F391190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 177 | 292 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300049593|Ga0501077_0067826|Ga0501077_0067826_563_1480 |
| Length | 305 |
| Sequence | VRRLPRQVPGEAISRSRAAGSSPAAAGLFIFCLLVAPLAALAQGDAKRGEYLAKAGGCVGCHTEAREGATPFAGGRALKTPFGTFYGPNITPHPQAGIGRWSEADFARALHEGVRPDGAHYYPAFPYTSFTRIADADVRDLWAYMRSLPPSAQPSRPHELGLLYRARFTLGIWKWLFFEPGRFVADSQKSASVNRGAYLVQALGHCGECHTPRNFLGGTKKDRFLAGGKLPDGGSAPNLTPTRLKDWSDGELRDVLSSGLLPDGDVLGETMGEVVRNTTSQLTPEDLAALIAYLRALPPLPSEPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 38 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 78 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 79 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 80 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 81 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 82 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 83 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 84 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 85 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 88 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 89 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 90 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 91 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 93 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 94 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 97 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 98 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 99 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 100 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 101 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 102 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 103 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 104 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 157 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10181442 | 3300005295 | Bacteria | 1416 |
| 2 | Ga0070676_10040320 | 3300005328 | Bacteria | 2704 |
| 3 | Ga0068869_100068394 | 3300005334 | Bacteria | 2623 |
| 4 | Ga0070680_100029866 | 3300005336 | Bacteria | 4376 |
| 5 | Ga0070689_100027499 | 3300005340 | Bacteria | 4288 |
| 6 | Ga0070691_10129179 | 3300005341 | Bacteria | 1279 |
| 7 | Ga0070692_10011019 | 3300005345 | Bacteria | 4139 |
| 8 | Ga0070692_10012971 | 3300005345 | Bacteria | 3874 |
| 9 | Ga0070669_100002754 | 3300005353 | Bacteria | 12681 |
| 10 | Ga0070675_100013844 | 3300005354 | Bacteria | 6350 |
| 11 | Ga0070674_100172358 | 3300005356 | Bacteria | 1651 |
| 12 | Ga0070673_100370566 | 3300005364 | Bacteria | 1275 |
| 13 | Ga0070701_10197925 | 3300005438 | Bacteria | 1186 |
| 14 | Ga0070705_100003370 | 3300005440 | Bacteria | 7842 |
| 15 | Ga0070705_100040982 | 3300005440 | Bacteria | 2637 |
| 16 | Ga0070705_100087767 | 3300005440 | Bacteria | 1929 |
| 17 | Ga0070700_100000940 | 3300005441 | Bacteria | 14379 |
| 18 | Ga0070700_100178596 | 3300005441 | Bacteria | 1475 |
| 19 | Ga0070694_100001052 | 3300005444 | Bacteria | 15766 |
| 20 | Ga0070681_10008416 | 3300005458 | Bacteria | 10104 |
| 21 | Ga0068867_100000199 | 3300005459 | Bacteria | 39822 |
| 22 | Ga0068867_100489776 | 3300005459 | Bacteria | 1055 |
| 23 | Ga0070706_100164500 | 3300005467 | Bacteria | 2072 |
| 24 | Ga0070679_100125321 | 3300005530 | Unclassified | 2551 |
| 25 | Ga0070697_100230141 | 3300005536 | Bacteria | 1581 |
| 26 | Ga0070695_100034745 | 3300005545 | Bacteria | 3163 |
| 27 | Ga0070696_100012102 | 3300005546 | Bacteria | 5781 |
| 28 | Ga0070704_100003746 | 3300005549 | Bacteria | 8751 |
| 29 | Ga0070704_100012071 | 3300005549 | Bacteria | 5326 |
| 30 | Ga0070704_100146863 | 3300005549 | Bacteria | 1849 |
| 31 | Ga0068861_100003974 | 3300005719 | Bacteria | 9902 |
| 32 | Ga0068861_100148045 | 3300005719 | Bacteria | 1924 |
| 33 | Ga0068862_100001087 | 3300005844 | Bacteria | 25912 |
| 34 | Ga0081539_10001356 | 3300005985 | Bacteria | 42605 |
| 35 | Ga0070716_100013965 | 3300006173 | Bacteria | 4107 |
| 36 | Ga0075428_100103296 | 3300006844 | Bacteria | 3108 |
| 37 | Ga0075428_100181009 | 3300006844 | Bacteria | 2281 |
| 38 | Ga0075430_100009348 | 3300006846 | Bacteria | 8285 |
| 39 | Ga0075430_100012171 | 3300006846 | Bacteria | 7325 |
| 40 | Ga0075430_100012874 | 3300006846 | Bacteria | 7128 |
| 41 | Ga0075430_100341734 | 3300006846 | Bacteria | 1236 |
| 42 | Ga0075431_100031643 | 3300006847 | Bacteria | 5449 |
| 43 | Ga0075431_100031781 | 3300006847 | Bacteria | 5438 |
| 44 | Ga0075431_100144200 | 3300006847 | Bacteria | 2454 |
| 45 | Ga0075433_10047299 | 3300006852 | Bacteria | 3742 |
| 46 | Ga0075433_10250852 | 3300006852 | Bacteria | 1570 |
| 47 | Ga0075434_100003841 | 3300006871 | Bacteria | 13427 |
| 48 | Ga0075434_100050282 | 3300006871 | Bacteria | 4140 |
| 49 | Ga0075434_100054216 | 3300006871 | Bacteria | 3984 |
| 50 | Ga0075434_100229886 | 3300006871 | Bacteria | 1874 |
| 51 | Ga0075429_100027821 | 3300006880 | Bacteria | 4908 |
| 52 | Ga0068865_100143114 | 3300006881 | Bacteria | 1805 |
| 53 | Ga0075436_100006269 | 3300006914 | Bacteria | 8148 |
| 54 | Ga0075436_100010372 | 3300006914 | Bacteria | 6383 |
| 55 | Ga0075436_100035894 | 3300006914 | Bacteria | 3420 |
| 56 | Ga0075436_100309406 | 3300006914 | Bacteria | 1133 |
| 57 | Ga0075435_100018626 | 3300007076 | Bacteria | 5288 |
