 5239
250 Ga0495629_0256665 3300046459 Unclassified 1202
251 Ga0495651_0178275 3300046462 Bacteria 1506
252 Ga0495584_0090017 3300046491 Bacteria 1547
253 Ga0495608_0217206 3300046511 Unclassified 1201
254 Ga0495618_0050232 3300046514 Bacteria 2634
255 Ga0495630_0034751 3300046517 Bacteria 3765
256 Ga0495630_0265864 3300046517 Unclassified 1310
257 Ga0495652_0040978 3300046529 Bacteria 4000
258 Ga0495586_0208292 3300046535 Unclassified 1109
259 Ga0495645_0066352 3300046543 Bacteria 2608
260 Ga0495667_0045600 3300046559 Unclassified 2902
261 Ga0495634_0122254 3300046642 Unclassified 1666
262 Ga0495634_0207045 3300046642 Unclassified 1216
263 Ga0495661_0128759 3300046665 Unclassified 1390
264 Ga0495623_0023563 3300046679 Unclassified 3972
265 Ga0495646_0023230 3300046680 Unclassified 3904
266 Ga0495647_0116921 3300046681 Unclassified 1118
267 Ga0495669_0021793 3300046684 Bacteria 2783
268 Ga0495613_0383615 3300046689 Unclassified 961
269 Ga0495604_0054962 3300047317 Bacteria 3070
270 Ga0495675_0118097 3300047444 Unclassified 1652
271 Ga0495602_0018318 3300048088 Bacteria 6998
272 Ga0496100_0340289 3300048903 Unclassified 1131
273 Ga0496102_0685448 3300048905 Bacteria 948
274 Ga0496104_0118561 3300048907 Bacteria 2541
275 Ga0496105_0104139 3300048908 Bacteria 2343
276 Ga0496107_0220881 3300048910 Unclassified 1410
277 Ga0496108_0112682 3300048911 Bacteria 2327
278 Ga0496109_0043901 3300048912 Bacteria 4053
279 Ga0496109_0048549 3300048912 Bacteria 3862
280 Ga0496109_0081436 3300048912 Bacteria 2983
281 Ga0496112_0020949 3300048915 Bacteria 6208
282 Ga0496113_0175788 3300048916 Bacteria 1697
283 Ga0496113_0298062 3300048916 Bacteria 1291
284 Ga0496114_0026046 3300048917 Bacteria 4785
285 Ga0496114_0202817 3300048917 Bacteria 1737
286 Ga0496115_0021642 3300048918 Bacteria 4969
287 Ga0496115_0152998 3300048918 Bacteria 1905
288 Ga0496115_0335379 3300048918 Bacteria 1235
289 nmdc:mga0n895_1036960_c1 3300050512 Unclassified 800
290 nmdc:mga0n895_739880_c1 3300050512 Unclassified 977
291 nmdc:mga08x19_24734_c1 3300050514 Bacteria 3736
292 Ga0495619_0077549 3300053085 Unclassified 2232
293 Ga0495619_0496451 3300053085 Unclassified 839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10412203 Ga0157375_104122032 244
2 3300046689 Ga0495613_0383615 Ga0495613_0383615_158_913 251
3 3300050512 nmdc:mga0n895_1036960_c1 nmdc:mga0n895_1036960_c1_13_771 251
4 3300025910 Ga0207684_10053321 Ga0207684_100533213 252
5 3300003911 JGI25405J52794_10021727 JGI25405J52794_100217271 255
6 3300005937 Ga0081455_10000205 Ga0081455_1000020536 255
7 3300005937 Ga0081455_10004835 Ga0081455_1000483510 255
8 3300028379 Ga0268266_10503082 Ga0268266_105030821 255
9 3300005367 Ga0070667_100790683 Ga0070667_1007906831 263
10 3300005536 Ga0070697_100104747 Ga0070697_1001047472 263
11 3300005937 Ga0081455_10005310 Ga0081455_100053108 263
12 3300013306 Ga0163162_10398160 Ga0163162_103981602 263
13 3300025898 Ga0207692_10133576 Ga0207692_101335762 263
14 3300025901 Ga0207688_10197172 Ga0207688_101971721 263
15 3300035116 Ga0373945_0046292 Ga0373945_0046292_747_1538 263
16 3300035725 Ga0373947_0125081 Ga0373947_0125081_195_986 263
17 3300046665 Ga0495661_0128759 Ga0495661_0128759_88_879 263
18 3300046681 Ga0495647_0116921 Ga0495647_0116921_89_880 263
19 3300046684 Ga0495669_0021793 Ga0495669_0021793_1117_1908 263
