F391190

General Info

Members Datasets Scaffolds Average Seq Length
292 177 292 280

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0067826|Ga0501077_0067826_563_1480
Length 305
Sequence VRRLPRQVPGEAISRSRAAGSSPAAAGLFIFCLLVAPLAALAQGDAKRGEYLAKAGGCVGCHTEAREGATPFAGGRALKTPFGTFYGPNITPHPQAGIGRWSEADFARALHEGVRPDGAHYYPAFPYTSFTRIADADVRDLWAYMRSLPPSAQPSRPHELGLLYRARFTLGIWKWLFFEPGRFVADSQKSASVNRGAYLVQALGHCGECHTPRNFLGGTKKDRFLAGGKLPDGGSAPNLTPTRLKDWSDGELRDVLSSGLLPDGDVLGETMGEVVRNTTSQLTPEDLAALIAYLRALPPLPSEPK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
97 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
98 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
101 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
102 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10181442 3300005295 Bacteria 1416
2 Ga0070676_10040320 3300005328 Bacteria 2704
3 Ga0068869_100068394 3300005334 Bacteria 2623
4 Ga0070680_100029866 3300005336 Bacteria 4376
5 Ga0070689_100027499 3300005340 Bacteria 4288
6 Ga0070691_10129179 3300005341 Bacteria 1279
7 Ga0070692_10011019 3300005345 Bacteria 4139
8 Ga0070692_10012971 3300005345 Bacteria 3874
9 Ga0070669_100002754 3300005353 Bacteria 12681
10 Ga0070675_100013844 3300005354 Bacteria 6350
11 Ga0070674_100172358 3300005356 Bacteria 1651
12 Ga0070673_100370566 3300005364 Bacteria 1275
13 Ga0070701_10197925 3300005438 Bacteria 1186
14 Ga0070705_100003370 3300005440 Bacteria 7842
15 Ga0070705_100040982 3300005440 Bacteria 2637
16 Ga0070705_100087767 3300005440 Bacteria 1929
17 Ga0070700_100000940 3300005441 Bacteria 14379
18 Ga0070700_100178596 3300005441 Bacteria 1475
19 Ga0070694_100001052 3300005444 Bacteria 15766
20 Ga0070681_10008416 3300005458 Bacteria 10104
21 Ga0068867_100000199 3300005459 Bacteria 39822
22 Ga0068867_100489776 3300005459 Bacteria 1055
23 Ga0070706_100164500 3300005467 Bacteria 2072
24 Ga0070679_100125321 3300005530 Unclassified 2551
25 Ga0070697_100230141 3300005536 Bacteria 1581
26 Ga0070695_100034745 3300005545 Bacteria 3163
27 Ga0070696_100012102 3300005546 Bacteria 5781
28 Ga0070704_100003746 3300005549 Bacteria 8751
29 Ga0070704_100012071 3300005549 Bacteria 5326
30 Ga0070704_100146863 3300005549 Bacteria 1849
31 Ga0068861_100003974 3300005719 Bacteria 9902
32 Ga0068861_100148045 3300005719 Bacteria 1924
33 Ga0068862_100001087 3300005844 Bacteria 25912
34 Ga0081539_10001356 3300005985 Bacteria 42605
35 Ga0070716_100013965 3300006173 Bacteria 4107
36 Ga0075428_100103296 3300006844 Bacteria 3108
37 Ga0075428_100181009 3300006844 Bacteria 2281
38 Ga0075430_100009348 3300006846 Bacteria 8285
39 Ga0075430_100012171 3300006846 Bacteria 7325
40 Ga0075430_100012874 3300006846 Bacteria 7128
41 Ga0075430_100341734 3300006846 Bacteria 1236
42 Ga0075431_100031643 3300006847 Bacteria 5449
43 Ga0075431_100031781 3300006847 Bacteria 5438
44 Ga0075431_100144200 3300006847 Bacteria 2454
45 Ga0075433_10047299 3300006852 Bacteria 3742
46 Ga0075433_10250852 3300006852 Bacteria 1570
47 Ga0075434_100003841 3300006871 Bacteria 13427
48 Ga0075434_100050282 3300006871 Bacteria 4140
49 Ga0075434_100054216 3300006871 Bacteria 3984
50 Ga0075434_100229886 3300006871 Bacteria 1874
51 Ga0075429_100027821 3300006880 Bacteria 4908
52 Ga0068865_100143114 3300006881 Bacteria 1805
53 Ga0075436_100006269 3300006914 Bacteria 8148
54 Ga0075436_100010372 3300006914 Bacteria 6383
55 Ga0075436_100035894 3300006914 Bacteria 3420
56 Ga0075436_100309406 3300006914 Bacteria 1133
57 Ga0075435_100018626 3300007076 Bacteria 5288
58 Ga0075435_100135010 3300007076 Bacteria 2066
59 Ga0099794_10022090 3300007265 Bacteria 2898
60 Ga0099794_10030175 3300007265 Bacteria 2530
61 Ga0099795_10032462 3300007788 Bacteria 1806
62 Ga0111539_10024558 3300009094 Bacteria 7393
63 Ga0111539_10067971 3300009094 Bacteria 4207
64 Ga0111539_10137905 3300009094 Bacteria 2857
65 Ga0114129_10012415 3300009147 Bacteria 12125
66 Ga0114129_10075721 3300009147 Bacteria 4686
67 Ga0105243_10006579 3300009148 Bacteria 8980
68 Ga0105243_10239592 3300009148 Bacteria 1613
69 Ga0105249_10000940 3300009553 Bacteria 25776
70 Ga0163162_10136355 3300013306 Bacteria 2565
71 Ga0157375_10487574 3300013308 Bacteria 1397
72 Ga0157380_10001346 3300014326 Bacteria 15990
73 Ga0157377_10040578 3300014745 Bacteria 2578
74 Ga0163161_10517968 3300017792 Bacteria 973