| 58 | Ga0075435_100135010 | 3300007076 | Bacteria | 2066 |
| 59 | Ga0099794_10022090 | 3300007265 | Bacteria | 2898 |
| 60 | Ga0099794_10030175 | 3300007265 | Bacteria | 2530 |
| 61 | Ga0099795_10032462 | 3300007788 | Bacteria | 1806 |
| 62 | Ga0111539_10024558 | 3300009094 | Bacteria | 7393 |
| 63 | Ga0111539_10067971 | 3300009094 | Bacteria | 4207 |
| 64 | Ga0111539_10137905 | 3300009094 | Bacteria | 2857 |
| 65 | Ga0114129_10012415 | 3300009147 | Bacteria | 12125 |
| 66 | Ga0114129_10075721 | 3300009147 | Bacteria | 4686 |
| 67 | Ga0105243_10006579 | 3300009148 | Bacteria | 8980 |
| 68 | Ga0105243_10239592 | 3300009148 | Bacteria | 1613 |
| 69 | Ga0105249_10000940 | 3300009553 | Bacteria | 25776 |
| 70 | Ga0163162_10136355 | 3300013306 | Bacteria | 2565 |
| 71 | Ga0157375_10487574 | 3300013308 | Bacteria | 1397 |
| 72 | Ga0157380_10001346 | 3300014326 | Bacteria | 15990 |
| 73 | Ga0157377_10040578 | 3300014745 | Bacteria | 2578 |
| 74 | Ga0163161_10517968 | 3300017792 | Bacteria | 973 |
| 75 | Ga0207643_10010340 | 3300025908 | Bacteria | 5024 |
| 76 | Ga0207684_10039529 | 3300025910 | Bacteria | 4001 |
| 77 | Ga0207707_10006779 | 3300025912 | Bacteria | 9994 |
| 78 | Ga0207660_10029057 | 3300025917 | Bacteria | 3788 |
| 79 | Ga0207660_10103755 | 3300025917 | Bacteria | 2128 |
| 80 | Ga0207660_10113153 | 3300025917 | Bacteria | 2045 |
| 81 | Ga0207662_10017638 | 3300025918 | Bacteria | 4040 |
| 82 | Ga0207652_10062504 | 3300025921 | Unclassified | 3218 |
| 83 | Ga0207681_10002198 | 3300025923 | Bacteria | 12440 |
| 84 | Ga0207659_10230607 | 3300025926 | Bacteria | 1493 |
| 85 | Ga0207709_10002718 | 3300025935 | Bacteria | 10931 |
| 86 | Ga0207669_10137729 | 3300025937 | Bacteria | 1689 |
| 87 | Ga0207704_10003917 | 3300025938 | Bacteria | 6767 |
| 88 | Ga0207691_10292150 | 3300025940 | Bacteria | 1401 |
| 89 | Ga0207689_10012214 | 3300025942 | Bacteria | 7347 |
| 90 | Ga0207651_10059892 | 3300025960 | Bacteria | 2640 |
| 91 | Ga0207712_10007878 | 3300025961 | Bacteria | 6734 |
| 92 | Ga0207668_10087937 | 3300025972 | Bacteria | 2274 |
| 93 | Ga0207708_10012340 | 3300026075 | Bacteria | 6368 |
| 94 | Ga0207708_10175058 | 3300026075 | Bacteria | 1701 |
| 95 | Ga0207708_10195470 | 3300026075 | Bacteria | 1612 |
| 96 | Ga0207648_10000242 | 3300026089 | Bacteria | 58883 |
| 97 | Ga0207648_10072578 | 3300026089 | Bacteria | 2999 |
| 98 | Ga0207675_100001245 | 3300026118 | Bacteria | 25404 |
| 99 | Ga0207675_100145755 | 3300026118 | Bacteria | 2251 |
| 100 | Ga0209969_1001400 | 3300027360 | Bacteria | 3313 |
| 101 | Ga0209179_1002444 | 3300027512 | Bacteria | 2513 |
| 102 | Ga0209999_1006849 | 3300027543 | Bacteria | 2051 |
| 103 | Ga0209588_1011049 | 3300027671 | Bacteria | 2722 |
| 104 | Ga0209974_10033317 | 3300027876 | Bacteria | 1709 |
| 105 | Ga0207428_10015387 | 3300027907 | Bacteria | 6618 |
| 106 | Ga0207428_10068569 | 3300027907 | Bacteria | 2789 |
| 107 | Ga0207428_10132974 | 3300027907 | Bacteria | 1903 |
| 108 | Ga0268265_10001954 | 3300028380 | Bacteria | 16362 |
| 109 | Ga0268264_10364574 | 3300028381 | Bacteria | 1379 |
| 110 | Ga0265331_10053873 | 3300031250 | Bacteria | 1917 |
| 111 | Ga0307412_10103314 | 3300031911 | Bacteria | 2020 |
| 112 | Ga0307409_100320304 | 3300031995 | Bacteria | 1451 |
| 113 | Ga0307416_100029913 | 3300032002 | Bacteria | 4078 |
| 114 | Ga0307416_100431419 | 3300032002 | Bacteria | 1365 |
| 115 | Ga0373959_0006670 | 3300034820 | Bacteria | 1925 |
| 116 | Ga0373934_0031522 | 3300035086 | Bacteria | 2076 |
| 117 | Ga0373934_0031970 | 3300035086 | Bacteria | 2062 |
| 118 | Ga0373952_0004181 | 3300035092 | Bacteria | 2608 |
| 119 | Ga0373936_0031958 | 3300035113 | Bacteria | 2080 |
| 120 | Ga0373941_0011558 | 3300035115 | Bacteria | 2284 |
| 121 | Ga0373953_0011064 | 3300035117 | Bacteria | 3154 |
| 122 | Ga0373954_0000292 | 3300035118 | Bacteria | 18103 |
| 123 | Ga0373954_0003552 | 3300035118 | Bacteria | 6626 |
| 124 | Ga0373956_0008457 | 3300035119 | Bacteria | 4166 |
| 125 | Ga0373957_0045931 | 3300035120 | Bacteria | 1656 |
| 126 | Ga0373957_0049991 | 3300035120 | Bacteria | 1597 |
| 127 | Ga0373957_0121744 | 3300035120 | Bacteria | 1056 |
| 128 | Ga0373955_0095939 | 3300035172 | Bacteria | 1696 |
| 129 | Ga0373924_0034692 | 3300035410 | Bacteria | 2043 |
| 130 | Ga0373931_0125953 | 3300035691 | Bacteria | 1469 |
| 131 | Ga0373935_0037873 | 3300035692 | Bacteria | 3018 |
| 132 | Ga0373933_0022860 | 3300035724 | Bacteria | 3565 |
| 133 | Ga0373933_0147428 | 3300035724 | Bacteria | 1488 |
| 134 | Ga0373947_0328491 | 3300035725 | Bacteria | 1024 |
| 135 | Ga0373937_0000145 | 3300036401 | Bacteria | 68629 |
| 136 | Ga0373937_0046718 | 3300036401 | Bacteria | 3959 |
| 137 | Ga0373925_0366054 | 3300037068 | Bacteria | 1172 |
| 138 | Ga0373925_0381386 | 3300037068 | Bacteria | 1148 |
| 139 | Ga0439453_0000959 | 3300041408 | Bacteria | 3491 |
| 140 | Ga0439437_006466 | 3300042000 | Bacteria | 1298 |
| 141 | Ga0439443_000211 | 3300042003 | Bacteria | 4391 |
| 142 | Ga0439435_0000403 | 3300042436 | Bacteria | 6682 |
| 143 | Ga0439435_0000431 | 3300042436 | Bacteria | 6563 |
| 144 | Ga0439444_0000032 | 3300042437 | Bacteria | 10072 |
| 145 | Ga0439460_0001305 | 3300042461 | Bacteria | 5853 |
| 146 | Ga0439460_0004113 | 3300042461 | Bacteria | 3537 |
| 147 | Ga0450893_0024904 | 3300042532 | Bacteria | 1046 |