20 3300048903 Ga0496100_0340289 Ga0496100_0340289_193_984 263
21 3300048917 Ga0496114_0202817 Ga0496114_0202817_536_1330 263
22 3300048918 Ga0496115_0021642 Ga0496115_0021642_430_1224 263
23 3300021361 Ga0213872_10008421 Ga0213872_100084213 264
24 3300039447 Ga0436361_0106607 Ga0436361_0106607_444_1244 264
25 3300039453 Ga0436362_0229777 Ga0436362_0229777_24_824 264
26 3300009098 Ga0105245_10252077 Ga0105245_102520773 265
27 3300013297 Ga0157378_10273300 Ga0157378_102733002 265
28 3300028653 Ga0265323_10017239 Ga0265323_100172393 265
29 3300031344 Ga0265316_10235888 Ga0265316_102358882 265
30 3300014969 Ga0157376_10063549 Ga0157376_100635493 266
31 3300003320 rootH2_10068846 rootH2_100688462 267
32 3300005289 Ga0065704_10018117 Ga0065704_100181171 268
33 3300005347 Ga0070668_100022917 Ga0070668_1000229172 268
34 3300005545 Ga0070695_100093330 Ga0070695_1000933302 268
35 3300025916 Ga0207663_10123889 Ga0207663_101238893 268
36 3300037418 Ga0395900_0111305 Ga0395900_0111305_12_821 268
37 3300003203 JGI25406J46586_10000003 JGI25406J46586_1000000342 269
38 3300003320 rootH2_10074728 rootH2_100747285 269
39 3300003911 JGI25405J52794_10000240 JGI25405J52794_100002403 269
40 3300005289 Ga0065704_10012119 Ga0065704_100121193 269
41 3300005290 Ga0065712_10130611 Ga0065712_101306111 269
42 3300005290 Ga0065712_10222916 Ga0065712_102229161 269
43 3300005293 Ga0065715_10092454 Ga0065715_100924544 269
44 3300005293 Ga0065715_10123697 Ga0065715_101236972 269
45 3300005295 Ga0065707_10127632 Ga0065707_101276322 269
46 3300005328 Ga0070676_10000452 Ga0070676_1000045217 269
47 3300005329 Ga0070683_100019469 Ga0070683_1000194695 269
48 3300005330 Ga0070690_100123811 Ga0070690_1001238111 269
49 3300005334 Ga0068869_100031345 Ga0068869_1000313454 269
50 3300005335 Ga0070666_10059663 Ga0070666_100596633 269
51 3300005338 Ga0068868_100062836 Ga0068868_1000628361 269
52 3300005340 Ga0070689_100085608 Ga0070689_1000856083 269
53 3300005340 Ga0070689_100211114 Ga0070689_1002111142 269
54 3300005340 Ga0070689_100250460 Ga0070689_1002504602 269
55 3300005347 Ga0070668_100001099 Ga0070668_1000010995 269
56 3300005353 Ga0070669_100000651 Ga0070669_10000065117 269
57 3300005354 Ga0070675_100002406 Ga0070675_1000024061 269
58 3300005354 Ga0070675_100003054 Ga0070675_10000305410 269
59 3300005354 Ga0070675_100143083 Ga0070675_1001430832 269
60 3300005355 Ga0070671_100052873 Ga0070671_1000528734 269
61 3300005364 Ga0070673_100042865 Ga0070673_1000428653 269
62 3300005364 Ga0070673_100052541 Ga0070673_1000525413 269
63 3300005365 Ga0070688_100001171 Ga0070688_1000011719 269
64 3300005365 Ga0070688_100025402 Ga0070688_1000254023 269
65 3300005365 Ga0070688_100157187 Ga0070688_1001571873 269
66 3300005366 Ga0070659_100273674 Ga0070659_1002736742 269
67 3300005366 Ga0070659_100340383 Ga0070659_1003403832 269
68 3300005367 Ga0070667_100000546 Ga0070667_10000054618 269
69 3300005434 Ga0070709_10100797 Ga0070709_101007972 269
70 3300005434 Ga0070709_10147284 Ga0070709_101472842 269
71 3300005439 Ga0070711_100006941 Ga0070711_1000069413 269
72 3300005441 Ga0070700_100037541 Ga0070700_1000375413 269
73 3300005445 Ga0070708_100008719 Ga0070708_1000087191 269
74 3300005445 Ga0070708_100015781 Ga0070708_1000157816 269
75 3300005445 Ga0070708_100168855 Ga0070708_1001688552 269