75 Ga0207643_10010340 3300025908 Bacteria 5024
76 Ga0207684_10039529 3300025910 Bacteria 4001
77 Ga0207707_10006779 3300025912 Bacteria 9994
78 Ga0207660_10029057 3300025917 Bacteria 3788
79 Ga0207660_10103755 3300025917 Bacteria 2128
80 Ga0207660_10113153 3300025917 Bacteria 2045
81 Ga0207662_10017638 3300025918 Bacteria 4040
82 Ga0207652_10062504 3300025921 Unclassified 3218
83 Ga0207681_10002198 3300025923 Bacteria 12440
84 Ga0207659_10230607 3300025926 Bacteria 1493
85 Ga0207709_10002718 3300025935 Bacteria 10931
86 Ga0207669_10137729 3300025937 Bacteria 1689
87 Ga0207704_10003917 3300025938 Bacteria 6767
88 Ga0207691_10292150 3300025940 Bacteria 1401
89 Ga0207689_10012214 3300025942 Bacteria 7347
90 Ga0207651_10059892 3300025960 Bacteria 2640
91 Ga0207712_10007878 3300025961 Bacteria 6734
92 Ga0207668_10087937 3300025972 Bacteria 2274
93 Ga0207708_10012340 3300026075 Bacteria 6368
94 Ga0207708_10175058 3300026075 Bacteria 1701
95 Ga0207708_10195470 3300026075 Bacteria 1612
96 Ga0207648_10000242 3300026089 Bacteria 58883
97 Ga0207648_10072578 3300026089 Bacteria 2999
98 Ga0207675_100001245 3300026118 Bacteria 25404
99 Ga0207675_100145755 3300026118 Bacteria 2251
100 Ga0209969_1001400 3300027360 Bacteria 3313
101 Ga0209179_1002444 3300027512 Bacteria 2513
102 Ga0209999_1006849 3300027543 Bacteria 2051
103 Ga0209588_1011049 3300027671 Bacteria 2722
104 Ga0209974_10033317 3300027876 Bacteria 1709
105 Ga0207428_10015387 3300027907 Bacteria 6618
106 Ga0207428_10068569 3300027907 Bacteria 2789
107 Ga0207428_10132974 3300027907 Bacteria 1903
108 Ga0268265_10001954 3300028380 Bacteria 16362
109 Ga0268264_10364574 3300028381 Bacteria 1379
110 Ga0265331_10053873 3300031250 Bacteria 1917
111 Ga0307412_10103314 3300031911 Bacteria 2020
112 Ga0307409_100320304 3300031995 Bacteria 1451
113 Ga0307416_100029913 3300032002 Bacteria 4078
114 Ga0307416_100431419 3300032002 Bacteria 1365
115 Ga0373959_0006670 3300034820 Bacteria 1925
116 Ga0373934_0031522 3300035086 Bacteria 2076
117 Ga0373934_0031970 3300035086 Bacteria 2062
118 Ga0373952_0004181 3300035092 Bacteria 2608
119 Ga0373936_0031958 3300035113 Bacteria 2080
120 Ga0373941_0011558 3300035115 Bacteria 2284
121 Ga0373953_0011064 3300035117 Bacteria 3154
122 Ga0373954_0000292 3300035118 Bacteria 18103
123 Ga0373954_0003552 3300035118 Bacteria 6626
124 Ga0373956_0008457 3300035119 Bacteria 4166
125 Ga0373957_0045931 3300035120 Bacteria 1656
126 Ga0373957_0049991 3300035120 Bacteria 1597
127 Ga0373957_0121744 3300035120 Bacteria 1056
128 Ga0373955_0095939 3300035172 Bacteria 1696
129 Ga0373924_0034692 3300035410 Bacteria 2043
130 Ga0373931_0125953 3300035691 Bacteria 1469
131 Ga0373935_0037873 3300035692 Bacteria 3018
132 Ga0373933_0022860 3300035724 Bacteria 3565
133 Ga0373933_0147428 3300035724 Bacteria 1488
134 Ga0373947_0328491 3300035725 Bacteria 1024
135 Ga0373937_0000145 3300036401 Bacteria 68629
136 Ga0373937_0046718 3300036401 Bacteria 3959
137 Ga0373925_0366054 3300037068 Bacteria 1172
138 Ga0373925_0381386 3300037068 Bacteria 1148
139 Ga0439453_0000959 3300041408 Bacteria 3491
140 Ga0439437_006466 3300042000 Bacteria 1298
141 Ga0439443_000211 3300042003 Bacteria 4391
142 Ga0439435_0000403 3300042436 Bacteria 6682
143 Ga0439435_0000431 3300042436 Bacteria 6563
144 Ga0439444_0000032 3300042437 Bacteria 10072
145 Ga0439460_0001305 3300042461 Bacteria 5853
146 Ga0439460_0004113 3300042461 Bacteria 3537
147 Ga0450893_0024904 3300042532 Bacteria 1046
148 Ga0451577_0146333 3300042876 Bacteria 2125
149 Ga0466957_0042644 3300044842 Bacteria 2746
150 Ga0466967_0002691 3300045976 Bacteria 11224
151 Ga0495592_0004302 3300046454 Bacteria 10412
152 Ga0495592_0015388 3300046454 Bacteria 5802
153 Ga0495651_0044186 3300046462 Bacteria 3453
154 Ga0495653_0029917 3300046463 Bacteria 4340
155 Ga0495580_0252370 3300046472 Bacteria 1207
156 Ga0495639_0148873 3300046475 Bacteria 1128
157 Ga0495662_0016269 3300046476 Bacteria 3605
158 Ga0495662_0026795 3300046476 Bacteria 2784
159 Ga0495664_0087151 3300046477 Bacteria 1875
160 Ga0495618_0103956 3300046514 Bacteria 1818
161 Ga0495618_0192551 3300046514 Bacteria 1292
162 Ga0495628_0005207 3300046516 Bacteria 11415
163 Ga0495628_0035537 3300046516 Bacteria 4003
164 Ga0495628_0061981 3300046516 Bacteria 2932
165 Ga0495630_0004891 3300046517 Bacteria 9413