| 148 | Ga0451577_0146333 | 3300042876 | Bacteria | 2125 |
| 149 | Ga0466957_0042644 | 3300044842 | Bacteria | 2746 |
| 150 | Ga0466967_0002691 | 3300045976 | Bacteria | 11224 |
| 151 | Ga0495592_0004302 | 3300046454 | Bacteria | 10412 |
| 152 | Ga0495592_0015388 | 3300046454 | Bacteria | 5802 |
| 153 | Ga0495651_0044186 | 3300046462 | Bacteria | 3453 |
| 154 | Ga0495653_0029917 | 3300046463 | Bacteria | 4340 |
| 155 | Ga0495580_0252370 | 3300046472 | Bacteria | 1207 |
| 156 | Ga0495639_0148873 | 3300046475 | Bacteria | 1128 |
| 157 | Ga0495662_0016269 | 3300046476 | Bacteria | 3605 |
| 158 | Ga0495662_0026795 | 3300046476 | Bacteria | 2784 |
| 159 | Ga0495664_0087151 | 3300046477 | Bacteria | 1875 |
| 160 | Ga0495618_0103956 | 3300046514 | Bacteria | 1818 |
| 161 | Ga0495618_0192551 | 3300046514 | Bacteria | 1292 |
| 162 | Ga0495628_0005207 | 3300046516 | Bacteria | 11415 |
| 163 | Ga0495628_0035537 | 3300046516 | Bacteria | 4003 |
| 164 | Ga0495628_0061981 | 3300046516 | Bacteria | 2932 |
| 165 | Ga0495630_0004891 | 3300046517 | Bacteria | 9413 |
| 166 | Ga0495630_0041606 | 3300046517 | Bacteria | 3432 |
| 167 | Ga0495630_0388887 | 3300046517 | Bacteria | 1068 |
| 168 | Ga0495666_0006855 | 3300046526 | Bacteria | 5720 |
| 169 | Ga0495652_0023616 | 3300046529 | Bacteria | 5450 |
| 170 | Ga0495652_0074789 | 3300046529 | Bacteria | 2816 |
| 171 | Ga0495652_0290032 | 3300046529 | Bacteria | 1194 |
| 172 | Ga0495665_0061106 | 3300046531 | Bacteria | 1989 |
| 173 | Ga0495586_0020354 | 3300046535 | Bacteria | 3533 |
| 174 | Ga0495587_0076883 | 3300046536 | Bacteria | 1938 |
| 175 | Ga0495598_0002452 | 3300046537 | Bacteria | 3836 |
| 176 | Ga0495598_0036999 | 3300046537 | Bacteria | 1406 |
| 177 | Ga0495621_0005757 | 3300046539 | Bacteria | 3582 |
| 178 | Ga0495621_0041677 | 3300046539 | Bacteria | 1613 |
| 179 | Ga0495645_0000044 | 3300046543 | Bacteria | 90950 |
| 180 | Ga0495667_0082916 | 3300046559 | Bacteria | 2082 |
| 181 | Ga0495634_0065153 | 3300046642 | Bacteria | 2415 |
| 182 | Ga0495635_0018422 | 3300046663 | Bacteria | 4872 |
| 183 | Ga0495635_0055622 | 3300046663 | Bacteria | 2726 |
| 184 | Ga0495599_0001611 | 3300046678 | Bacteria | 13003 |
| 185 | Ga0495599_0044582 | 3300046678 | Bacteria | 2782 |
| 186 | Ga0495599_0055994 | 3300046678 | Bacteria | 2467 |
| 187 | Ga0495647_0023685 | 3300046681 | Bacteria | 2228 |
| 188 | Ga0495658_0053208 | 3300046683 | Bacteria | 2298 |
| 189 | Ga0495669_0046993 | 3300046684 | Bacteria | 1927 |
| 190 | Ga0495613_0057965 | 3300046689 | Bacteria | 2843 |
| 191 | Ga0495624_0064830 | 3300046690 | Bacteria | 2283 |
| 192 | Ga0495600_0074976 | 3300046809 | Bacteria | 2209 |
| 193 | Ga0495604_0073358 | 3300047317 | Bacteria | 2583 |
| 194 | Ga0495636_0109799 | 3300047318 | Bacteria | 1213 |
| 195 | Ga0495674_0008982 | 3300047319 | Bacteria | 9496 |
| 196 | Ga0495675_0006190 | 3300047444 | Bacteria | 7323 |
| 197 | Ga0495602_0177247 | 3300048088 | Bacteria | 1648 |
| 198 | Ga0501298_007184 | 3300049521 | Bacteria | 1843 |
| 199 | Ga0501298_007225 | 3300049521 | Bacteria | 1838 |
| 200 | Ga0501036_0024987 | 3300049572 | Bacteria | 5039 |
| 201 | Ga0501036_0433247 | 3300049572 | Bacteria | 1096 |
| 202 | Ga0501037_0182596 | 3300049573 | Bacteria | 1488 |
| 203 | Ga0501037_0241706 | 3300049573 | Bacteria | 1265 |
| 204 | Ga0501039_0002475 | 3300049575 | Bacteria | 13754 |
| 205 | Ga0501039_0078739 | 3300049575 | Bacteria | 2564 |
| 206 | Ga0501039_0109384 | 3300049575 | Bacteria | 2160 |
| 207 | Ga0501040_0073662 | 3300049576 | Bacteria | 2360 |
| 208 | Ga0501041_0001554 | 3300049577 | Bacteria | 12778 |
| 209 | Ga0501041_0013311 | 3300049577 | Bacteria | 4875 |
| 210 | Ga0501041_0020073 | 3300049577 | Bacteria | 3991 |
| 211 | Ga0501041_0066994 | 3300049577 | Bacteria | 2201 |
| 212 | Ga0501042_0015307 | 3300049578 | Bacteria | 5251 |
| 213 | Ga0501042_0045145 | 3300049578 | Bacteria | 3141 |
| 214 | Ga0501042_0129099 | 3300049578 | Bacteria | 1821 |
| 215 | Ga0501042_0308986 | 3300049578 | Bacteria | 1142 |
| 216 | Ga0501046_0023379 | 3300049580 | Bacteria | 5086 |
| 217 | Ga0501046_0058201 | 3300049580 | Bacteria | 3030 |
| 218 | Ga0501046_0068227 | 3300049580 | Bacteria | 2768 |
| 219 | Ga0501048_0211730 | 3300049582 | Bacteria | 1375 |
| 220 | Ga0501068_0037892 | 3300049584 | Bacteria | 2887 |
| 221 | Ga0501068_0347311 | 3300049584 | Bacteria | 953 |
| 222 | Ga0501071_0001043 | 3300049587 | Bacteria | 15345 |
| 223 | Ga0501071_0010657 | 3300049587 | Bacteria | 6166 |
| 224 | Ga0501071_0017580 | 3300049587 | Bacteria | 4935 |
| 225 | Ga0501071_0019675 | 3300049587 | Bacteria | 4686 |
| 226 | Ga0501072_0005925 | 3300049588 | Bacteria | 9312 |
| 227 | Ga0501072_0067866 | 3300049588 | Bacteria | 2814 |
| 228 | Ga0501072_0071187 | 3300049588 | Bacteria | 2747 |
| 229 | Ga0501072_0472976 | 3300049588 | Bacteria | 992 |
| 230 | Ga0501073_0306051 | 3300049589 | Bacteria | 1096 |
| 231 | Ga0501074_0085306 | 3300049590 | Bacteria | 2263 |
| 232 | Ga0501074_0298600 | 3300049590 | Bacteria | 1144 |
| 233 | Ga0501074_0427341 | 3300049590 | Bacteria | 939 |
| 234 | Ga0501075_0001389 | 3300049591 | Bacteria | 15748 |
| 235 | Ga0501075_0024466 | 3300049591 | Bacteria | 4429 |
| 236 | Ga0501075_0034433 | 3300049591 | Bacteria | 3771 |
| 237 | Ga0501075_0416116 | 3300049591 | Bacteria | 1025 |
| 238 | Ga0501076_0000978 | 3300049592 | Bacteria | 18726 |