76 3300005445 Ga0070708_100361613 Ga0070708_1003616132 269
77 3300005445 Ga0070708_100505990 Ga0070708_1005059902 269
78 3300005445 Ga0070708_100637979 Ga0070708_1006379791 269
79 3300005457 Ga0070662_100003137 Ga0070662_10000313712 269
80 3300005457 Ga0070662_100105570 Ga0070662_1001055702 269
81 3300005457 Ga0070662_100113988 Ga0070662_1001139881 269
82 3300005466 Ga0070685_10044740 Ga0070685_100447401 269
83 3300005466 Ga0070685_10198150 Ga0070685_101981501 269
84 3300005467 Ga0070706_100000244 Ga0070706_10000024472 269
85 3300005467 Ga0070706_100001850 Ga0070706_10000185016 269
86 3300005467 Ga0070706_100008554 Ga0070706_10000855410 269
87 3300005467 Ga0070706_100099310 Ga0070706_1000993102 269
88 3300005467 Ga0070706_100245583 Ga0070706_1002455832 269
89 3300005467 Ga0070706_100267803 Ga0070706_1002678031 269
90 3300005467 Ga0070706_100324042 Ga0070706_1003240423 269
91 3300005467 Ga0070706_100332664 Ga0070706_1003326642 269
92 3300005467 Ga0070706_100363825 Ga0070706_1003638252 269
93 3300005467 Ga0070706_100414110 Ga0070706_1004141102 269
94 3300005468 Ga0070707_100002040 Ga0070707_10000204013 269
95 3300005468 Ga0070707_100006608 Ga0070707_1000066086 269
96 3300005468 Ga0070707_100010431 Ga0070707_10001043113 269
97 3300005468 Ga0070707_100060910 Ga0070707_1000609105 269
98 3300005468 Ga0070707_100065904 Ga0070707_1000659042 269
99 3300005468 Ga0070707_100083187 Ga0070707_1000831873 269
100 3300005471 Ga0070698_100016650 Ga0070698_1000166503 269
101 3300005471 Ga0070698_100184803 Ga0070698_1001848031 269
102 3300005471 Ga0070698_100296097 Ga0070698_1002960973 269
103 3300005471 Ga0070698_100434223 Ga0070698_1004342231 269
104 3300005518 Ga0070699_100059776 Ga0070699_1000597764 269
105 3300005530 Ga0070679_100093486 Ga0070679_1000934863 269
106 3300005535 Ga0070684_100054552 Ga0070684_1000545524 269
107 3300005536 Ga0070697_100004444 Ga0070697_1000044444 269
108 3300005536 Ga0070697_100004688 Ga0070697_10000468810 269
109 3300005536 Ga0070697_100079330 Ga0070697_1000793302 269
110 3300005536 Ga0070697_100092066 Ga0070697_1000920661 269
111 3300005536 Ga0070697_100104196 Ga0070697_1001041963 269
112 3300005536 Ga0070697_100194845 Ga0070697_1001948452 269
113 3300005536 Ga0070697_100241891 Ga0070697_1002418912 269
114 3300005536 Ga0070697_100243084 Ga0070697_1002430842 269
115 3300005536 Ga0070697_100284768 Ga0070697_1002847681 269
116 3300005536 Ga0070697_100334182 Ga0070697_1003341822 269
117 3300005536 Ga0070697_100370107 Ga0070697_1003701072 269
118 3300005548 Ga0070665_100027376 Ga0070665_1000273765 269
119 3300005548 Ga0070665_100332684 Ga0070665_1003326842 269
120 3300005549 Ga0070704_100071049 Ga0070704_1000710492 269
121 3300005564 Ga0070664_100713814 Ga0070664_1007138141 269
122 3300005719 Ga0068861_100150409 Ga0068861_1001504093 269
123 3300005842 Ga0068858_100037774 Ga0068858_1000377745 269
124 3300005844 Ga0068862_100020819 Ga0068862_1000208195 269
125 3300005937 Ga0081455_10002389 Ga0081455_1000238915 269
126 3300005937 Ga0081455_10071275 Ga0081455_100712752 269
127 3300005983 Ga0081540_1002718 Ga0081540_100271812 269
128 3300005983 Ga0081540_1004643 Ga0081540_10046432 269
129 3300005983 Ga0081540_1054178 Ga0081540_10541783 269
130 3300005985 Ga0081539_10000077 Ga0081539_10000077112 269
131 3300005985 Ga0081539_10044251 Ga0081539_100442512 269