166 Ga0495630_0041606 3300046517 Bacteria 3432
167 Ga0495630_0388887 3300046517 Bacteria 1068
168 Ga0495666_0006855 3300046526 Bacteria 5720
169 Ga0495652_0023616 3300046529 Bacteria 5450
170 Ga0495652_0074789 3300046529 Bacteria 2816
171 Ga0495652_0290032 3300046529 Bacteria 1194
172 Ga0495665_0061106 3300046531 Bacteria 1989
173 Ga0495586_0020354 3300046535 Bacteria 3533
174 Ga0495587_0076883 3300046536 Bacteria 1938
175 Ga0495598_0002452 3300046537 Bacteria 3836
176 Ga0495598_0036999 3300046537 Bacteria 1406
177 Ga0495621_0005757 3300046539 Bacteria 3582
178 Ga0495621_0041677 3300046539 Bacteria 1613
179 Ga0495645_0000044 3300046543 Bacteria 90950
180 Ga0495667_0082916 3300046559 Bacteria 2082
181 Ga0495634_0065153 3300046642 Bacteria 2415
182 Ga0495635_0018422 3300046663 Bacteria 4872
183 Ga0495635_0055622 3300046663 Bacteria 2726
184 Ga0495599_0001611 3300046678 Bacteria 13003
185 Ga0495599_0044582 3300046678 Bacteria 2782
186 Ga0495599_0055994 3300046678 Bacteria 2467
187 Ga0495647_0023685 3300046681 Bacteria 2228
188 Ga0495658_0053208 3300046683 Bacteria 2298
189 Ga0495669_0046993 3300046684 Bacteria 1927
190 Ga0495613_0057965 3300046689 Bacteria 2843
191 Ga0495624_0064830 3300046690 Bacteria 2283
192 Ga0495600_0074976 3300046809 Bacteria 2209
193 Ga0495604_0073358 3300047317 Bacteria 2583
194 Ga0495636_0109799 3300047318 Bacteria 1213
195 Ga0495674_0008982 3300047319 Bacteria 9496
196 Ga0495675_0006190 3300047444 Bacteria 7323
197 Ga0495602_0177247 3300048088 Bacteria 1648
198 Ga0501298_007184 3300049521 Bacteria 1843
199 Ga0501298_007225 3300049521 Bacteria 1838
200 Ga0501036_0024987 3300049572 Bacteria 5039
201 Ga0501036_0433247 3300049572 Bacteria 1096
202 Ga0501037_0182596 3300049573 Bacteria 1488
203 Ga0501037_0241706 3300049573 Bacteria 1265
204 Ga0501039_0002475 3300049575 Bacteria 13754
205 Ga0501039_0078739 3300049575 Bacteria 2564
206 Ga0501039_0109384 3300049575 Bacteria 2160
207 Ga0501040_0073662 3300049576 Bacteria 2360
208 Ga0501041_0001554 3300049577 Bacteria 12778
209 Ga0501041_0013311 3300049577 Bacteria 4875
210 Ga0501041_0020073 3300049577 Bacteria 3991
211 Ga0501041_0066994 3300049577 Bacteria 2201
212 Ga0501042_0015307 3300049578 Bacteria 5251
213 Ga0501042_0045145 3300049578 Bacteria 3141
214 Ga0501042_0129099 3300049578 Bacteria 1821
215 Ga0501042_0308986 3300049578 Bacteria 1142
216 Ga0501046_0023379 3300049580 Bacteria 5086
217 Ga0501046_0058201 3300049580 Bacteria 3030
218 Ga0501046_0068227 3300049580 Bacteria 2768
219 Ga0501048_0211730 3300049582 Bacteria 1375
220 Ga0501068_0037892 3300049584 Bacteria 2887
221 Ga0501068_0347311 3300049584 Bacteria 953
222 Ga0501071_0001043 3300049587 Bacteria 15345
223 Ga0501071_0010657 3300049587 Bacteria 6166
224 Ga0501071_0017580 3300049587 Bacteria 4935
225 Ga0501071_0019675 3300049587 Bacteria 4686
226 Ga0501072_0005925 3300049588 Bacteria 9312
227 Ga0501072_0067866 3300049588 Bacteria 2814
228 Ga0501072_0071187 3300049588 Bacteria 2747
229 Ga0501072_0472976 3300049588 Bacteria 992
230 Ga0501073_0306051 3300049589 Bacteria 1096
231 Ga0501074_0085306 3300049590 Bacteria 2263
232 Ga0501074_0298600 3300049590 Bacteria 1144
233 Ga0501074_0427341 3300049590 Bacteria 939
234 Ga0501075_0001389 3300049591 Bacteria 15748
235 Ga0501075_0024466 3300049591 Bacteria 4429
236 Ga0501075_0034433 3300049591 Bacteria 3771
237 Ga0501075_0416116 3300049591 Bacteria 1025
238 Ga0501076_0000978 3300049592 Bacteria 18726
239 Ga0501076_0003088 3300049592 Bacteria 11602
240 Ga0501076_0062670 3300049592 Bacteria 2962
241 Ga0501077_0014116 3300049593 Bacteria 5013
242 Ga0501077_0067826 3300049593 Bacteria 2262
243 Ga0501077_0077899 3300049593 Bacteria 2100
244 Ga0501216_013387 3300049660 Bacteria 1360
245 Ga0501217_012508 3300049661 Bacteria 1892
246 Ga0501079_0009554 3300049741 Bacteria 7353
247 Ga0501079_0168823 3300049741 Bacteria 1706
248 Ga0501080_0004298 3300049742 Bacteria 12649
249 Ga0501080_0012969 3300049742 Bacteria 7651
250 Ga0501080_0014278 3300049742 Bacteria 7316
251 Ga0501080_0094314 3300049742 Bacteria 2779
252 Ga0501081_0057636 3300049743 Bacteria 2686
253 Ga0501083_0015981 3300049744 Bacteria 5256
254 Ga0501083_0102688 3300049744 Bacteria 1885
255 Ga0501035_0150761 3300049822 Bacteria 2018
256 Ga0501045_0001917 3300049824 Bacteria 14057