| 239 | Ga0501076_0003088 | 3300049592 | Bacteria | 11602 |
| 240 | Ga0501076_0062670 | 3300049592 | Bacteria | 2962 |
| 241 | Ga0501077_0014116 | 3300049593 | Bacteria | 5013 |
| 242 | Ga0501077_0067826 | 3300049593 | Bacteria | 2262 |
| 243 | Ga0501077_0077899 | 3300049593 | Bacteria | 2100 |
| 244 | Ga0501216_013387 | 3300049660 | Bacteria | 1360 |
| 245 | Ga0501217_012508 | 3300049661 | Bacteria | 1892 |
| 246 | Ga0501079_0009554 | 3300049741 | Bacteria | 7353 |
| 247 | Ga0501079_0168823 | 3300049741 | Bacteria | 1706 |
| 248 | Ga0501080_0004298 | 3300049742 | Bacteria | 12649 |
| 249 | Ga0501080_0012969 | 3300049742 | Bacteria | 7651 |
| 250 | Ga0501080_0014278 | 3300049742 | Bacteria | 7316 |
| 251 | Ga0501080_0094314 | 3300049742 | Bacteria | 2779 |
| 252 | Ga0501081_0057636 | 3300049743 | Bacteria | 2686 |
| 253 | Ga0501083_0015981 | 3300049744 | Bacteria | 5256 |
| 254 | Ga0501083_0102688 | 3300049744 | Bacteria | 1885 |
| 255 | Ga0501035_0150761 | 3300049822 | Bacteria | 2018 |
| 256 | Ga0501045_0001917 | 3300049824 | Bacteria | 14057 |
| 257 | Ga0501045_0004750 | 3300049824 | Bacteria | 9380 |
| 258 | nmdc:mga09592_214564_c1 | 3300050508 | Bacteria | 1668 |
| 259 | nmdc:mga09592_7869_c1 | 3300050508 | Bacteria | 8665 |
| 260 | nmdc:mga0qj67_355716_c1 | 3300050509 | Unclassified | 1184 |
| 261 | nmdc:mga0qj67_37631_c1 | 3300050509 | Bacteria | 3792 |
| 262 | nmdc:mga0qj67_72454_c1 | 3300050509 | Bacteria | 2751 |
| 263 | nmdc:mga0qj67_7863_c1 | 3300050509 | Bacteria | 7878 |
| 264 | nmdc:mga06r32_340134_c1 | 3300050510 | Bacteria | 1485 |
| 265 | nmdc:mga06r32_712543_c1 | 3300050510 | Bacteria | 969 |
| 266 | nmdc:mga06r32_93929_c1 | 3300050510 | Bacteria | 2935 |
| 267 | nmdc:mga08y16_25321_c1 | 3300050511 | Bacteria | 6256 |
| 268 | nmdc:mga08y16_26487_c1 | 3300050511 | Bacteria | 6113 |
| 269 | nmdc:mga08y16_74960_c1 | 3300050511 | Bacteria | 3527 |
| 270 | nmdc:mga0n895_388563_c1 | 3300050512 | Bacteria | 1412 |
| 271 | nmdc:mga0n895_3965_c1 | 3300050512 | Bacteria | 12033 |
| 272 | nmdc:mga0n895_68358_c1 | 3300050512 | Bacteria | 3519 |
| 273 | nmdc:mga0rr50_12330_c1 | 3300050513 | Bacteria | 5520 |
| 274 | nmdc:mga0rr50_50342_c1 | 3300050513 | Bacteria | 3086 |
| 275 | nmdc:mga08x19_102697_c1 | 3300050514 | Bacteria | 1899 |
| 276 | nmdc:mga08x19_14411_c1 | 3300050514 | Bacteria | 4793 |
| 277 | nmdc:mga08x19_25422_c1 | 3300050514 | Bacteria | 3688 |
| 278 | nmdc:mga08x19_54061_c1 | 3300050514 | Bacteria | 2584 |
| 279 | nmdc:mga08x19_80232_c1 | 3300050514 | Bacteria | 2141 |
| 280 | nmdc:mga0a205_32315_c1 | 3300050515 | Bacteria | 5018 |
| 281 | Ga0495601_0002996 | 3300053077 | Bacteria | 9619 |
| 282 | Ga0495601_0080173 | 3300053077 | Bacteria | 2094 |
| 283 | Ga0495612_0073256 | 3300053078 | Bacteria | 1431 |
| 284 | Ga0495619_0029288 | 3300053085 | Bacteria | 3556 |
| 285 | Ga0501084_0026967 | 3300054114 | Bacteria | 4800 |
| 286 | Ga0501084_0034236 | 3300054114 | Bacteria | 4248 |
| 287 | Ga0501084_0061697 | 3300054114 | Bacteria | 3139 |
| 288 | Ga0501082_0001295 | 3300060353 | Bacteria | 21925 |
| 289 | Ga0501082_0073980 | 3300060353 | Bacteria | 2934 |
| 290 | Ga0501082_0650712 | 3300060353 | Bacteria | 922 |
| 291 | Ga0530510_0003896 | 3300061734 | Bacteria | 10292 |
| 292 | Ga0530510_0004440 | 3300061734 | Bacteria | 9712 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100164500 | Ga0070706_1001645001 | 252 |
| 2 | 3300035119 | Ga0373956_0008457 | Ga0373956_0008457_1987_2844 | 255 |
| 3 | 3300035120 | Ga0373957_0121744 | Ga0373957_0121744_137_994 | 255 |
| 4 | 3300035172 | Ga0373955_0095939 | Ga0373955_0095939_752_1609 | 255 |
| 5 | 3300036401 | Ga0373937_0046718 | Ga0373937_0046718_2129_2986 | 255 |
| 6 | 3300046454 | Ga0495592_0004302 | Ga0495592_0004302_861_1712 | 255 |
| 7 | 3300046514 | Ga0495618_0192551 | Ga0495618_0192551_157_1014 | 255 |
| 8 | 3300046516 | Ga0495628_0005207 | Ga0495628_0005207_4348_5199 | 255 |
| 9 | 3300046529 | Ga0495652_0023616 | Ga0495652_0023616_3942_4793 | 255 |
| 10 | 3300046535 | Ga0495586_0020354 | Ga0495586_0020354_2562_3419 | 255 |
| 11 | 3300046543 | Ga0495645_0000044 | Ga0495645_0000044_71256_72107 | 255 |
| 12 | 3300046559 | Ga0495667_0082916 | Ga0495667_0082916_115_972 | 255 |
| 13 | 3300046678 | Ga0495599_0001611 | Ga0495599_0001611_10398_11249 | 255 |
| 14 | 3300006871 | Ga0075434_100229886 | Ga0075434_1002298863 | 256 |
| 15 | 3300050512 | nmdc:mga0n895_68358_c1 | nmdc:mga0n895_68358_c1_2374_3234 | 256 |
| 16 | 3300050514 | nmdc:mga08x19_25422_c1 | nmdc:mga08x19_25422_c1_918_1778 | 256 |
| 17 | 3300046516 | Ga0495628_0035537 | Ga0495628_0035537_2718_3569 | 259 |
| 18 | 3300046529 | Ga0495652_0290032 | Ga0495652_0290032_84_935 | 259 |
| 19 | 3300053077 | Ga0495601_0002996 | Ga0495601_0002996_1753_2604 | 259 |
| 20 | 3300035086 | Ga0373934_0031522 | Ga0373934_0031522_1153_1992 | 260 |
| 21 | 3300005440 | Ga0070705_100003370 | Ga0070705_1000033708 | 261 |
| 22 | 3300006852 | Ga0075433_10250852 | Ga0075433_102508522 | 261 |
| 23 | 3300007788 | Ga0099795_10032462 | Ga0099795_100324623 | 262 |
| 24 | 3300027512 | Ga0209179_1002444 | Ga0209179_10024442 | 262 |
| 25 | 3300035725 | Ga0373947_0328491 | Ga0373947_0328491_112_972 | 262 |
| 26 | 3300049573 | Ga0501037_0241706 | Ga0501037_0241706_405_1217 | 265 |
| 27 | 3300049575 | Ga0501039_0109384 | Ga0501039_0109384_1176_1988 | 265 |