132 3300006163 Ga0070715_10029839 Ga0070715_100298392 269
133 3300006163 Ga0070715_10137279 Ga0070715_101372792 269
134 3300006173 Ga0070716_100091961 Ga0070716_1000919612 269
135 3300006173 Ga0070716_100104271 Ga0070716_1001042713 269
136 3300006173 Ga0070716_100285074 Ga0070716_1002850742 269
137 3300006175 Ga0070712_100048483 Ga0070712_1000484833 269
138 3300006175 Ga0070712_100096037 Ga0070712_1000960372 269
139 3300006175 Ga0070712_100296275 Ga0070712_1002962752 269
140 3300006175 Ga0070712_100430097 Ga0070712_1004300972 269
141 3300006237 Ga0097621_100266563 Ga0097621_1002665632 269
142 3300006871 Ga0075434_100327423 Ga0075434_1003274231 269
143 3300006914 Ga0075436_100043540 Ga0075436_1000435403 269
144 3300009098 Ga0105245_10008295 Ga0105245_1000829510 269
145 3300009098 Ga0105245_10039438 Ga0105245_100394382 269
146 3300009147 Ga0114129_10161750 Ga0114129_101617503 269
147 3300009147 Ga0114129_10202647 Ga0114129_102026472 269
148 3300009553 Ga0105249_10031673 Ga0105249_100316735 269
149 3300013296 Ga0157374_10084300 Ga0157374_100843003 269
150 3300013296 Ga0157374_10336409 Ga0157374_103364092 269
151 3300013297 Ga0157378_10049186 Ga0157378_100491863 269
152 3300013306 Ga0163162_10029605 Ga0163162_100296055 269
153 3300013307 Ga0157372_10209454 Ga0157372_102094541 269
154 3300013307 Ga0157372_10342434 Ga0157372_103424343 269
155 3300013308 Ga0157375_10003883 Ga0157375_1000388314 269
156 3300013308 Ga0157375_10015600 Ga0157375_100156002 269
157 3300013308 Ga0157375_10146140 Ga0157375_101461403 269
158 3300014325 Ga0163163_10033355 Ga0163163_100333553 269
159 3300014497 Ga0182008_10011519 Ga0182008_100115195 269
160 3300014745 Ga0157377_10089312 Ga0157377_100893122 269
161 3300014968 Ga0157379_10005733 Ga0157379_100057337 269
162 3300014969 Ga0157376_10046089 Ga0157376_100460893 269
163 3300014969 Ga0157376_10071577 Ga0157376_100715773 269
164 3300025271 Ga0207666_1001032 Ga0207666_10010323 269
165 3300025290 Ga0207673_1001253 Ga0207673_10012533 269
166 3300025315 Ga0207697_10000202 Ga0207697_100002022 269
167 3300025315 Ga0207697_10007327 Ga0207697_100073273 269
168 3300025315 Ga0207697_10011419 Ga0207697_100114194 269
169 3300025315 Ga0207697_10011797 Ga0207697_100117973 269
170 3300025898 Ga0207692_10106830 Ga0207692_101068302 269
171 3300025905 Ga0207685_10021851 Ga0207685_100218513 269
172 3300025905 Ga0207685_10202723 Ga0207685_102027231 269
173 3300025907 Ga0207645_10000396 Ga0207645_1000039612 269
174 3300025910 Ga0207684_10000282 Ga0207684_1000028280 269
175 3300025910 Ga0207684_10003752 Ga0207684_100037528 269
176 3300025910 Ga0207684_10006446 Ga0207684_100064466 269
177 3300025910 Ga0207684_10015666 Ga0207684_100156667 269
178 3300025910 Ga0207684_10081591 Ga0207684_100815913 269
179 3300025910 Ga0207684_10124101 Ga0207684_101241012 269
180 3300025915 Ga0207693_10071612 Ga0207693_100716122 269
181 3300025915 Ga0207693_10077788 Ga0207693_100777883 269
182 3300025915 Ga0207693_10132098 Ga0207693_101320982 269
183 3300025915 Ga0207693_10289195 Ga0207693_102891951 269
184 3300025915 Ga0207693_10308002 Ga0207693_103080022 269
185 3300025916 Ga0207663_10016310 Ga0207663_100163104 269
186 3300025916 Ga0207663_10038151 Ga0207663_100381512 269
187 3300025916 Ga0207663_10113712 Ga0207663_101137122 269
188 3300025918 Ga0207662_10004191 Ga0207662_100041913 269