257 Ga0501045_0004750 3300049824 Bacteria 9380
258 nmdc:mga09592_214564_c1 3300050508 Bacteria 1668
259 nmdc:mga09592_7869_c1 3300050508 Bacteria 8665
260 nmdc:mga0qj67_355716_c1 3300050509 Unclassified 1184
261 nmdc:mga0qj67_37631_c1 3300050509 Bacteria 3792
262 nmdc:mga0qj67_72454_c1 3300050509 Bacteria 2751
263 nmdc:mga0qj67_7863_c1 3300050509 Bacteria 7878
264 nmdc:mga06r32_340134_c1 3300050510 Bacteria 1485
265 nmdc:mga06r32_712543_c1 3300050510 Bacteria 969
266 nmdc:mga06r32_93929_c1 3300050510 Bacteria 2935
267 nmdc:mga08y16_25321_c1 3300050511 Bacteria 6256
268 nmdc:mga08y16_26487_c1 3300050511 Bacteria 6113
269 nmdc:mga08y16_74960_c1 3300050511 Bacteria 3527
270 nmdc:mga0n895_388563_c1 3300050512 Bacteria 1412
271 nmdc:mga0n895_3965_c1 3300050512 Bacteria 12033
272 nmdc:mga0n895_68358_c1 3300050512 Bacteria 3519
273 nmdc:mga0rr50_12330_c1 3300050513 Bacteria 5520
274 nmdc:mga0rr50_50342_c1 3300050513 Bacteria 3086
275 nmdc:mga08x19_102697_c1 3300050514 Bacteria 1899
276 nmdc:mga08x19_14411_c1 3300050514 Bacteria 4793
277 nmdc:mga08x19_25422_c1 3300050514 Bacteria 3688
278 nmdc:mga08x19_54061_c1 3300050514 Bacteria 2584
279 nmdc:mga08x19_80232_c1 3300050514 Bacteria 2141
280 nmdc:mga0a205_32315_c1 3300050515 Bacteria 5018
281 Ga0495601_0002996 3300053077 Bacteria 9619
282 Ga0495601_0080173 3300053077 Bacteria 2094
283 Ga0495612_0073256 3300053078 Bacteria 1431
284 Ga0495619_0029288 3300053085 Bacteria 3556
285 Ga0501084_0026967 3300054114 Bacteria 4800
286 Ga0501084_0034236 3300054114 Bacteria 4248
287 Ga0501084_0061697 3300054114 Bacteria 3139
288 Ga0501082_0001295 3300060353 Bacteria 21925
289 Ga0501082_0073980 3300060353 Bacteria 2934
290 Ga0501082_0650712 3300060353 Bacteria 922
291 Ga0530510_0003896 3300061734 Bacteria 10292
292 Ga0530510_0004440 3300061734 Bacteria 9712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100164500 Ga0070706_1001645001 252
2 3300035119 Ga0373956_0008457 Ga0373956_0008457_1987_2844 255
3 3300035120 Ga0373957_0121744 Ga0373957_0121744_137_994 255
4 3300035172 Ga0373955_0095939 Ga0373955_0095939_752_1609 255
5 3300036401 Ga0373937_0046718 Ga0373937_0046718_2129_2986 255
6 3300046454 Ga0495592_0004302 Ga0495592_0004302_861_1712 255
7 3300046514 Ga0495618_0192551 Ga0495618_0192551_157_1014 255
8 3300046516 Ga0495628_0005207 Ga0495628_0005207_4348_5199 255
9 3300046529 Ga0495652_0023616 Ga0495652_0023616_3942_4793 255
10 3300046535 Ga0495586_0020354 Ga0495586_0020354_2562_3419 255
11 3300046543 Ga0495645_0000044 Ga0495645_0000044_71256_72107 255
12 3300046559 Ga0495667_0082916 Ga0495667_0082916_115_972 255
13 3300046678 Ga0495599_0001611 Ga0495599_0001611_10398_11249 255
14 3300006871 Ga0075434_100229886 Ga0075434_1002298863 256
15 3300050512 nmdc:mga0n895_68358_c1 nmdc:mga0n895_68358_c1_2374_3234 256
16 3300050514 nmdc:mga08x19_25422_c1 nmdc:mga08x19_25422_c1_918_1778 256
17 3300046516 Ga0495628_0035537 Ga0495628_0035537_2718_3569 259
18 3300046529 Ga0495652_0290032 Ga0495652_0290032_84_935 259
19 3300053077 Ga0495601_0002996 Ga0495601_0002996_1753_2604 259
20 3300035086 Ga0373934_0031522 Ga0373934_0031522_1153_1992 260
21 3300005440 Ga0070705_100003370 Ga0070705_1000033708 261
22 3300006852 Ga0075433_10250852 Ga0075433_102508522 261
23 3300007788 Ga0099795_10032462 Ga0099795_100324623 262
24 3300027512 Ga0209179_1002444 Ga0209179_10024442 262
25 3300035725 Ga0373947_0328491 Ga0373947_0328491_112_972 262
26 3300049573 Ga0501037_0241706 Ga0501037_0241706_405_1217 265
27 3300049575 Ga0501039_0109384 Ga0501039_0109384_1176_1988 265
28 3300049577 Ga0501041_0001554 Ga0501041_0001554_1926_2738 265
29 3300049578 Ga0501042_0015307 Ga0501042_0015307_1106_1918 265
30 3300049580 Ga0501046_0068227 Ga0501046_0068227_998_1810 265
31 3300049584 Ga0501068_0037892 Ga0501068_0037892_255_1067 265
32 3300049587 Ga0501071_0017580 Ga0501071_0017580_2205_3017 265
33 3300049589 Ga0501073_0306051 Ga0501073_0306051_195_1007 265
34 3300049590 Ga0501074_0085306 Ga0501074_0085306_366_1178 265
35 3300049591 Ga0501075_0001389 Ga0501075_0001389_45_857 265
36 3300049592 Ga0501076_0003088 Ga0501076_0003088_6915_7727 265
37 3300049593 Ga0501077_0077899 Ga0501077_0077899_800_1612 265
38 3300049742 Ga0501080_0012969 Ga0501080_0012969_6232_7044 265
39 3300049824 Ga0501045_0004750 Ga0501045_0004750_45_857 265