| 28 | 3300049577 | Ga0501041_0001554 | Ga0501041_0001554_1926_2738 | 265 |
| 29 | 3300049578 | Ga0501042_0015307 | Ga0501042_0015307_1106_1918 | 265 |
| 30 | 3300049580 | Ga0501046_0068227 | Ga0501046_0068227_998_1810 | 265 |
| 31 | 3300049584 | Ga0501068_0037892 | Ga0501068_0037892_255_1067 | 265 |
| 32 | 3300049587 | Ga0501071_0017580 | Ga0501071_0017580_2205_3017 | 265 |
| 33 | 3300049589 | Ga0501073_0306051 | Ga0501073_0306051_195_1007 | 265 |
| 34 | 3300049590 | Ga0501074_0085306 | Ga0501074_0085306_366_1178 | 265 |
| 35 | 3300049591 | Ga0501075_0001389 | Ga0501075_0001389_45_857 | 265 |
| 36 | 3300049592 | Ga0501076_0003088 | Ga0501076_0003088_6915_7727 | 265 |
| 37 | 3300049593 | Ga0501077_0077899 | Ga0501077_0077899_800_1612 | 265 |
| 38 | 3300049742 | Ga0501080_0012969 | Ga0501080_0012969_6232_7044 | 265 |
| 39 | 3300049824 | Ga0501045_0004750 | Ga0501045_0004750_45_857 | 265 |
| 40 | 3300054114 | Ga0501084_0061697 | Ga0501084_0061697_13_825 | 265 |
| 41 | 3300061734 | Ga0530510_0004440 | Ga0530510_0004440_2021_2833 | 265 |
| 42 | 3300005549 | Ga0070704_100012071 | Ga0070704_1000120713 | 267 |
| 43 | 3300009147 | Ga0114129_10012415 | Ga0114129_100124155 | 267 |
| 44 | 3300035086 | Ga0373934_0031970 | Ga0373934_0031970_1021_1878 | 267 |
| 45 | 3300035113 | Ga0373936_0031958 | Ga0373936_0031958_582_1439 | 267 |
| 46 | 3300035117 | Ga0373953_0011064 | Ga0373953_0011064_145_1002 | 267 |
| 47 | 3300035120 | Ga0373957_0045931 | Ga0373957_0045931_771_1628 | 267 |
| 48 | 3300035410 | Ga0373924_0034692 | Ga0373924_0034692_868_1725 | 267 |
| 49 | 3300035692 | Ga0373935_0037873 | Ga0373935_0037873_2121_2978 | 267 |
| 50 | 3300035724 | Ga0373933_0147428 | Ga0373933_0147428_114_971 | 267 |
| 51 | 3300037068 | Ga0373925_0366054 | Ga0373925_0366054_187_1044 | 267 |
| 52 | 3300046454 | Ga0495592_0015388 | Ga0495592_0015388_1937_2794 | 267 |
| 53 | 3300046462 | Ga0495651_0044186 | Ga0495651_0044186_920_1777 | 267 |
| 54 | 3300046463 | Ga0495653_0029917 | Ga0495653_0029917_2738_3595 | 267 |
| 55 | 3300046472 | Ga0495580_0252370 | Ga0495580_0252370_71_928 | 267 |
| 56 | 3300046475 | Ga0495639_0148873 | Ga0495639_0148873_48_905 | 267 |
| 57 | 3300046476 | Ga0495662_0016269 | Ga0495662_0016269_1036_1893 | 267 |
| 58 | 3300046477 | Ga0495664_0087151 | Ga0495664_0087151_755_1612 | 267 |
| 59 | 3300046514 | Ga0495618_0103956 | Ga0495618_0103956_93_950 | 267 |
| 60 | 3300046516 | Ga0495628_0061981 | Ga0495628_0061981_330_1187 | 267 |
| 61 | 3300046517 | Ga0495630_0004891 | Ga0495630_0004891_5022_5879 | 267 |
| 62 | 3300046526 | Ga0495666_0006855 | Ga0495666_0006855_619_1476 | 267 |
| 63 | 3300046529 | Ga0495652_0074789 | Ga0495652_0074789_1763_2620 | 267 |
| 64 | 3300046531 | Ga0495665_0061106 | Ga0495665_0061106_635_1492 | 267 |
| 65 | 3300046536 | Ga0495587_0076883 | Ga0495587_0076883_777_1634 | 267 |
| 66 | 3300046663 | Ga0495635_0018422 | Ga0495635_0018422_2414_3271 | 267 |
| 67 | 3300046678 | Ga0495599_0055994 | Ga0495599_0055994_1203_2060 | 267 |
| 68 | 3300046681 | Ga0495647_0023685 | Ga0495647_0023685_546_1403 | 267 |
| 69 | 3300046683 | Ga0495658_0053208 | Ga0495658_0053208_373_1230 | 267 |
| 70 | 3300046689 | Ga0495613_0057965 | Ga0495613_0057965_374_1231 | 267 |
| 71 | 3300046690 | Ga0495624_0064830 | Ga0495624_0064830_1021_1878 | 267 |
| 72 | 3300046809 | Ga0495600_0074976 | Ga0495600_0074976_860_1717 | 267 |
| 73 | 3300047317 | Ga0495604_0073358 | Ga0495604_0073358_742_1599 | 267 |
| 74 | 3300047319 | Ga0495674_0008982 | Ga0495674_0008982_5745_6602 | 267 |
| 75 | 3300047444 | Ga0495675_0006190 | Ga0495675_0006190_2873_3730 | 267 |
| 76 | 3300053077 | Ga0495601_0080173 | Ga0495601_0080173_985_1842 | 267 |
| 77 | 3300053078 | Ga0495612_0073256 | Ga0495612_0073256_47_904 | 267 |
| 78 | 3300053085 | Ga0495619_0029288 | Ga0495619_0029288_1954_2811 | 267 |
| 79 | 3300044842 | Ga0466957_0042644 | Ga0466957_0042644_1358_2185 | 268 |
| 80 | 3300045976 | Ga0466967_0002691 | Ga0466967_0002691_6330_7157 | 268 |
| 81 | 3300049521 | Ga0501298_007184 | Ga0501298_007184_799_1620 | 268 |
| 82 | 3300049577 | Ga0501041_0066994 | Ga0501041_0066994_235_1065 | 268 |
| 83 | 3300049587 | Ga0501071_0001043 | Ga0501071_0001043_771_1601 | 268 |
| 84 | 3300049588 | Ga0501072_0071187 | Ga0501072_0071187_19_849 | 268 |
| 85 | 3300049590 | Ga0501074_0427341 | Ga0501074_0427341_89_919 | 268 |
| 86 | 3300049591 | Ga0501075_0024466 | Ga0501075_0024466_1827_2657 | 268 |
| 87 | 3300049592 | Ga0501076_0062670 | Ga0501076_0062670_1608_2438 | 268 |
| 88 | 3300049661 | Ga0501217_012508 | Ga0501217_012508_224_1045 | 268 |
| 89 | 3300049741 | Ga0501079_0168823 | Ga0501079_0168823_342_1172 | 268 |
| 90 | 3300049742 | Ga0501080_0004298 | Ga0501080_0004298_130_960 | 268 |
| 91 | 3300049744 | Ga0501083_0102688 | Ga0501083_0102688_132_962 | 268 |
| 92 | 3300060353 | Ga0501082_0073980 | Ga0501082_0073980_1858_2688 | 268 |
| 93 | 3300042532 | Ga0450893_0024904 | Ga0450893_0024904_219_1031 | 270 |
| 94 | 3300049572 | Ga0501036_0433247 | Ga0501036_0433247_225_1040 | 271 |
| 95 | 3300049575 | Ga0501039_0078739 | Ga0501039_0078739_196_1011 | 271 |
| 96 | 3300049582 | Ga0501048_0211730 | Ga0501048_0211730_264_1079 | 271 |
| 97 | 3300049588 | Ga0501072_0472976 | Ga0501072_0472976_84_899 | 271 |
| 98 | 3300050514 | nmdc:mga08x19_54061_c1 | nmdc:mga08x19_54061_c1_1234_2088 | 271 |