189 3300025919 Ga0207657_10115419 Ga0207657_101154191 269
190 3300025921 Ga0207652_10379679 Ga0207652_103796791 269
191 3300025922 Ga0207646_10000130 Ga0207646_1000013065 269
192 3300025922 Ga0207646_10005216 Ga0207646_100052166 269
193 3300025922 Ga0207646_10055950 Ga0207646_100559502 269
194 3300025922 Ga0207646_10163193 Ga0207646_101631933 269
195 3300025922 Ga0207646_10387434 Ga0207646_103874342 269
196 3300025922 Ga0207646_10423650 Ga0207646_104236501 269
197 3300025923 Ga0207681_10024024 Ga0207681_100240242 269
198 3300025927 Ga0207687_10360860 Ga0207687_103608602 269
199 3300025929 Ga0207664_10110312 Ga0207664_101103122 269
200 3300025929 Ga0207664_10253545 Ga0207664_102535451 269
201 3300025931 Ga0207644_10432379 Ga0207644_104323791 269
202 3300025933 Ga0207706_10010484 Ga0207706_100104845 269
203 3300025933 Ga0207706_10155192 Ga0207706_101551923 269
204 3300025936 Ga0207670_10000992 Ga0207670_1000099212 269
205 3300025936 Ga0207670_10015842 Ga0207670_100158425 269
206 3300025936 Ga0207670_10170861 Ga0207670_101708612 269
207 3300025939 Ga0207665_10105404 Ga0207665_101054043 269
208 3300025939 Ga0207665_10140333 Ga0207665_101403331 269
209 3300025944 Ga0207661_10014002 Ga0207661_100140024 269
210 3300025960 Ga0207651_10098666 Ga0207651_100986661 269
211 3300025961 Ga0207712_10042653 Ga0207712_100426532 269
212 3300025972 Ga0207668_10001471 Ga0207668_100014714 269
213 3300026023 Ga0207677_10114498 Ga0207677_101144983 269
214 3300026035 Ga0207703_10017185 Ga0207703_100171855 269
215 3300026078 Ga0207702_10209083 Ga0207702_102090833 269
216 3300026118 Ga0207675_100108387 Ga0207675_1001083871 269
217 3300026118 Ga0207675_100215250 Ga0207675_1002152502 269
218 3300026121 Ga0207683_10045083 Ga0207683_100450833 269
219 3300026121 Ga0207683_10139522 Ga0207683_101395223 269
220 3300028379 Ga0268266_10032687 Ga0268266_100326872 269
221 3300028380 Ga0268265_10085211 Ga0268265_100852113 269
222 3300031456 Ga0307513_10029074 Ga0307513_100290742 269
223 3300035086 Ga0373934_0050504 Ga0373934_0050504_447_1256 269
224 3300035089 Ga0373944_0092588 Ga0373944_0092588_105_914 269
225 3300035170 Ga0373943_0046827 Ga0373943_0046827_1089_1898 269
226 3300035170 Ga0373943_0118556 Ga0373943_0118556_220_1029 269
227 3300035171 Ga0373946_0167319 Ga0373946_0167319_123_932 269
228 3300035691 Ga0373931_0114095 Ga0373931_0114095_24_833 269
229 3300035692 Ga0373935_0075013 Ga0373935_0075013_1285_2094 269
230 3300035692 Ga0373935_0087855 Ga0373935_0087855_855_1673 269
231 3300035692 Ga0373935_0169252 Ga0373935_0169252_488_1330 269
232 3300035695 Ga0373927_0032645 Ga0373927_0032645_84_893 269
233 3300035724 Ga0373933_0036140 Ga0373933_0036140_1928_2737 269
234 3300035725 Ga0373947_0054863 Ga0373947_0054863_773_1615 269
235 3300035725 Ga0373947_0056536 Ga0373947_0056536_907_1716 269
236 3300035725 Ga0373947_0132164 Ga0373947_0132164_269_1078 269
237 3300035725 Ga0373947_0285564 Ga0373947_0285564_103_924 269
238 3300036401 Ga0373937_0485541 Ga0373937_0485541_352_1161 269
239 3300036401 Ga0373937_0487915 Ga0373937_0487915_340_1149 269
240 3300037068 Ga0373925_0085354 Ga0373925_0085354_1508_2317 269
241 3300037068 Ga0373925_0109317 Ga0373925_0109317_144_953 269
242 3300037068 Ga0373925_0279994 Ga0373925_0279994_298_1140 269
243 3300037312 Ga0395899_0061365 Ga0395899_0061365_1543_2352 269
244 3300037418 Ga0395900_0003244 Ga0395900_0003244_15315_16124 269
245 3300037418 Ga0395900_0200776 Ga0395900_0200776_1143_1958 269
246 3300037418 Ga0395900_0250260 Ga0395900_0250260_540_1349 269
247 3300037466 Ga0395898_0002180 Ga0395898_0002180_13291_14100 269
248 3300037466 Ga0395898_0669614 Ga0395898_0669614_135_950 269
249 3300037471 Ga0395905_0011399 Ga0395905_0011399_1400_2209 269
250 3300037471 Ga0395905_0591193 Ga0395905_0591193_34_849 269
251 3300037853 Ga0436364_1554999 Ga0436364_1554999_302_1114 269
252 3300037853 Ga0436364_1562084 Ga0436364_1562084_15_824 269
253 3300038443 Ga0395901_0003824 Ga0395901_0003824_2759_3568 269
254 3300038443 Ga0395901_0262525 Ga0395901_0262525_484_1293 269
255 3300039447 Ga0436361_0102443 Ga0436361_0102443_944_1762 269
256 3300046455 Ga0495603_0072403 Ga0495603_0072403_1203_2012 269
257 3300046459 Ga0495629_0016883 Ga0495629_0016883_350_1159 269
258 3300046459 Ga0495629_0256665 Ga0495629_0256665_343_1152 269
259 3300046462 Ga0495651_0178275 Ga0495651_0178275_47_856 269
260 3300046491 Ga0495584_0090017 Ga0495584_0090017_66_932 269
261 3300046511 Ga0495608_0217206 Ga0495608_0217206_115_924 269
262 3300046514 Ga0495618_0050232 Ga0495618_0050232_1618_2427 269
263 3300046517 Ga0495630_0034751 Ga0495630_0034751_1542_2351 269
264 3300046517 Ga0495630_0265864 Ga0495630_0265864_142_957 269
265 3300046529 Ga0495652_0040978 Ga0495652_0040978_1589_2398 269
266 3300046535 Ga0495586_0208292 Ga0495586_0208292_208_1017 269
267 3300046543 Ga0495645_0066352 Ga0495645_0066352_211_1020 269
268 3300046559 Ga0495667_0045600 Ga0495667_0045600_288_1097 269
269 3300046642 Ga0495634_0122254 Ga0495634_0122254_394_1203 269
270 3300046642 Ga0495634_0207045 Ga0495634_0207045_317_1126 269
271 3300046679 Ga0495623_0023563 Ga0495623_0023563_860_1669 269
272 3300046680 Ga0495646_0023230 Ga0495646_0023230_2817_3626 269
273 3300047317 Ga0495604_0054962 Ga0495604_0054962_515_1324 269
274 3300047444 Ga0495675_0118097 Ga0495675_0118097_208_1017 269
275 3300048088 Ga0495602_0018318 Ga0495602_0018318_1003_1812 269
276 3300048905 Ga0496102_0685448 Ga0496102_0685448_40_861 269
277 3300048907 Ga0496104_0118561 Ga0496104_0118561_894_1715 269
278 3300048908 Ga0496105_0104139 Ga0496105_0104139_260_1081 269
279 3300048910 Ga0496107_0220881 Ga0496107_0220881_496_1356 269
280 3300048911 Ga0496108_0112682 Ga0496108_0112682_1417_2226 269
281 3300048912 Ga0496109_0043901 Ga0496109_0043901_2436_3245 269
282 3300048912 Ga0496109_0048549 Ga0496109_0048549_2055_2876 269
283 3300048912 Ga0496109_0081436 Ga0496109_0081436_606_1421 269
284 3300048915 Ga0496112_0020949 Ga0496112_0020949_987_1808 269
285 3300048916 Ga0496113_0175788 Ga0496113_0175788_367_1182 269
286 3300048916 Ga0496113_0298062 Ga0496113_0298062_15_836 269
287 3300048917 Ga0496114_0026046 Ga0496114_0026046_3193_4014 269
288 3300048918 Ga0496115_0152998 Ga0496115_0152998_717_1532 269
289 3300048918 Ga0496115_0335379 Ga0496115_0335379_263_1084 269
290 3300050512 nmdc:mga0n895_739880_c1 nmdc:mga0n895_739880_c1_47_862 269
291 3300050514 nmdc:mga08x19_24734_c1 nmdc:mga08x19_24734_c1_1082_1891 269
292 3300053085 Ga0495619_0077549 Ga0495619_0077549_186_995 269
293 3300053085 Ga0495619_0496451 Ga0495619_0496451_17_826 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17930

LpxI_N

LpxI N-terminal domain

37

166

0.98

PF06230

LpxI_C

LpxI C-terminal domain

169

298

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j6e-assembly1.cif.gz_A-2 structure of lpxi d225a mutant 0.8657 8 268
4j6e-assembly1.cif.gz_A-2 structure of lpxi d225a mutant 0.8391 8 268
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.7729 6 123
4yra-assembly4.cif.gz_F mouse tdh in the apo form 0.7539 4 125
4yra-assembly1.cif.gz_H mouse tdh in the apo form 0.7383 4 125
ID Description Score Start End Superfamily
4j6eA02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;LpxI C-terminal catalytic domain 0.9061 134 268 3.40.140.80
4j6eA02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;LpxI C-terminal catalytic domain 0.8465 134 268 3.40.140.80
4ggmX01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8386 6 128 3.40.50.20
4j6eA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8253 8 126 3.40.50.20
4ggmX01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8145 6 128 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A2V6AWG7-F1-model_v4 DUF1009 domain-containing protein 0.9912 1 72
AF-A0A2V5M5V1-F1-model_v4 DUF1009 domain-containing protein 0.9891 1 77
AF-W1YCS9-F1-model_v4 LpxI C-terminal domain-containing protein 0.9866 148 215
AF-A0A3D4ABF4-F1-model_v4 DUF1009 domain-containing protein 0.9779 1 135
AF-A0A2V6AWG7-F1-model_v4 DUF1009 domain-containing protein 0.9777 1 72

Feature Viewer

pLDDT pTM Quality
92.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map