40 3300054114 Ga0501084_0061697 Ga0501084_0061697_13_825 265
41 3300061734 Ga0530510_0004440 Ga0530510_0004440_2021_2833 265
42 3300005549 Ga0070704_100012071 Ga0070704_1000120713 267
43 3300009147 Ga0114129_10012415 Ga0114129_100124155 267
44 3300035086 Ga0373934_0031970 Ga0373934_0031970_1021_1878 267
45 3300035113 Ga0373936_0031958 Ga0373936_0031958_582_1439 267
46 3300035117 Ga0373953_0011064 Ga0373953_0011064_145_1002 267
47 3300035120 Ga0373957_0045931 Ga0373957_0045931_771_1628 267
48 3300035410 Ga0373924_0034692 Ga0373924_0034692_868_1725 267
49 3300035692 Ga0373935_0037873 Ga0373935_0037873_2121_2978 267
50 3300035724 Ga0373933_0147428 Ga0373933_0147428_114_971 267
51 3300037068 Ga0373925_0366054 Ga0373925_0366054_187_1044 267
52 3300046454 Ga0495592_0015388 Ga0495592_0015388_1937_2794 267
53 3300046462 Ga0495651_0044186 Ga0495651_0044186_920_1777 267
54 3300046463 Ga0495653_0029917 Ga0495653_0029917_2738_3595 267
55 3300046472 Ga0495580_0252370 Ga0495580_0252370_71_928 267
56 3300046475 Ga0495639_0148873 Ga0495639_0148873_48_905 267
57 3300046476 Ga0495662_0016269 Ga0495662_0016269_1036_1893 267
58 3300046477 Ga0495664_0087151 Ga0495664_0087151_755_1612 267
59 3300046514 Ga0495618_0103956 Ga0495618_0103956_93_950 267
60 3300046516 Ga0495628_0061981 Ga0495628_0061981_330_1187 267
61 3300046517 Ga0495630_0004891 Ga0495630_0004891_5022_5879 267
62 3300046526 Ga0495666_0006855 Ga0495666_0006855_619_1476 267
63 3300046529 Ga0495652_0074789 Ga0495652_0074789_1763_2620 267
64 3300046531 Ga0495665_0061106 Ga0495665_0061106_635_1492 267
65 3300046536 Ga0495587_0076883 Ga0495587_0076883_777_1634 267
66 3300046663 Ga0495635_0018422 Ga0495635_0018422_2414_3271 267
67 3300046678 Ga0495599_0055994 Ga0495599_0055994_1203_2060 267
68 3300046681 Ga0495647_0023685 Ga0495647_0023685_546_1403 267
69 3300046683 Ga0495658_0053208 Ga0495658_0053208_373_1230 267
70 3300046689 Ga0495613_0057965 Ga0495613_0057965_374_1231 267
71 3300046690 Ga0495624_0064830 Ga0495624_0064830_1021_1878 267
72 3300046809 Ga0495600_0074976 Ga0495600_0074976_860_1717 267
73 3300047317 Ga0495604_0073358 Ga0495604_0073358_742_1599 267
74 3300047319 Ga0495674_0008982 Ga0495674_0008982_5745_6602 267
75 3300047444 Ga0495675_0006190 Ga0495675_0006190_2873_3730 267
76 3300053077 Ga0495601_0080173 Ga0495601_0080173_985_1842 267
77 3300053078 Ga0495612_0073256 Ga0495612_0073256_47_904 267
78 3300053085 Ga0495619_0029288 Ga0495619_0029288_1954_2811 267
79 3300044842 Ga0466957_0042644 Ga0466957_0042644_1358_2185 268
80 3300045976 Ga0466967_0002691 Ga0466967_0002691_6330_7157 268
81 3300049521 Ga0501298_007184 Ga0501298_007184_799_1620 268
82 3300049577 Ga0501041_0066994 Ga0501041_0066994_235_1065 268
83 3300049587 Ga0501071_0001043 Ga0501071_0001043_771_1601 268
84 3300049588 Ga0501072_0071187 Ga0501072_0071187_19_849 268
85 3300049590 Ga0501074_0427341 Ga0501074_0427341_89_919 268
86 3300049591 Ga0501075_0024466 Ga0501075_0024466_1827_2657 268
87 3300049592 Ga0501076_0062670 Ga0501076_0062670_1608_2438 268
88 3300049661 Ga0501217_012508 Ga0501217_012508_224_1045 268
89 3300049741 Ga0501079_0168823 Ga0501079_0168823_342_1172 268
90 3300049742 Ga0501080_0004298 Ga0501080_0004298_130_960 268
91 3300049744 Ga0501083_0102688 Ga0501083_0102688_132_962 268
92 3300060353 Ga0501082_0073980 Ga0501082_0073980_1858_2688 268
93 3300042532 Ga0450893_0024904 Ga0450893_0024904_219_1031 270
94 3300049572 Ga0501036_0433247 Ga0501036_0433247_225_1040 271
95 3300049575 Ga0501039_0078739 Ga0501039_0078739_196_1011 271
96 3300049582 Ga0501048_0211730 Ga0501048_0211730_264_1079 271
97 3300049588 Ga0501072_0472976 Ga0501072_0472976_84_899 271
98 3300050514 nmdc:mga08x19_54061_c1 nmdc:mga08x19_54061_c1_1234_2088 271
99 3300006852 Ga0075433_10047299 Ga0075433_100472995 273
100 3300006914 Ga0075436_100010372 Ga0075436_1000103728 273
101 3300007076 Ga0075435_100018626 Ga0075435_1000186265 273
102 3300050513 nmdc:mga0rr50_12330_c1 nmdc:mga0rr50_12330_c1_2908_3765 273
103 3300050514 nmdc:mga08x19_102697_c1 nmdc:mga08x19_102697_c1_245_1102 273
104 3300050515 nmdc:mga0a205_32315_c1 nmdc:mga0a205_32315_c1_3606_4463 273
105 3300006844 Ga0075428_100103296 Ga0075428_1001032962 274
106 3300006847 Ga0075431_100144200 Ga0075431_1001442004 274
107 3300006846 Ga0075430_100012171 Ga0075430_1000121712 276
108 3300006847 Ga0075431_100031781 Ga0075431_1000317812 276