| 99 | 3300006852 | Ga0075433_10047299 | Ga0075433_100472995 | 273 |
| 100 | 3300006914 | Ga0075436_100010372 | Ga0075436_1000103728 | 273 |
| 101 | 3300007076 | Ga0075435_100018626 | Ga0075435_1000186265 | 273 |
| 102 | 3300050513 | nmdc:mga0rr50_12330_c1 | nmdc:mga0rr50_12330_c1_2908_3765 | 273 |
| 103 | 3300050514 | nmdc:mga08x19_102697_c1 | nmdc:mga08x19_102697_c1_245_1102 | 273 |
| 104 | 3300050515 | nmdc:mga0a205_32315_c1 | nmdc:mga0a205_32315_c1_3606_4463 | 273 |
| 105 | 3300006844 | Ga0075428_100103296 | Ga0075428_1001032962 | 274 |
| 106 | 3300006847 | Ga0075431_100144200 | Ga0075431_1001442004 | 274 |
| 107 | 3300006846 | Ga0075430_100012171 | Ga0075430_1000121712 | 276 |
| 108 | 3300006847 | Ga0075431_100031781 | Ga0075431_1000317812 | 276 |
| 109 | 3300049575 | Ga0501039_0002475 | Ga0501039_0002475_8888_9739 | 276 |
| 110 | 3300049577 | Ga0501041_0020073 | Ga0501041_0020073_2269_3120 | 276 |
| 111 | 3300049578 | Ga0501042_0045145 | Ga0501042_0045145_1742_2593 | 276 |
| 112 | 3300049580 | Ga0501046_0023379 | Ga0501046_0023379_2022_2873 | 276 |
| 113 | 3300049587 | Ga0501071_0019675 | Ga0501071_0019675_3103_3954 | 276 |
| 114 | 3300049588 | Ga0501072_0005925 | Ga0501072_0005925_5098_5949 | 276 |
| 115 | 3300049591 | Ga0501075_0034433 | Ga0501075_0034433_760_1611 | 276 |
| 116 | 3300049593 | Ga0501077_0014116 | Ga0501077_0014116_2510_3361 | 276 |
| 117 | 3300049741 | Ga0501079_0009554 | Ga0501079_0009554_2535_3386 | 276 |
| 118 | 3300049742 | Ga0501080_0014278 | Ga0501080_0014278_1285_2136 | 276 |
| 119 | 3300049744 | Ga0501083_0015981 | Ga0501083_0015981_3901_4752 | 276 |
| 120 | 3300049822 | Ga0501035_0150761 | Ga0501035_0150761_453_1304 | 276 |
| 121 | 3300050509 | nmdc:mga0qj67_37631_c1 | nmdc:mga0qj67_37631_c1_1849_2679 | 276 |
| 122 | 3300050510 | nmdc:mga06r32_340134_c1 | nmdc:mga06r32_340134_c1_301_1131 | 276 |
| 123 | 3300054114 | Ga0501084_0034236 | Ga0501084_0034236_1077_1928 | 276 |
| 124 | 3300060353 | Ga0501082_0001295 | Ga0501082_0001295_559_1410 | 276 |
| 125 | 3300031911 | Ga0307412_10103314 | Ga0307412_101033142 | 277 |
| 126 | 3300032002 | Ga0307416_100029913 | Ga0307416_1000299134 | 277 |
| 127 | 3300046678 | Ga0495599_0044582 | Ga0495599_0044582_385_1245 | 277 |
| 128 | 3300006914 | Ga0075436_100035894 | Ga0075436_1000358943 | 278 |
| 129 | 3300031250 | Ga0265331_10053873 | Ga0265331_100538733 | 278 |
| 130 | 3300035118 | Ga0373954_0003552 | Ga0373954_0003552_3772_4635 | 278 |
| 131 | 3300046517 | Ga0495630_0041606 | Ga0495630_0041606_1565_2428 | 278 |
| 132 | 3300050514 | nmdc:mga08x19_80232_c1 | nmdc:mga08x19_80232_c1_43_900 | 278 |
| 133 | 3300005985 | Ga0081539_10001356 | Ga0081539_100013563 | 279 |
| 134 | 3300037068 | Ga0373925_0381386 | Ga0373925_0381386_198_1049 | 279 |
| 135 | 3300046476 | Ga0495662_0026795 | Ga0495662_0026795_489_1340 | 279 |
| 136 | 3300046517 | Ga0495630_0388887 | Ga0495630_0388887_85_936 | 279 |
| 137 | 3300046642 | Ga0495634_0065153 | Ga0495634_0065153_815_1666 | 279 |
| 138 | 3300046663 | Ga0495635_0055622 | Ga0495635_0055622_861_1712 | 279 |
| 139 | 3300005440 | Ga0070705_100040982 | Ga0070705_1000409823 | 280 |
| 140 | 3300005440 | Ga0070705_100087767 | Ga0070705_1000877672 | 280 |
| 141 | 3300005458 | Ga0070681_10008416 | Ga0070681_100084167 | 280 |
| 142 | 3300005530 | Ga0070679_100125321 | Ga0070679_1001253213 | 280 |
| 143 | 3300005536 | Ga0070697_100230141 | Ga0070697_1002301412 | 280 |
| 144 | 3300005545 | Ga0070695_100034745 | Ga0070695_1000347455 | 280 |
| 145 | 3300005549 | Ga0070704_100146863 | Ga0070704_1001468632 | 280 |
| 146 | 3300006173 | Ga0070716_100013965 | Ga0070716_1000139654 | 280 |
| 147 | 3300006871 | Ga0075434_100003841 | Ga0075434_1000038417 | 280 |
| 148 | 3300006871 | Ga0075434_100050282 | Ga0075434_1000502823 | 280 |
| 149 | 3300006871 | Ga0075434_100054216 | Ga0075434_1000542163 | 280 |
| 150 | 3300006914 | Ga0075436_100006269 | Ga0075436_1000062695 | 280 |
| 151 | 3300006914 | Ga0075436_100309406 | Ga0075436_1003094062 | 280 |
| 152 | 3300007076 | Ga0075435_100135010 | Ga0075435_1001350101 | 280 |
| 153 | 3300007265 | Ga0099794_10022090 | Ga0099794_100220903 | 280 |
| 154 | 3300007265 | Ga0099794_10030175 | Ga0099794_100301753 | 280 |
| 155 | 3300025910 | Ga0207684_10039529 | Ga0207684_100395293 | 280 |
| 156 | 3300025912 | Ga0207707_10006779 | Ga0207707_100067799 | 280 |
| 157 | 3300025921 | Ga0207652_10062504 | Ga0207652_100625042 | 280 |
| 158 | 3300027671 | Ga0209588_1011049 | Ga0209588_10110493 | 280 |
| 159 | 3300032002 | Ga0307416_100431419 | Ga0307416_1004314191 | 280 |
| 160 | 3300034820 | Ga0373959_0006670 | Ga0373959_0006670_810_1667 | 280 |
| 161 | 3300035092 | Ga0373952_0004181 | Ga0373952_0004181_290_1147 | 280 |
| 162 | 3300035115 | Ga0373941_0011558 | Ga0373941_0011558_394_1251 | 280 |
| 163 | 3300035118 | Ga0373954_0000292 | Ga0373954_0000292_15060_15926 | 280 |
| 164 | 3300035120 | Ga0373957_0049991 | Ga0373957_0049991_235_1101 | 280 |
| 165 | 3300035691 | Ga0373931_0125953 | Ga0373931_0125953_400_1257 | 280 |
| 166 | 3300035724 | Ga0373933_0022860 | Ga0373933_0022860_2305_3171 | 280 |
| 167 | 3300036401 | Ga0373937_0000145 | Ga0373937_0000145_23088_23954 | 280 |
| 168 | 3300042876 | Ga0451577_0146333 | Ga0451577_0146333_453_1337 | 280 |
| 169 | 3300046684 | Ga0495669_0046993 | Ga0495669_0046993_825_1685 | 280 |
| 170 | 3300048088 | Ga0495602_0177247 | Ga0495602_0177247_95_961 | 280 |
| 171 | 3300049521 | Ga0501298_007225 | Ga0501298_007225_483_1340 | 280 |
| 172 | 3300049593 | Ga0501077_0067826 | Ga0501077_0067826_563_1480 | 280 |
| 173 | 3300050512 | nmdc:mga0n895_388563_c1 | nmdc:mga0n895_388563_c1_374_1234 | 280 |
| 174 | 3300050512 | nmdc:mga0n895_3965_c1 | nmdc:mga0n895_3965_c1_3606_4469 | 280 |
| 175 | 3300050513 | nmdc:mga0rr50_50342_c1 | nmdc:mga0rr50_50342_c1_185_1045 | 280 |
| 176 | 3300050514 | nmdc:mga08x19_14411_c1 | nmdc:mga08x19_14411_c1_3238_4107 | 280 |
| 177 | 3300005345 | Ga0070692_10011019 | Ga0070692_100110195 | 281 |
| 178 | 3300005444 | Ga0070694_100001052 | Ga0070694_1000010525 | 281 |
| 179 | 3300005546 | Ga0070696_100012102 | Ga0070696_1000121022 | 281 |
| 180 | 3300005549 | Ga0070704_100003746 | Ga0070704_1000037466 | 281 |
| 181 | 3300006846 | Ga0075430_100012874 | Ga0075430_1000128746 | 281 |
| 182 | 3300006846 | Ga0075430_100341734 | Ga0075430_1003417342 | 281 |
| 183 | 3300006847 | Ga0075431_100031643 | Ga0075431_1000316432 | 281 |
| 184 | 3300006880 | Ga0075429_100027821 | Ga0075429_1000278215 | 281 |
| 185 | 3300009147 | Ga0114129_10075721 | Ga0114129_100757214 | 281 |
| 186 | 3300025917 | Ga0207660_10029057 | Ga0207660_100290573 | 281 |
| 187 | 3300027543 | Ga0209999_1006849 | Ga0209999_10068492 | 281 |
| 188 | 3300027876 | Ga0209974_10033317 | Ga0209974_100333173 | 281 |
| 189 | 3300041408 | Ga0439453_0000959 | Ga0439453_0000959_569_1414 | 281 |
| 190 | 3300042000 | Ga0439437_006466 | Ga0439437_006466_195_1040 | 281 |
| 191 | 3300042003 | Ga0439443_000211 | Ga0439443_000211_1883_2728 | 281 |
| 192 | 3300042436 | Ga0439435_0000403 | Ga0439435_0000403_3818_4663 | 281 |
| 193 | 3300042436 | Ga0439435_0000431 | Ga0439435_0000431_944_1789 | 281 |
| 194 | 3300042437 | Ga0439444_0000032 | Ga0439444_0000032_3115_3960 | 281 |
| 195 | 3300042461 | Ga0439460_0001305 | Ga0439460_0001305_3308_4153 | 281 |
| 196 | 3300042461 | Ga0439460_0004113 | Ga0439460_0004113_733_1578 | 281 |
| 197 | 3300046537 | Ga0495598_0002452 | Ga0495598_0002452_1454_2326 | 281 |
| 198 | 3300046539 | Ga0495621_0041677 | Ga0495621_0041677_465_1325 | 281 |
| 199 | 3300049572 | Ga0501036_0024987 | Ga0501036_0024987_1817_2662 | 281 |
| 200 | 3300049573 | Ga0501037_0182596 | Ga0501037_0182596_201_1046 | 281 |
| 201 | 3300049576 | Ga0501040_0073662 | Ga0501040_0073662_540_1385 | 281 |
| 202 | 3300049577 | Ga0501041_0013311 | Ga0501041_0013311_1783_2628 | 281 |
| 203 | 3300049578 | Ga0501042_0129099 | Ga0501042_0129099_858_1703 | 281 |
| 204 | 3300049578 | Ga0501042_0308986 | Ga0501042_0308986_142_987 | 281 |
| 205 | 3300049580 | Ga0501046_0058201 | Ga0501046_0058201_1295_2140 | 281 |
| 206 | 3300049584 | Ga0501068_0347311 | Ga0501068_0347311_70_915 | 281 |
| 207 | 3300049587 | Ga0501071_0010657 | Ga0501071_0010657_3744_4589 | 281 |
| 208 | 3300049588 | Ga0501072_0067866 | Ga0501072_0067866_660_1505 | 281 |
| 209 | 3300049590 | Ga0501074_0298600 | Ga0501074_0298600_92_937 | 281 |
| 210 | 3300049591 | Ga0501075_0416116 | Ga0501075_0416116_142_987 | 281 |
| 211 | 3300049592 | Ga0501076_0000978 | Ga0501076_0000978_12146_12991 | 281 |
| 212 | 3300049742 | Ga0501080_0094314 | Ga0501080_0094314_465_1310 | 281 |
| 213 | 3300049743 | Ga0501081_0057636 | Ga0501081_0057636_536_1381 | 281 |
| 214 | 3300049824 | Ga0501045_0001917 | Ga0501045_0001917_2077_2922 | 281 |
| 215 | 3300050508 | nmdc:mga09592_7869_c1 | nmdc:mga09592_7869_c1_2173_3018 | 281 |
| 216 | 3300050509 | nmdc:mga0qj67_355716_c1 | nmdc:mga0qj67_355716_c1_156_1001 | 281 |
| 217 | 3300050509 | nmdc:mga0qj67_72454_c1 | nmdc:mga0qj67_72454_c1_730_1575 | 281 |
| 218 | 3300050510 | nmdc:mga06r32_93929_c1 | nmdc:mga06r32_93929_c1_1530_2375 | 281 |
| 219 | 3300054114 | Ga0501084_0026967 | Ga0501084_0026967_2246_3091 | 281 |
| 220 | 3300060353 | Ga0501082_0650712 | Ga0501082_0650712_25_870 | 281 |
| 221 | 3300061734 | Ga0530510_0003896 | Ga0530510_0003896_1867_2712 | 281 |
| 222 | 3300047318 | Ga0495636_0109799 | Ga0495636_0109799_228_1082 | 284 |
| 223 | 3300005336 | Ga0070680_100029866 | Ga0070680_1000298667 | 285 |
| 224 | 3300006846 | Ga0075430_100009348 | Ga0075430_10000934810 | 285 |
| 225 | 3300025917 | Ga0207660_10103755 | Ga0207660_101037553 | 285 |
| 226 | 3300049660 | Ga0501216_013387 | Ga0501216_013387_292_1149 | 285 |
| 227 | 3300050509 | nmdc:mga0qj67_7863_c1 | nmdc:mga0qj67_7863_c1_464_1321 | 285 |
| 228 | 3300005295 | Ga0065707_10181442 | Ga0065707_101814422 | 286 |
| 229 | 3300005328 | Ga0070676_10040320 | Ga0070676_100403203 | 286 |
| 230 | 3300005334 | Ga0068869_100068394 | Ga0068869_1000683943 | 286 |
| 231 | 3300005340 | Ga0070689_100027499 | Ga0070689_1000274996 | 286 |
| 232 | 3300005341 | Ga0070691_10129179 | Ga0070691_101291791 | 286 |
| 233 | 3300005345 | Ga0070692_10012971 | Ga0070692_100129714 | 286 |
| 234 | 3300005353 | Ga0070669_100002754 | Ga0070669_1000027547 | 286 |
| 235 | 3300005354 | Ga0070675_100013844 | Ga0070675_1000138446 | 286 |
| 236 | 3300005356 | Ga0070674_100172358 | Ga0070674_1001723582 | 286 |
| 237 | 3300005364 | Ga0070673_100370566 | Ga0070673_1003705661 | 286 |
| 238 | 3300005438 | Ga0070701_10197925 | Ga0070701_101979252 | 286 |
| 239 | 3300005441 | Ga0070700_100000940 | Ga0070700_10000094013 | 286 |
| 240 | 3300005441 | Ga0070700_100178596 | Ga0070700_1001785962 | 286 |
| 241 | 3300005459 | Ga0068867_100000199 | Ga0068867_10000019921 | 286 |