109 3300049575 Ga0501039_0002475 Ga0501039_0002475_8888_9739 276
110 3300049577 Ga0501041_0020073 Ga0501041_0020073_2269_3120 276
111 3300049578 Ga0501042_0045145 Ga0501042_0045145_1742_2593 276
112 3300049580 Ga0501046_0023379 Ga0501046_0023379_2022_2873 276
113 3300049587 Ga0501071_0019675 Ga0501071_0019675_3103_3954 276
114 3300049588 Ga0501072_0005925 Ga0501072_0005925_5098_5949 276
115 3300049591 Ga0501075_0034433 Ga0501075_0034433_760_1611 276
116 3300049593 Ga0501077_0014116 Ga0501077_0014116_2510_3361 276
117 3300049741 Ga0501079_0009554 Ga0501079_0009554_2535_3386 276
118 3300049742 Ga0501080_0014278 Ga0501080_0014278_1285_2136 276
119 3300049744 Ga0501083_0015981 Ga0501083_0015981_3901_4752 276
120 3300049822 Ga0501035_0150761 Ga0501035_0150761_453_1304 276
121 3300050509 nmdc:mga0qj67_37631_c1 nmdc:mga0qj67_37631_c1_1849_2679 276
122 3300050510 nmdc:mga06r32_340134_c1 nmdc:mga06r32_340134_c1_301_1131 276
123 3300054114 Ga0501084_0034236 Ga0501084_0034236_1077_1928 276
124 3300060353 Ga0501082_0001295 Ga0501082_0001295_559_1410 276
125 3300031911 Ga0307412_10103314 Ga0307412_101033142 277
126 3300032002 Ga0307416_100029913 Ga0307416_1000299134 277
127 3300046678 Ga0495599_0044582 Ga0495599_0044582_385_1245 277
128 3300006914 Ga0075436_100035894 Ga0075436_1000358943 278
129 3300031250 Ga0265331_10053873 Ga0265331_100538733 278
130 3300035118 Ga0373954_0003552 Ga0373954_0003552_3772_4635 278
131 3300046517 Ga0495630_0041606 Ga0495630_0041606_1565_2428 278
132 3300050514 nmdc:mga08x19_80232_c1 nmdc:mga08x19_80232_c1_43_900 278
133 3300005985 Ga0081539_10001356 Ga0081539_100013563 279
134 3300037068 Ga0373925_0381386 Ga0373925_0381386_198_1049 279
135 3300046476 Ga0495662_0026795 Ga0495662_0026795_489_1340 279
136 3300046517 Ga0495630_0388887 Ga0495630_0388887_85_936 279
137 3300046642 Ga0495634_0065153 Ga0495634_0065153_815_1666 279
138 3300046663 Ga0495635_0055622 Ga0495635_0055622_861_1712 279
139 3300005440 Ga0070705_100040982 Ga0070705_1000409823 280
140 3300005440 Ga0070705_100087767 Ga0070705_1000877672 280
141 3300005458 Ga0070681_10008416 Ga0070681_100084167 280
142 3300005530 Ga0070679_100125321 Ga0070679_1001253213 280
143 3300005536 Ga0070697_100230141 Ga0070697_1002301412 280
144 3300005545 Ga0070695_100034745 Ga0070695_1000347455 280
145 3300005549 Ga0070704_100146863 Ga0070704_1001468632 280
146 3300006173 Ga0070716_100013965 Ga0070716_1000139654 280
147 3300006871 Ga0075434_100003841 Ga0075434_1000038417 280
148 3300006871 Ga0075434_100050282 Ga0075434_1000502823 280
149 3300006871 Ga0075434_100054216 Ga0075434_1000542163 280
150 3300006914 Ga0075436_100006269 Ga0075436_1000062695 280
151 3300006914 Ga0075436_100309406 Ga0075436_1003094062 280
152 3300007076 Ga0075435_100135010 Ga0075435_1001350101 280
153 3300007265 Ga0099794_10022090 Ga0099794_100220903 280
154 3300007265 Ga0099794_10030175 Ga0099794_100301753 280
155 3300025910 Ga0207684_10039529 Ga0207684_100395293 280
156 3300025912 Ga0207707_10006779 Ga0207707_100067799 280
157 3300025921 Ga0207652_10062504 Ga0207652_100625042 280
158 3300027671 Ga0209588_1011049 Ga0209588_10110493 280
159 3300032002 Ga0307416_100431419 Ga0307416_1004314191 280
160 3300034820 Ga0373959_0006670 Ga0373959_0006670_810_1667 280
161 3300035092 Ga0373952_0004181 Ga0373952_0004181_290_1147 280
162 3300035115 Ga0373941_0011558 Ga0373941_0011558_394_1251 280
163 3300035118 Ga0373954_0000292 Ga0373954_0000292_15060_15926 280
164 3300035120 Ga0373957_0049991 Ga0373957_0049991_235_1101 280
165 3300035691 Ga0373931_0125953 Ga0373931_0125953_400_1257 280
166 3300035724 Ga0373933_0022860 Ga0373933_0022860_2305_3171 280
167 3300036401 Ga0373937_0000145 Ga0373937_0000145_23088_23954 280
168 3300042876 Ga0451577_0146333 Ga0451577_0146333_453_1337 280
169 3300046684 Ga0495669_0046993 Ga0495669_0046993_825_1685 280
170 3300048088 Ga0495602_0177247 Ga0495602_0177247_95_961 280
171 3300049521 Ga0501298_007225 Ga0501298_007225_483_1340 280
172 3300049593 Ga0501077_0067826 Ga0501077_0067826_563_1480 280
173 3300050512 nmdc:mga0n895_388563_c1 nmdc:mga0n895_388563_c1_374_1234 280
174 3300050512 nmdc:mga0n895_3965_c1 nmdc:mga0n895_3965_c1_3606_4469 280
175 3300050513 nmdc:mga0rr50_50342_c1 nmdc:mga0rr50_50342_c1_185_1045 280
176 3300050514 nmdc:mga08x19_14411_c1 nmdc:mga08x19_14411_c1_3238_4107 280
177 3300005345 Ga0070692_10011019 Ga0070692_100110195 281
178 3300005444 Ga0070694_100001052 Ga0070694_1000010525 281
179 3300005546 Ga0070696_100012102 Ga0070696_1000121022 281
180 3300005549 Ga0070704_100003746 Ga0070704_1000037466 281
181 3300006846 Ga0075430_100012874 Ga0075430_1000128746 281
182 3300006846 Ga0075430_100341734 Ga0075430_1003417342 281
183 3300006847 Ga0075431_100031643 Ga0075431_1000316432 281
184 3300006880 Ga0075429_100027821 Ga0075429_1000278215 281
185 3300009147 Ga0114129_10075721 Ga0114129_100757214 281
186 3300025917 Ga0207660_10029057 Ga0207660_100290573 281
187 3300027543 Ga0209999_1006849 Ga0209999_10068492 281
188 3300027876 Ga0209974_10033317 Ga0209974_100333173 281
189 3300041408 Ga0439453_0000959 Ga0439453_0000959_569_1414 281
190 3300042000 Ga0439437_006466 Ga0439437_006466_195_1040 281
191 3300042003 Ga0439443_000211 Ga0439443_000211_1883_2728 281
192 3300042436 Ga0439435_0000403 Ga0439435_0000403_3818_4663 281
193 3300042436 Ga0439435_0000431 Ga0439435_0000431_944_1789 281
194 3300042437 Ga0439444_0000032 Ga0439444_0000032_3115_3960 281
195 3300042461 Ga0439460_0001305 Ga0439460_0001305_3308_4153 281
196 3300042461 Ga0439460_0004113 Ga0439460_0004113_733_1578 281
197 3300046537 Ga0495598_0002452 Ga0495598_0002452_1454_2326 281
198 3300046539 Ga0495621_0041677 Ga0495621_0041677_465_1325 281
199 3300049572 Ga0501036_0024987 Ga0501036_0024987_1817_2662 281
200 3300049573 Ga0501037_0182596 Ga0501037_0182596_201_1046 281
201 3300049576 Ga0501040_0073662 Ga0501040_0073662_540_1385 281
202 3300049577 Ga0501041_0013311 Ga0501041_0013311_1783_2628 281
203 3300049578 Ga0501042_0129099 Ga0501042_0129099_858_1703 281
204 3300049578 Ga0501042_0308986 Ga0501042_0308986_142_987 281
205 3300049580 Ga0501046_0058201 Ga0501046_0058201_1295_2140 281
206 3300049584 Ga0501068_0347311 Ga0501068_0347311_70_915 281
207 3300049587 Ga0501071_0010657 Ga0501071_0010657_3744_4589 281
208 3300049588 Ga0501072_0067866 Ga0501072_0067866_660_1505 281
209 3300049590 Ga0501074_0298600 Ga0501074_0298600_92_937 281
210 3300049591 Ga0501075_0416116 Ga0501075_0416116_142_987 281
211 3300049592 Ga0501076_0000978 Ga0501076_0000978_12146_12991 281
212 3300049742 Ga0501080_0094314 Ga0501080_0094314_465_1310 281
213 3300049743 Ga0501081_0057636 Ga0501081_0057636_536_1381 281
214 3300049824 Ga0501045_0001917 Ga0501045_0001917_2077_2922 281
215 3300050508 nmdc:mga09592_7869_c1 nmdc:mga09592_7869_c1_2173_3018 281
216 3300050509 nmdc:mga0qj67_355716_c1 nmdc:mga0qj67_355716_c1_156_1001 281
217 3300050509 nmdc:mga0qj67_72454_c1 nmdc:mga0qj67_72454_c1_730_1575 281
218 3300050510 nmdc:mga06r32_93929_c1 nmdc:mga06r32_93929_c1_1530_2375 281
219 3300054114 Ga0501084_0026967 Ga0501084_0026967_2246_3091 281
220 3300060353 Ga0501082_0650712 Ga0501082_0650712_25_870 281
221 3300061734 Ga0530510_0003896 Ga0530510_0003896_1867_2712 281
222 3300047318 Ga0495636_0109799 Ga0495636_0109799_228_1082 284
223 3300005336 Ga0070680_100029866 Ga0070680_1000298667 285
224 3300006846 Ga0075430_100009348 Ga0075430_10000934810 285
225 3300025917 Ga0207660_10103755 Ga0207660_101037553 285
226 3300049660 Ga0501216_013387 Ga0501216_013387_292_1149 285
227 3300050509 nmdc:mga0qj67_7863_c1 nmdc:mga0qj67_7863_c1_464_1321 285
228 3300005295 Ga0065707_10181442 Ga0065707_101814422 286
229 3300005328 Ga0070676_10040320 Ga0070676_100403203 286
230 3300005334 Ga0068869_100068394 Ga0068869_1000683943 286
231 3300005340 Ga0070689_100027499 Ga0070689_1000274996 286
232 3300005341 Ga0070691_10129179 Ga0070691_101291791 286
233 3300005345 Ga0070692_10012971 Ga0070692_100129714 286
234 3300005353 Ga0070669_100002754 Ga0070669_1000027547 286
235 3300005354 Ga0070675_100013844 Ga0070675_1000138446 286
236 3300005356 Ga0070674_100172358 Ga0070674_1001723582 286
237 3300005364 Ga0070673_100370566 Ga0070673_1003705661 286
238 3300005438 Ga0070701_10197925 Ga0070701_101979252 286
239 3300005441 Ga0070700_100000940 Ga0070700_10000094013 286
240 3300005441 Ga0070700_100178596 Ga0070700_1001785962 286
241 3300005459 Ga0068867_100000199 Ga0068867_10000019921 286
242 3300005459 Ga0068867_100489776 Ga0068867_1004897761 286
243 3300005719 Ga0068861_100003974 Ga0068861_1000039745 286
244 3300005719 Ga0068861_100148045 Ga0068861_1001480452 286
245 3300005844 Ga0068862_100001087 Ga0068862_1000010878 286
246 3300006844 Ga0075428_100181009 Ga0075428_1001810093 286
247 3300006881 Ga0068865_100143114 Ga0068865_1001431142 286
248 3300009094 Ga0111539_10024558 Ga0111539_100245584 286
249 3300009094 Ga0111539_10067971 Ga0111539_100679717 286
250 3300009094 Ga0111539_10137905 Ga0111539_101379053 286
251 3300009148 Ga0105243_10006579 Ga0105243_100065798 286
252 3300009148 Ga0105243_10239592 Ga0105243_102395921 286
253 3300009553 Ga0105249_10000940 Ga0105249_1000094018 286
254 3300013306 Ga0163162_10136355 Ga0163162_101363553 286
255 3300013308 Ga0157375_10487574 Ga0157375_104875742 286
256 3300014326 Ga0157380_10001346 Ga0157380_100013469 286
257 3300014745 Ga0157377_10040578 Ga0157377_100405783 286
258 3300017792 Ga0163161_10517968 Ga0163161_105179681 286
259 3300025908 Ga0207643_10010340 Ga0207643_100103404 286
260 3300025917 Ga0207660_10113153 Ga0207660_101131533 286
261 3300025918 Ga0207662_10017638 Ga0207662_100176383 286
262 3300025923 Ga0207681_10002198 Ga0207681_100021987 286
263 3300025926 Ga0207659_10230607 Ga0207659_102306071 286
264 3300025935 Ga0207709_10002718 Ga0207709_100027186 286
265 3300025937 Ga0207669_10137729 Ga0207669_101377292 286
266 3300025938 Ga0207704_10003917 Ga0207704_100039176 286
267 3300025940 Ga0207691_10292150 Ga0207691_102921502 286
268 3300025942 Ga0207689_10012214 Ga0207689_100122145 286
269 3300025960 Ga0207651_10059892 Ga0207651_100598922 286
270 3300025961 Ga0207712_10007878 Ga0207712_100078786 286
271 3300025972 Ga0207668_10087937 Ga0207668_100879372 286
272 3300026075 Ga0207708_10012340 Ga0207708_100123407 286
273 3300026075 Ga0207708_10175058 Ga0207708_101750583 286
274 3300026075 Ga0207708_10195470 Ga0207708_101954702 286
275 3300026089 Ga0207648_10000242 Ga0207648_100002428 286
276 3300026089 Ga0207648_10072578 Ga0207648_100725784 286
277 3300026118 Ga0207675_100001245 Ga0207675_10000124517 286
278 3300026118 Ga0207675_100145755 Ga0207675_1001457552 286
279 3300027360 Ga0209969_1001400 Ga0209969_10014005 286
280 3300027907 Ga0207428_10015387 Ga0207428_100153875 286
281 3300027907 Ga0207428_10068569 Ga0207428_100685693 286
282 3300027907 Ga0207428_10132974 Ga0207428_101329743 286
283 3300028380 Ga0268265_10001954 Ga0268265_100019549 286
284 3300028381 Ga0268264_10364574 Ga0268264_103645741 286
285 3300031995 Ga0307409_100320304 Ga0307409_1003203042 286
286 3300046537 Ga0495598_0036999 Ga0495598_0036999_286_1146 286
287 3300046539 Ga0495621_0005757 Ga0495621_0005757_1933_2802 286
288 3300050508 nmdc:mga09592_214564_c1 nmdc:mga09592_214564_c1_24_884 286
289 3300050510 nmdc:mga06r32_712543_c1 nmdc:mga06r32_712543_c1_94_954 286
290 3300050511 nmdc:mga08y16_25321_c1 nmdc:mga08y16_25321_c1_3273_4133 286
291 3300050511 nmdc:mga08y16_26487_c1 nmdc:mga08y16_26487_c1_1855_2715 286
292 3300050511 nmdc:mga08y16_74960_c1 nmdc:mga08y16_74960_c1_913_1773 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

46

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.9022 28 285
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.8717 26 286
7w2j-assembly1.cif.gz_C cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8715 28 285
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8174 6 277
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.8154 28 285
ID Description Score Start End Superfamily
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.68 176 281 1.10.760.10
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6579 168 282 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6543 176 281 1.10.760.10
1cnoH00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6364 24 134 1.10.760.10
2zzs300 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6346 174 278 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2E9MFQ3-F1-model_v4 Cytochrome C 0.947 58 282 GO:0009055
GO:0020037
GO:0046872
AF-A0A2P9HE99-F1-model_v4 Diheme cytochrome c-553 0.9412 73 281 GO:0005506
GO:0005886
GO:0009055
GO:0016614
GO:0020037
AF-A0A2S6U5M7-F1-model_v4 Fructose dehydrogenase cytochrome subunit 0.941 23 283 GO:0005506
GO:0009055
GO:0020037
GO:0022900
AF-A0A3S0GMW2-F1-model_v4 deleted 0.9392 80 284
AF-A0A7C7U4H0-F1-model_v4 Cytochrome C 0.9389 26 284 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.45 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map