| 242 | 3300005459 | Ga0068867_100489776 | Ga0068867_1004897761 | 286 |
| 243 | 3300005719 | Ga0068861_100003974 | Ga0068861_1000039745 | 286 |
| 244 | 3300005719 | Ga0068861_100148045 | Ga0068861_1001480452 | 286 |
| 245 | 3300005844 | Ga0068862_100001087 | Ga0068862_1000010878 | 286 |
| 246 | 3300006844 | Ga0075428_100181009 | Ga0075428_1001810093 | 286 |
| 247 | 3300006881 | Ga0068865_100143114 | Ga0068865_1001431142 | 286 |
| 248 | 3300009094 | Ga0111539_10024558 | Ga0111539_100245584 | 286 |
| 249 | 3300009094 | Ga0111539_10067971 | Ga0111539_100679717 | 286 |
| 250 | 3300009094 | Ga0111539_10137905 | Ga0111539_101379053 | 286 |
| 251 | 3300009148 | Ga0105243_10006579 | Ga0105243_100065798 | 286 |
| 252 | 3300009148 | Ga0105243_10239592 | Ga0105243_102395921 | 286 |
| 253 | 3300009553 | Ga0105249_10000940 | Ga0105249_1000094018 | 286 |
| 254 | 3300013306 | Ga0163162_10136355 | Ga0163162_101363553 | 286 |
| 255 | 3300013308 | Ga0157375_10487574 | Ga0157375_104875742 | 286 |
| 256 | 3300014326 | Ga0157380_10001346 | Ga0157380_100013469 | 286 |
| 257 | 3300014745 | Ga0157377_10040578 | Ga0157377_100405783 | 286 |
| 258 | 3300017792 | Ga0163161_10517968 | Ga0163161_105179681 | 286 |
| 259 | 3300025908 | Ga0207643_10010340 | Ga0207643_100103404 | 286 |
| 260 | 3300025917 | Ga0207660_10113153 | Ga0207660_101131533 | 286 |
| 261 | 3300025918 | Ga0207662_10017638 | Ga0207662_100176383 | 286 |
| 262 | 3300025923 | Ga0207681_10002198 | Ga0207681_100021987 | 286 |
| 263 | 3300025926 | Ga0207659_10230607 | Ga0207659_102306071 | 286 |
| 264 | 3300025935 | Ga0207709_10002718 | Ga0207709_100027186 | 286 |
| 265 | 3300025937 | Ga0207669_10137729 | Ga0207669_101377292 | 286 |
| 266 | 3300025938 | Ga0207704_10003917 | Ga0207704_100039176 | 286 |
| 267 | 3300025940 | Ga0207691_10292150 | Ga0207691_102921502 | 286 |
| 268 | 3300025942 | Ga0207689_10012214 | Ga0207689_100122145 | 286 |
| 269 | 3300025960 | Ga0207651_10059892 | Ga0207651_100598922 | 286 |
| 270 | 3300025961 | Ga0207712_10007878 | Ga0207712_100078786 | 286 |
| 271 | 3300025972 | Ga0207668_10087937 | Ga0207668_100879372 | 286 |
| 272 | 3300026075 | Ga0207708_10012340 | Ga0207708_100123407 | 286 |
| 273 | 3300026075 | Ga0207708_10175058 | Ga0207708_101750583 | 286 |
| 274 | 3300026075 | Ga0207708_10195470 | Ga0207708_101954702 | 286 |
| 275 | 3300026089 | Ga0207648_10000242 | Ga0207648_100002428 | 286 |
| 276 | 3300026089 | Ga0207648_10072578 | Ga0207648_100725784 | 286 |
| 277 | 3300026118 | Ga0207675_100001245 | Ga0207675_10000124517 | 286 |
| 278 | 3300026118 | Ga0207675_100145755 | Ga0207675_1001457552 | 286 |
| 279 | 3300027360 | Ga0209969_1001400 | Ga0209969_10014005 | 286 |
| 280 | 3300027907 | Ga0207428_10015387 | Ga0207428_100153875 | 286 |
| 281 | 3300027907 | Ga0207428_10068569 | Ga0207428_100685693 | 286 |
| 282 | 3300027907 | Ga0207428_10132974 | Ga0207428_101329743 | 286 |
| 283 | 3300028380 | Ga0268265_10001954 | Ga0268265_100019549 | 286 |
| 284 | 3300028381 | Ga0268264_10364574 | Ga0268264_103645741 | 286 |
| 285 | 3300031995 | Ga0307409_100320304 | Ga0307409_1003203042 | 286 |
| 286 | 3300046537 | Ga0495598_0036999 | Ga0495598_0036999_286_1146 | 286 |
| 287 | 3300046539 | Ga0495621_0005757 | Ga0495621_0005757_1933_2802 | 286 |
| 288 | 3300050508 | nmdc:mga09592_214564_c1 | nmdc:mga09592_214564_c1_24_884 | 286 |
| 289 | 3300050510 | nmdc:mga06r32_712543_c1 | nmdc:mga06r32_712543_c1_94_954 | 286 |
| 290 | 3300050511 | nmdc:mga08y16_25321_c1 | nmdc:mga08y16_25321_c1_3273_4133 | 286 |
| 291 | 3300050511 | nmdc:mga08y16_26487_c1 | nmdc:mga08y16_26487_c1_1855_2715 | 286 |
| 292 | 3300050511 | nmdc:mga08y16_74960_c1 | nmdc:mga08y16_74960_c1_913_1773 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jek-assembly1.cif.gz_C | cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.9022 | 28 | 285 |
| 8gy2-assembly1.cif.gz_B | cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans | 0.8717 | 26 | 286 |
| 7w2j-assembly1.cif.gz_C | cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.8715 | 28 | 285 |
| 8gy3-assembly1.cif.gz_A | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.8174 | 6 | 277 |
| 8jek-assembly1.cif.gz_C | cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.8154 | 28 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h9yB01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.68 | 176 | 281 | 1.10.760.10 |
| 1hzuA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6579 | 168 | 282 | 1.10.760.10 |
| 1h9yB01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6543 | 176 | 281 | 1.10.760.10 |
| 1cnoH00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6364 | 24 | 134 | 1.10.760.10 |
| 2zzs300 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6346 | 174 | 278 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9MFQ3-F1-model_v4 | Cytochrome C | 0.947 | 58 | 282 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2P9HE99-F1-model_v4 | Diheme cytochrome c-553 | 0.9412 | 73 | 281 |
GO:0005506
GO:0005886 GO:0009055 GO:0016614 GO:0020037 |
| AF-A0A2S6U5M7-F1-model_v4 | Fructose dehydrogenase cytochrome subunit | 0.941 | 23 | 283 |
GO:0005506
GO:0009055 GO:0020037 GO:0022900 |
| AF-A0A3S0GMW2-F1-model_v4 | deleted | 0.9392 | 80 | 284 |
|
| AF-A0A7C7U4H0-F1-model_v4 | Cytochrome C | 0.9389 | 26 | 284 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar