F391163

General Info

Members Datasets Scaffolds Average Seq Length
292 197 279 181

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0610030|Ga0496124_0610030_61_654
Length 197
Sequence MNWRVQSGSVMSLEGGGEDRWVFGYGSLMWRPGFPFIDRRTAVLHGRRRAFCIYSVHHRGTYERPGLVLGLAPGGAVRGMAYRVAAAEWEAVYAYLREREQPTETYFETWREVKIDGNGPDGRQRASALVFLSDMKHSQWAGALTLDEQAALIAGATGLSGPNIDYLRDLVMHLREDGVRDHAMEKLLKMVEAIEAP

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
7 2643221640 Caulobacter sp. Root342 Isolate Unclassified
8 2643221642 Caulobacter sp. Root343 Isolate Unclassified
9 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
10 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
11 2818991435 Caulobacter henricii 536 Isolate Unclassified
12 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
13 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
161 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
176 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
179 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
187 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
193 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
197 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 0.34
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0
Rhizoplane 2.4
Rhizosphere 64.73
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10104930 3300003215 Bacteria 658
2 rootH1_10014903 3300003316 Bacteria 4261
3 rootL2_10028765 3300003322 Bacteria 5590
4 Ga0055537_1001968 3300003773 Bacteria 7333
5 Ga0055524_1004495 3300003775 Bacteria 6427
6 Ga0055536_1000271 3300003781 Bacteria 39460
7 Ga0055536_1000307 3300003781 Bacteria 36826
8 Ga0055528_1004442 3300003790 Bacteria 6760
9 Ga0055530_10006687 3300003791 Bacteria 5070
10 Ga0055530_10021169 3300003791 Bacteria 1924
11 Ga0055531_10000899 3300003794 Bacteria 24257
12 Ga0055531_10001385 3300003794 Bacteria 17985
13 Ga0055531_10005414 3300003794 Bacteria 7476
14 Ga0055531_10032432 3300003794 Bacteria 1706
15 Ga0070658_10076797 3300005327 Bacteria 2739
16 Ga0070683_100180746 3300005329 Bacteria 2002
17 Ga0070670_100110106 3300005331 Bacteria 2373
18 Ga0070670_101201572 3300005331 Bacteria 693
19 Ga0068869_100330649 3300005334 Bacteria 1238
20 Ga0070680_100470085 3300005336 Bacteria 1074
21 Ga0070660_100231692 3300005339 Bacteria 1503
22 Ga0070668_100001360 3300005347 Bacteria 17507
23 Ga0070668_100031474 3300005347 Bacteria 4036
24 Ga0070669_100279613 3300005353 Bacteria 1337
25 Ga0070675_101650207 3300005354 Bacteria 591
26 Ga0070659_100000143 3300005366 Bacteria 55183
27 Ga0070681_10086030 3300005458 Bacteria 3096
28 Ga0070679_100067897 3300005530 Bacteria 3556
29 Ga0068853_100079438 3300005539 Bacteria 2869
30 Ga0068853_100142037 3300005539 Bacteria 2156
31 Ga0068853_100365440 3300005539 Bacteria 1345
32 Ga0068855_100029979 3300005563 Bacteria 6506
33 Ga0068855_100042446 3300005563 Bacteria 5389
34 Ga0068855_100050942 3300005563 Bacteria 4878
35 Ga0068855_100489535 3300005563 Bacteria 1338
36 Ga0068855_100726569 3300005563 Bacteria 1061
37 Ga0068855_101400267 3300005563 Bacteria 721
38 Ga0070664_100005203 3300005564 Bacteria 10429
39 Ga0068857_100152711 3300005577 Bacteria 2093
40 Ga0068854_100276153 3300005578 Bacteria 1351
41 Ga0068854_100305635 3300005578 Bacteria 1288
42 Ga0068856_100150819 3300005614 Bacteria 2334
43 Ga0068859_100006364 3300005617 Bacteria 11977
44 Ga0068864_100000503 3300005618 Bacteria 33698
45 Ga0068864_100084524 3300005618 Bacteria 2788
46 Ga0068864_100462904 3300005618 Bacteria 1214
47 Ga0068864_100705819 3300005618 Bacteria 986
48 Ga0068861_100025040 3300005719 Bacteria 4321
49 Ga0068858_101131223 3300005842 Bacteria 769
50 Ga0068860_100000234 3300005843 Bacteria 85182
51 Ga0068860_100084530 3300005843 Bacteria 3019
52 Ga0068862_100004962 3300005844 Bacteria 11203
53 Ga0068862_100125557 3300005844 Bacteria 2265
54 Ga0075369_10003374 3300006186 Bacteria 5809
55 Ga0075366_10013308 3300006195 Bacteria 4680
56 Ga0097620_100006364 3300006931 Bacteria 11977
57 Ga0105240_10006131 3300009093 Bacteria 17731
58 Ga0105240_10006793 3300009093 Bacteria 16737
59 Ga0105240_10070107 3300009093 Bacteria 4337
60 Ga0105240_10075573 3300009093 Bacteria 4155
61 Ga0105240_10217949 3300009093 Bacteria 2225
62 Ga0105241_11449811 3300009174 Bacteria 659
63 Ga0105242_10053946 3300009176 Bacteria 3284
64 Ga0105242_11598797 3300009176 Bacteria 685
65 Ga0105248_11288104 3300009177 Bacteria 827
66 Ga0105237_11057306 3300009545 Bacteria 818
67 Ga0105238_10117104 3300009551 Bacteria 2644
68 Ga0105238_10216676 3300009551 Bacteria 1890
69 Ga0105249_10308829 3300009553 Bacteria 1589
70 Ga0105239_10172685 3300010375 Bacteria 2417
71 Ga0105239_10374595 3300010375 Bacteria 1609
72 Ga0105239_11015342 3300010375 Bacteria 954
73 Ga0157373_10000482 3300013100 Bacteria 31638
74 Ga0157373_10000483 3300013100 Bacteria 31535
75 Ga0157370_10090050 3300013104 Bacteria 2881
76 Ga0157369_10443460 3300013105 Bacteria 1344
77 Ga0157374_10565402 3300013296 Bacteria 1145
78 Ga0163162_11202121 3300013306 Bacteria 860
79 Ga0157372_10022928 3300013307 Bacteria 6762
80 Ga0182008_10038291 3300014497 Bacteria 2397
81 Ga0157376_10933450 3300014969 Bacteria 887
82 Ga0206353_10428515 3300020082 Bacteria 672
83 Ga0213872_10189540 3300021361 Bacteria 885
84 Ga0213876_10000074 3300021384 Bacteria 120394
85 Ga0213871_10040802 3300021441 Bacteria 1245
86 Ga0209676_1000224 3300025292 Bacteria 124160
87 Ga0209676_1000422 3300025292 Bacteria 74541
88 Ga0209050_1000463 3300025298 Bacteria 72380
89 Ga0209050_1001204 3300025298 Bacteria 30367
90 Ga0209050_1007137 3300025298 Bacteria 6371
91 Ga0209050_1015980 3300025298 Bacteria 3104
92 Ga0209256_1001915 3300025299 Bacteria 19046
93 Ga0209256_1005025 3300025299 Bacteria 7894
94 Ga0209051_1019489 3300025303 Bacteria 2957
95 Ga0209257_1000066 3300025304 Bacteria 344166
96 Ga0209257_1000512 3300025304 Bacteria 67436
97 Ga0209257_1010830 3300025304 Bacteria 4519
98 Ga0207705_10323629 3300025909 Bacteria 1185
99 Ga0207705_10513959 3300025909 Bacteria 930
100 Ga0207654_10400475 3300025911 Bacteria 954
101 Ga0207695_10001763 3300025913 Bacteria 34269
102 Ga0207695_10008830 3300025913 Bacteria 12549
103 Ga0207695_10010025 3300025913 Bacteria 11633
104 Ga0207695_10054978 3300025913 Bacteria 4152
105 Ga0207660_10045532 3300025917 Bacteria 3091
106 Ga0207649_10099827 3300025920 Bacteria 1919
107 Ga0207652_10055210 3300025921 Bacteria 3415
108 Ga0207694_10015604 3300025924 Bacteria 5729
109 Ga0207694_10434443 3300025924 Bacteria 1095
110 Ga0207690_10000617 3300025932 Bacteria 23012
111 Ga0207690_10030803 3300025932 Bacteria 3426
112 Ga0207689_10050635 3300025942 Bacteria 3424
113 Ga0207679_10001519 3300025945 Bacteria 14513
114 Ga0207667_10024032 3300025949 Bacteria 6701
115 Ga0207667_10048032 3300025949 Bacteria 4515
116 Ga0207668_10008216 3300025972 Bacteria 6216
117 Ga0207640_10097946 3300025981 Bacteria 2049
118 Ga0207640_10340900 3300025981 Bacteria 1200
119 Ga0207639_10067427 3300026041 Bacteria 2784
120 Ga0207702_10101831 3300026078 Bacteria 2537
121 Ga0207702_10552605 3300026078 Bacteria 1126
122 Ga0207676_10488634 3300026095 Bacteria 1167
123 Ga0207674_10274050 3300026116 Bacteria 1635
124 Ga0268265_10028442 3300028380 Bacteria 4001
125 Ga0268264_10000008 3300028381 Bacteria 773387
126 Ga0307515_10131391 3300028794 Bacteria 2755
127 Ga0265338_10094937 3300028800 Bacteria 2452
128 Ga0265338_10141414 3300028800 Bacteria 1884
129 Ga0307511_10034528 3300030521 Bacteria 4436
130 Ga0265340_10025138 3300031247 Bacteria 3020
131 Ga0265327_10001234 3300031251 Bacteria 34331
132 Ga0265327_10001963 3300031251 Bacteria 23543
133 Ga0265327_10043413 3300031251 Bacteria 2405
134 Ga0265327_10124336 3300031251 Bacteria 1219
135 Ga0265316_10225893 3300031344 Bacteria 1380
136 Ga0307513_10002302 3300031456 Bacteria 26655
137 Ga0307513_10013285 3300031456 Bacteria 10111
138 Ga0307513_10319883 3300031456 Bacteria 1310
139 Ga0307516_10000002 3300031730 Bacteria 467851
140 Ga0307405_10798076 3300031731 Bacteria 791
141 Ga0307413_10974249 3300031824 Bacteria 725
142 Ga0307407_10364687 3300031903 Bacteria 1027
143 Ga0307412_10542899 3300031911 Bacteria 975
144 Ga0307416_100333330 3300032002 Bacteria 1526
145 Ga0307414_10140390 3300032004 Bacteria 1890
146 Ga0307510_10033533 3300033180 Bacteria 5765
147 Ga0373944_0014481 3300035089 Bacteria 2201
148 Ga0373927_0000155 3300035695 Bacteria 53529
149 Ga0373937_0387969 3300036401 Bacteria 1325
150 Ga0373925_0000032 3300037068 Bacteria 145357
151 Ga0395899_0002151 3300037312 Bacteria 16183
152 Ga0395900_0032813 3300037418 Bacteria 5341
153 Ga0395900_0714315 3300037418 Bacteria 935
154 Ga0395898_0169995 3300037466 Bacteria 2084
155 Ga0395898_0529378 3300037466 Bacteria 1120
156 Ga0395905_0130965 3300037471 Bacteria 2359
157 Ga0395905_0221149 3300037471 Bacteria 1772
158 Ga0395905_0400777 3300037471 Bacteria 1267
159 Ga0395905_0682110 3300037471 Bacteria 930
160 Ga0395901_0290468 3300038443 Bacteria 1697
161 Ga0436365_0896302 3300039437 Bacteria 1924
162 Ga0436365_1421618 3300039437 Bacteria 2347
163 Ga0436365_1583918 3300039437 Bacteria 9004
164 Ga0451802_1821435 3300041460 Bacteria 631
165 Ga0439431_0038608 3300041997 Bacteria 1209
166 Ga0439446_0001987 3300042156 Bacteria 4830
167 Ga0466957_0247241 3300044842 Bacteria 1185
168 Ga0466959_0757705 3300045049 Bacteria 650
169 Ga0495592_0308111 3300046454 Bacteria 1027
170 Ga0495638_0000387 3300046460 Bacteria 54475
171 Ga0495638_0007644 3300046460 Bacteria 7728
172 Ga0495638_0057856 3300046460 Bacteria 2404
173 Ga0495650_0000020 3300046471 Bacteria 533839
174 Ga0495606_0005914 3300046507 Bacteria 11498
175 Ga0495610_0000218 3300046512 Bacteria 61777
176 Ga0495610_0013904 3300046512 Bacteria 4755
177 Ga0495610_0141294 3300046512 Bacteria 1036
178 Ga0495616_0035747 3300046513 Bacteria 2568
179 Ga0495637_0013941 3300046520 Bacteria 3804
180 Ga0495637_0056090 3300046520 Bacteria 1632
181 Ga0495648_0000130 3300046524 Bacteria 88368
182 Ga0495642_0015036 3300046528 Bacteria 3004
183 Ga0495642_0070501 3300046528 Bacteria 1461
184 Ga0495654_0000139 3300046530 Bacteria 75903
185 Ga0495668_0000060 3300046616 Bacteria 193823
186 Ga0495668_0204864 3300046616 Bacteria 1080
187 Ga0495625_0011277 3300046660 Bacteria 7304
188 Ga0495625_0013866 3300046660 Bacteria 6454
189 Ga0495625_0069545 3300046660 Bacteria 2473
190 Ga0495625_0291135 3300046660 Bacteria 1048
191 Ga0495669_0000020 3300046684 Bacteria 122868
192 Ga0495669_0000449 3300046684 Bacteria 19393
193 Ga0495613_0000559 3300046689 Bacteria 30599
194 Ga0495671_0318156 3300046692 Bacteria 747
195 Ga0495589_0016530 3300046794 Bacteria 3792
196 Ga0495660_0046517 3300046810 Bacteria 2379
197 Ga0495672_0002907 3300047320 Bacteria 15160
198 Ga0495679_005626 3300047446 Bacteria 5527
199 Ga0495673_0000301 3300047469 Bacteria 66146
200 Ga0495673_0003272 3300047469 Bacteria 10785
201 Ga0495673_0012658 3300047469 Bacteria 4461
202 Ga0495681_0075864 3300047470 Bacteria 1512
203 Ga0495686_0002071 3300047472 Bacteria 19715
204 Ga0495686_0015238 3300047472 Bacteria 5259
205 Ga0495615_0022341 3300048090 Bacteria 1438
206 Ga0496102_1093632 3300048905 Bacteria 717
207 Ga0496112_0044190 3300048915 Bacteria 4365
208 Ga0496112_0214755 3300048915 Bacteria 1880
209 Ga0496115_0004911 3300048918 Bacteria 9707
210 Ga0496115_0070672 3300048918 Bacteria 2830
211 Ga0496115_0193169 3300048918 Bacteria 1682
212 Ga0496124_0023292 3300048927 Bacteria 5656
213 Ga0496124_0610030 3300048927 Bacteria 708
214 Ga0496126_0105828 3300048929 Bacteria 2456
215 Ga0495678_005395 3300049459 Bacteria 7073
216 Ga0501033_0144721 3300049570 Bacteria 1717
217 Ga0501034_0086990 3300049571 Bacteria 3125
218 Ga0501034_0140184 3300049571 Bacteria 2398
219 Ga0501034_0171605 3300049571 Bacteria 2136
220 Ga0501036_0597216 3300049572 Bacteria 916
221 Ga0501039_0621279 3300049575 Bacteria 847
222 Ga0501043_0262087 3300049579 Bacteria 1329
223 Ga0501047_0011838 3300049581 Bacteria 8250
224 Ga0501070_0333168 3300049586 Bacteria 1233
225 Ga0501238_006927 3300049671 Bacteria 1467
226 Ga0501257_012103 3300049686 Bacteria 1972
227 Ga0501080_0569569 3300049742 Bacteria 1008
228 Ga0501081_0594028 3300049743 Bacteria 829
229 Ga0501083_0088167 3300049744 Bacteria 2052
230 Ga0501035_0246210 3300049822 Bacteria 1519
231 Ga0501044_0007104 3300049823 Bacteria 12322
232 Ga0501044_0289379 3300049823 Bacteria 1570
233 nmdc:mga07m45_322768_c1 3300050496 Bacteria 897
234 nmdc:mga0sz30_18721_c1 3300050516 Bacteria 2774
235 Ga0500578_0002604 3300053086 Bacteria 14717
236 Ga0500643_001547 3300053087 Bacteria 13032
237 Ga0500643_001592 3300053087 Bacteria 12831
238 Ga0500643_060272 3300053087 Bacteria 1066
239 Ga0500644_0000037 3300053088 Bacteria 80217
240 Ga0500646_0115431 3300053090 Bacteria 858
241 Ga0500641_0001402 3300053096 Bacteria 8591
242 Ga0500641_0015511 3300053096 Bacteria 2830
243 Ga0500555_046972 3300053103 Bacteria 1189
244 Ga0500556_0001281 3300053104 Bacteria 11390
245 Ga0500556_0002484 3300053104 Bacteria 5889
246 Ga0500556_0011497 3300053104 Bacteria 2622
247 Ga0500557_069361 3300053105 Bacteria 1155
248 Ga0500562_008682 3300053108 Bacteria 2567
249 Ga0500562_009303 3300053108 Bacteria 2484
250 Ga0500562_010244 3300053108 Bacteria 2374
251 Ga0500572_000485 3300053111 Bacteria 13743
252 Ga0500593_274218 3300053117 Bacteria 556
253 Ga0500594_0000943 3300053118 Bacteria 6252
254 Ga0500595_014858 3300053119 Bacteria 2942
255 Ga0500614_017735 3300053123 Bacteria 1612
256 Ga0500618_000365 3300053125 Bacteria 31459
257 Ga0500658_0000898 3300053134 Bacteria 12195
258 Ga0500559_0022671 3300053136 Bacteria 2663
259 Ga0500564_000009 3300053138 Bacteria 60470
260 Ga0500577_0016655 3300053142 Bacteria 2322
261 Ga0500604_0304236 3300053151 Bacteria 553
262 Ga0500616_0017528 3300053153 Bacteria 4062
263 Ga0500616_0049314 3300053153 Bacteria 2229
264 Ga0500616_0067990 3300053153 Bacteria 1825
265 Ga0500619_028609 3300053154 Bacteria 1680
266 Ga0500622_0000234 3300053156 Bacteria 57602
267 Ga0500622_0010533 3300053156 Bacteria 5071
268 Ga0500622_0015749 3300053156 Bacteria 4047
269 Ga0500622_0168935 3300053156 Bacteria 1019
270 Ga0500622_0186952 3300053156 Bacteria 952
271 Ga0500627_0088821 3300053158 Bacteria 1382
272 Ga0500638_122993 3300053162 Bacteria 1185
273 Ga0500636_0011330 3300053177 Bacteria 5220
274 Ga0500645_000929 3300053730 Bacteria 16783
275 Ga0500645_009375 3300053730 Bacteria 3290
276 Ga0500645_012869 3300053730 Bacteria 2697
277 Ga0500645_030099 3300053730 Bacteria 1635
278 Ga0500552_026789 3300053733 Bacteria 862
279 Ga0500599_059528 3300053736 Bacteria 619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10400475 Ga0207654_104004752 148
2 3300025920 Ga0207649_10099827 Ga0207649_100998272 148
3 3300005530 Ga0070679_100067897 Ga0070679_1000678973 161
4 3300005563 Ga0068855_100042446 Ga0068855_1000424466 161
5 3300005578 Ga0068854_100305635 Ga0068854_1003056352 161
6 3300009174 Ga0105241_11449811 Ga0105241_114498111 161
7 3300025917 Ga0207660_10045532 Ga0207660_100455324 161
8 3300025921 Ga0207652_10055210 Ga0207652_100552103 161
9 3300025924 Ga0207694_10015604 Ga0207694_100156046 161
10 3300025949 Ga0207667_10024032 Ga0207667_100240322 161
11 3300025981 Ga0207640_10097946 Ga0207640_100979462 161
12 3300026041 Ga0207639_10067427 Ga0207639_100674273 161
13 3300026078 Ga0207702_10552605 Ga0207702_105526052 161
14 3300046528 Ga0495642_0015036 Ga0495642_0015036_2498_2989 161
15 3300048905 Ga0496102_1093632 Ga0496102_1093632_215_706 161
16 3300046660 Ga0495625_0291135 Ga0495625_0291135_67_606 163
17 3300046684 Ga0495669_0000449 Ga0495669_0000449_13221_13760 163
18 3300053117 Ga0500593_274218 Ga0500593_274218_23_517 163
19 3300053151 Ga0500604_0304236 Ga0500604_0304236_16_510 163
20 3300053153 Ga0500616_0049314 Ga0500616_0049314_828_1322 163
21 3300037471 Ga0395905_0221149 Ga0395905_0221149_1265_1762 164
22 3300047470 Ga0495681_0075864 Ga0495681_0075864_957_1466 164
23 3300053103 Ga0500555_046972 Ga0500555_046972_373_870 164
24 3300005334 Ga0068869_100330649 Ga0068869_1003306492 165
25 3300032004 Ga0307414_10140390 Ga0307414_101403903 165
26 3300036401 Ga0373937_0387969 Ga0373937_0387969_806_1306 165
27 3300049579 Ga0501043_0262087 Ga0501043_0262087_431_940 165
28 3300049581 Ga0501047_0011838 Ga0501047_0011838_7433_7942 165
29 3300049744 Ga0501083_0088167 Ga0501083_0088167_441_950 165
30 3300046524 Ga0495648_0000130 Ga0495648_0000130_57568_58077 166
31 3300031730 Ga0307516_10000002 Ga0307516_1000000298 168
32 3300031456 Ga0307513_10319883 Ga0307513_103198832 170
33 3300053111 Ga0500572_000485 Ga0500572_000485_7930_8445 170
34 3300053733 Ga0500552_026789 Ga0500552_026789_293_808 170
35 3300005458 Ga0070681_10086030 Ga0070681_100860303 172
36 3300025942 Ga0207689_10050635 Ga0207689_100506354 172
37 3300033180 Ga0307510_10033533 Ga0307510_100335334 172
38 3300039437 Ga0436365_1583918 Ga0436365_1583918_4146_4685 172
39 3300028800 Ga0265338_10094937 Ga0265338_100949372 173
40 3300030521 Ga0307511_10034528 Ga0307511_100345284 173
41 3300046616 Ga0495668_0204864 Ga0495668_0204864_508_1041 173
42 3300050496 nmdc:mga07m45_322768_c1 nmdc:mga07m45_322768_c1_153_677 173
43 3300053119 Ga0500595_014858 Ga0500595_014858_1406_1930 173
44 3300053162 Ga0500638_122993 Ga0500638_122993_172_708 173
45 3300005327 Ga0070658_10076797 Ga0070658_100767972 174
46 3300005366 Ga0070659_100000143 Ga0070659_10000014347 174
47 3300009551 Ga0105238_10216676 Ga0105238_102166763 174
48 3300010375 Ga0105239_10374595 Ga0105239_103745952 174
49 3300025932 Ga0207690_10000617 Ga0207690_100006175 174
50 3300053108 Ga0500562_009303 Ga0500562_009303_138_668 174
51 3300005329 Ga0070683_100180746 Ga0070683_1001807463 175
52 3300005539 Ga0068853_100142037 Ga0068853_1001420372 175
53 3300005618 Ga0068864_100084524 Ga0068864_1000845241 175
54 3300025909 Ga0207705_10513959 Ga0207705_105139592 175
55 3300031251 Ga0265327_10001963 Ga0265327_1000196315 175
56 3300048918 Ga0496115_0070672 Ga0496115_0070672_225_755 175
57 3300049823 Ga0501044_0289379 Ga0501044_0289379_217_747 175
58 3300005563 Ga0068855_101400267 Ga0068855_1014002671 176
59 3300009093 Ga0105240_10006131 Ga0105240_1000613110 176
60 3300009176 Ga0105242_11598797 Ga0105242_115987971 176
61 3300013296 Ga0157374_10565402 Ga0157374_105654022 176
62 3300014969 Ga0157376_10933450 Ga0157376_109334502 176
63 3300021361 Ga0213872_10189540 Ga0213872_101895401 176
64 3300025913 Ga0207695_10001763 Ga0207695_1000176314 176
65 3300031824 Ga0307413_10974249 Ga0307413_109742491 176
66 3300035089 Ga0373944_0014481 Ga0373944_0014481_465_1001 176
67 3300035695 Ga0373927_0000155 Ga0373927_0000155_47626_48162 176
68 3300037068 Ga0373925_0000032 Ga0373925_0000032_4833_5369 176
69 3300048915 Ga0496112_0214755 Ga0496112_0214755_1173_1739 176
70 3300049570 Ga0501033_0144721 Ga0501033_0144721_126_659 176
71 3300049823 Ga0501044_0007104 Ga0501044_0007104_7840_8373 176
72 3300053087 Ga0500643_060272 Ga0500643_060272_99_641 176
73 3300053104 Ga0500556_0002484 Ga0500556_0002484_3608_4150 176
74 3300053108 Ga0500562_008682 Ga0500562_008682_931_1473 176
75 3300053153 Ga0500616_0067990 Ga0500616_0067990_350_892 176
76 3300053177 Ga0500636_0011330 Ga0500636_0011330_3727_4260 176
77 3300053730 Ga0500645_009375 Ga0500645_009375_1813_2355 176
78 iso_pu_bacteria 2585428106 2587919356 176
79 3300005347 Ga0070668_100001360 Ga0070668_1000013608 177
80 3300005563 Ga0068855_100489535 Ga0068855_1004895352 177
81 3300005844 Ga0068862_100004962 Ga0068862_1000049626 177
82 3300009176 Ga0105242_10053946 Ga0105242_100539464 177
83 3300010375 Ga0105239_11015342 Ga0105239_110153422 177
84 3300025972 Ga0207668_10008216 Ga0207668_100082165 177
85 3300028380 Ga0268265_10028442 Ga0268265_100284423 177
86 3300031251 Ga0265327_10001234 Ga0265327_1000123416 177
87 3300031251 Ga0265327_10124336 Ga0265327_101243361 177
88 3300039437 Ga0436365_1421618 Ga0436365_1421618_235_792 177
89 3300041997 Ga0439431_0038608 Ga0439431_0038608_662_1198 177
90 3300048915 Ga0496112_0044190 Ga0496112_0044190_1662_2198 177
91 3300049572 Ga0501036_0597216 Ga0501036_0597216_338_889 177
92 3300049575 Ga0501039_0621279 Ga0501039_0621279_222_773 177
93 3300049742 Ga0501080_0569569 Ga0501080_0569569_276_827 177
94 3300049743 Ga0501081_0594028 Ga0501081_0594028_236_787 177
95 3300053087 Ga0500643_001547 Ga0500643_001547_953_1498 177
96 3300053090 Ga0500646_0115431 Ga0500646_0115431_119_655 177
97 3300053096 Ga0500641_0015511 Ga0500641_0015511_908_1453 177
98 3300053104 Ga0500556_0011497 Ga0500556_0011497_908_1453 177
99 3300053153 Ga0500616_0017528 Ga0500616_0017528_908_1453 177
100 3300053154 Ga0500619_028609 Ga0500619_028609_309_845 177
101 3300053156 Ga0500622_0015749 Ga0500622_0015749_2738_3283 177
102 3300053730 Ga0500645_030099 Ga0500645_030099_128_673 177
103 iso_pu_bacteria 2510917020 2511124307 177
104 3300005331 Ga0070670_100110106 Ga0070670_1001101062 178
105 3300005331 Ga0070670_101201572 Ga0070670_1012015721 178
106 3300005336 Ga0070680_100470085 Ga0070680_1004700852 178
107 3300005347 Ga0070668_100031474 Ga0070668_1000314743 178
108 3300005563 Ga0068855_100029979 Ga0068855_1000299798 178
109 3300005563 Ga0068855_100726569 Ga0068855_1007265692 178
110 3300005578 Ga0068854_100276153 Ga0068854_1002761532 178
111 3300005617 Ga0068859_100006364 Ga0068859_10000636414 178
112 3300005618 Ga0068864_100000503 Ga0068864_10000050315 178
113 3300005618 Ga0068864_100462904 Ga0068864_1004629041 178
114 3300005618 Ga0068864_100705819 Ga0068864_1007058192 178
115 3300005719 Ga0068861_100025040 Ga0068861_1000250403 178
116 3300005842 Ga0068858_101131223 Ga0068858_1011312231 178
117 3300005843 Ga0068860_100000234 Ga0068860_10000023413 178
118 3300005843 Ga0068860_100084530 Ga0068860_1000845301 178
119 3300005844 Ga0068862_100125557 Ga0068862_1001255573 178
120 3300006931 Ga0097620_100006364 Ga0097620_10000636414 178
121 3300009093 Ga0105240_10070107 Ga0105240_100701074 178
122 3300009093 Ga0105240_10075573 Ga0105240_100755734 178
123 3300009553 Ga0105249_10308829 Ga0105249_103088291 178
124 3300010375 Ga0105239_10172685 Ga0105239_101726853 178
125 3300013104 Ga0157370_10090050 Ga0157370_100900504 178
126 3300013306 Ga0163162_11202121 Ga0163162_112021211 178
127 3300013307 Ga0157372_10022928 Ga0157372_100229283 178
128 3300020082 Ga0206353_10428515 Ga0206353_104285152 178
129 3300025913 Ga0207695_10010025 Ga0207695_100100255 178
130 3300025913 Ga0207695_10054978 Ga0207695_100549783 178
131 3300025949 Ga0207667_10048032 Ga0207667_100480325 178
132 3300025981 Ga0207640_10340900 Ga0207640_103409002 178
133 3300026095 Ga0207676_10488634 Ga0207676_104886342 178
134 3300028381 Ga0268264_10000008 Ga0268264_10000008703 178
135 3300031251 Ga0265327_10043413 Ga0265327_100434133 178
136 3300031456 Ga0307513_10002302 Ga0307513_1000230218 178
137 3300031731 Ga0307405_10798076 Ga0307405_107980762 178
138 3300031911 Ga0307412_10542899 Ga0307412_105428991 178
139 3300037312 Ga0395899_0002151 Ga0395899_0002151_11902_12486 178
140 3300037418 Ga0395900_0714315 Ga0395900_0714315_289_864 178
141 3300037466 Ga0395898_0529378 Ga0395898_0529378_13_588 178
142 3300037471 Ga0395905_0400777 Ga0395905_0400777_356_916 178
143 3300037471 Ga0395905_0682110 Ga0395905_0682110_290_865 178
144 3300038443 Ga0395901_0290468 Ga0395901_0290468_251_826 178
145 3300039437 Ga0436365_0896302 Ga0436365_0896302_1127_1705 178
146 3300046454 Ga0495592_0308111 Ga0495592_0308111_417_1001 178
147 3300046460 Ga0495638_0000387 Ga0495638_0000387_11017_11562 178
148 3300046528 Ga0495642_0070501 Ga0495642_0070501_244_789 178
149 3300046684 Ga0495669_0000020 Ga0495669_0000020_25323_25868 178
150 3300049686 Ga0501257_012103 Ga0501257_012103_623_1165 178
151 3300053096 Ga0500641_0001402 Ga0500641_0001402_7655_8200 178
152 iso_pu_bacteria 2643221545 2643750977 178
153 iso_pu_bacteria 2643221614 2644088546 178
154 iso_pu_bacteria 2643221640 2644225184 178
155 iso_pu_bacteria 2643221642 2644232492 178
156 iso_pu_bacteria 2643221661 2644343782 178
157 iso_pu_bacteria 2643221666 2644368740 178
158 iso_pu_bacteria 2928531327 2928534315 178
159 3300005339 Ga0070660_100231692 Ga0070660_1002316922 179
160 3300005539 Ga0068853_100079438 Ga0068853_1000794382 179
161 3300005539 Ga0068853_100365440 Ga0068853_1003654402 179
162 3300005614 Ga0068856_100150819 Ga0068856_1001508192 179
163 3300009177 Ga0105248_11288104 Ga0105248_112881041 179
164 3300013100 Ga0157373_10000483 Ga0157373_1000048310 179
165 3300013105 Ga0157369_10443460 Ga0157369_104434602 179
166 3300025909 Ga0207705_10323629 Ga0207705_103236292 179
167 3300025913 Ga0207695_10008830 Ga0207695_100088306 179
168 3300025924 Ga0207694_10434443 Ga0207694_104344432 179
169 3300025932 Ga0207690_10030803 Ga0207690_100308034 179
170 3300026078 Ga0207702_10101831 Ga0207702_101018312 179
171 3300028794 Ga0307515_10131391 Ga0307515_101313911 179
172 3300031344 Ga0265316_10225893 Ga0265316_102258932 179
173 3300031456 Ga0307513_10013285 Ga0307513_100132852 179
174 3300046512 Ga0495610_0013904 Ga0495610_0013904_3823_4371 179
175 3300046520 Ga0495637_0056090 Ga0495637_0056090_969_1517 179
176 3300046689 Ga0495613_0000559 Ga0495613_0000559_15430_16014 179
177 3300046692 Ga0495671_0318156 Ga0495671_0318156_76_624 179
178 3300047472 Ga0495686_0002071 Ga0495686_0002071_2600_3148 179
179 3300049459 Ga0495678_005395 Ga0495678_005395_4319_4867 179
180 3300053086 Ga0500578_0002604 Ga0500578_0002604_11953_12501 179
181 3300053105 Ga0500557_069361 Ga0500557_069361_478_1026 179
182 3300053108 Ga0500562_010244 Ga0500562_010244_1779_2327 179
183 3300053118 Ga0500594_0000943 Ga0500594_0000943_2234_2782 179
184 3300053156 Ga0500622_0000234 Ga0500622_0000234_15444_15992 179
185 iso_pu_bacteria 2818991435 2819539819 179
186 iso_pu_bacteria 2818991454 2819648902 179
187 3300005354 Ga0070675_101650207 Ga0070675_1016502071 180
188 3300005563 Ga0068855_100050942 Ga0068855_1000509422 180
189 3300005577 Ga0068857_100152711 Ga0068857_1001527112 180
190 3300009093 Ga0105240_10217949 Ga0105240_102179492 180
191 3300013100 Ga0157373_10000482 Ga0157373_1000048224 180
192 3300026116 Ga0207674_10274050 Ga0207674_102740502 180
193 3300028800 Ga0265338_10141414 Ga0265338_101414142 180
194 3300031903 Ga0307407_10364687 Ga0307407_103646872 180
195 3300032002 Ga0307416_100333330 Ga0307416_1003333302 180
196 3300037418 Ga0395900_0032813 Ga0395900_0032813_802_1347 180
197 3300037466 Ga0395898_0169995 Ga0395898_0169995_1524_2069 180
198 3300037471 Ga0395905_0130965 Ga0395905_0130965_509_1054 180
199 3300047469 Ga0495673_0012658 Ga0495673_0012658_14_571 180
200 3300053088 Ga0500644_0000037 Ga0500644_0000037_41937_42494 180
201 3300053138 Ga0500564_000009 Ga0500564_000009_40897_41454 180
202 3300053156 Ga0500622_0186952 Ga0500622_0186952_40_582 180
203 3300053736 Ga0500599_059528 Ga0500599_059528_44_586 180
204 3300009545 Ga0105237_11057306 Ga0105237_110573062 181
205 3300021384 Ga0213876_10000074 Ga0213876_10000074100 181
206 3300031247 Ga0265340_10025138 Ga0265340_100251382 181
207 3300044842 Ga0466957_0247241 Ga0466957_0247241_482_1036 181
208 3300046471 Ga0495650_0000020 Ga0495650_0000020_361158_361718 181
209 3300046513 Ga0495616_0035747 Ga0495616_0035747_860_1405 181
210 3300046520 Ga0495637_0013941 Ga0495637_0013941_943_1503 181
211 3300046530 Ga0495654_0000139 Ga0495654_0000139_63410_63970 181
212 3300046660 Ga0495625_0069545 Ga0495625_0069545_1314_1874 181
213 3300046794 Ga0495589_0016530 Ga0495589_0016530_1243_1788 181
214 3300047469 Ga0495673_0000301 Ga0495673_0000301_61695_62240 181
215 3300053142 Ga0500577_0016655 Ga0500577_0016655_1384_1929 181
216 3300053156 Ga0500622_0168935 Ga0500622_0168935_327_884 181
217 3300053158 Ga0500627_0088821 Ga0500627_0088821_122_682 181
218 3300003316 rootH1_10014903 rootH1_100149032 182
219 3300003781 Ga0055536_1000271 Ga0055536_100027143 182
220 3300003781 Ga0055536_1000307 Ga0055536_100030739 182
221 3300003791 Ga0055530_10006687 Ga0055530_100066877 182
222 3300003791 Ga0055530_10021169 Ga0055530_100211692 182
223 3300003794 Ga0055531_10000899 Ga0055531_1000089927 182
224 3300003794 Ga0055531_10001385 Ga0055531_1000138517 182
225 3300003794 Ga0055531_10032432 Ga0055531_100324322 182
226 3300005564 Ga0070664_100005203 Ga0070664_1000052036 182
227 3300006186 Ga0075369_10003374 Ga0075369_100033745 182
228 3300006195 Ga0075366_10013308 Ga0075366_100133082 182
229 3300025292 Ga0209676_1000224 Ga0209676_100022495 182
230 3300025292 Ga0209676_1000422 Ga0209676_10004226 182
231 3300025298 Ga0209050_1000463 Ga0209050_100046378 182
232 3300025298 Ga0209050_1001204 Ga0209050_100120416 182
233 3300025298 Ga0209050_1007137 Ga0209050_10071375 182
234 3300025303 Ga0209051_1019489 Ga0209051_10194894 182
235 3300025304 Ga0209257_1000512 Ga0209257_100051238 182
236 3300025304 Ga0209257_1010830 Ga0209257_10108305 182
237 3300025945 Ga0207679_10001519 Ga0207679_100015197 182
238 3300042156 Ga0439446_0001987 Ga0439446_0001987_2734_3300 182
239 3300045049 Ga0466959_0757705 Ga0466959_0757705_67_618 182
240 3300046460 Ga0495638_0057856 Ga0495638_0057856_189_737 182
241 3300046507 Ga0495606_0005914 Ga0495606_0005914_9721_10269 182
242 3300046512 Ga0495610_0141294 Ga0495610_0141294_35_598 182
243 3300046616 Ga0495668_0000060 Ga0495668_0000060_80647_81195 182
244 3300046810 Ga0495660_0046517 Ga0495660_0046517_625_1188 182
245 3300047446 Ga0495679_005626 Ga0495679_005626_3606_4169 182
246 3300047472 Ga0495686_0015238 Ga0495686_0015238_2114_2680 182
247 3300048918 Ga0496115_0193169 Ga0496115_0193169_541_1104 182
248 3300048927 Ga0496124_0023292 Ga0496124_0023292_2247_2795 182
249 3300048927 Ga0496124_0610030 Ga0496124_0610030_61_654 182
250 3300049571 Ga0501034_0086990 Ga0501034_0086990_1806_2357 182
251 3300049571 Ga0501034_0171605 Ga0501034_0171605_214_780 182
252 3300049586 Ga0501070_0333168 Ga0501070_0333168_369_935 182
253 3300049822 Ga0501035_0246210 Ga0501035_0246210_317_883 182
254 3300050516 nmdc:mga0sz30_18721_c1 nmdc:mga0sz30_18721_c1_1774_2322 182
255 3300053087 Ga0500643_001592 Ga0500643_001592_10689_11252 182
256 3300053104 Ga0500556_0001281 Ga0500556_0001281_6138_6686 182
257 3300053125 Ga0500618_000365 Ga0500618_000365_25803_26366 182
258 3300053156 Ga0500622_0010533 Ga0500622_0010533_37_585 182
259 3300053730 Ga0500645_000929 Ga0500645_000929_10134_10697 182
260 iso_pu_bacteria 2582581280 2585150551 182
261 iso_pu_bacteria 2582581293 2585197741 182
262 3300003773 Ga0055537_1001968 Ga0055537_10019686 183
263 3300003775 Ga0055524_1004495 Ga0055524_10044955 183
264 3300003790 Ga0055528_1004442 Ga0055528_10044426 183
265 3300003794 Ga0055531_10005414 Ga0055531_100054144 183
266 3300014497 Ga0182008_10038291 Ga0182008_100382913 183
267 3300025299 Ga0209256_1005025 Ga0209256_10050256 183
268 3300025304 Ga0209257_1000066 Ga0209257_1000066271 183
269 3300041460 Ga0451802_1821435 Ga0451802_1821435_24_605 183
270 3300046660 Ga0495625_0013866 Ga0495625_0013866_1858_2424 183
271 3300048090 Ga0495615_0022341 Ga0495615_0022341_103_669 183
272 3300048918 Ga0496115_0004911 Ga0496115_0004911_7275_7826 183
273 3300048929 Ga0496126_0105828 Ga0496126_0105828_863_1414 183
274 3300049671 Ga0501238_006927 Ga0501238_006927_764_1315 183
275 3300053123 Ga0500614_017735 Ga0500614_017735_112_678 183
276 3300053136 Ga0500559_0022671 Ga0500559_0022671_112_663 183
277 3300009093 Ga0105240_10006793 Ga0105240_1000679311 185
278 3300009551 Ga0105238_10117104 Ga0105238_101171044 185
279 3300046460 Ga0495638_0007644 Ga0495638_0007644_6067_6639 185
280 3300046512 Ga0495610_0000218 Ga0495610_0000218_51383_51940 185
281 3300046660 Ga0495625_0011277 Ga0495625_0011277_4189_4746 185
282 3300047320 Ga0495672_0002907 Ga0495672_0002907_6887_7444 185
283 3300049571 Ga0501034_0140184 Ga0501034_0140184_1253_1825 185
284 3300053134 Ga0500658_0000898 Ga0500658_0000898_2829_3386 185
285 3300053730 Ga0500645_012869 Ga0500645_012869_267_824 185
286 3300021441 Ga0213871_10040802 Ga0213871_100408022 186
287 3300025298 Ga0209050_1015980 Ga0209050_10159803 186
288 3300047469 Ga0495673_0003272 Ga0495673_0003272_5369_5929 186
289 3300003215 JGI25153J46596_10104930 JGI25153J46596_101049301 187
290 3300003322 rootL2_10028765 rootL2_100287655 187
291 3300005353 Ga0070669_100279613 Ga0070669_1002796132 187
292 3300025299 Ga0209256_1001915 Ga0209256_100191511 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04752

ChaC

ChaC-like protein

20

194

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9095 151 184
1ks9-assembly1.cif.gz_A ketopantoate reductase from escherichia coli 0.8938 150 184
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.866 151 183
3wfi-assembly1.cif.gz_A the crystal structure of d-mandelate dehydrogenase 0.8632 152 185
3wfj-assembly4.cif.gz_F the complex structure of d-mandelate dehydrogenase with nadh 0.8583 151 185
ID Description Score Start End Superfamily
2ofpB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9345 152 183 1.10.1040.10
af_Q09894_203_321_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9263 149 181 1.10.1040.10
5hwsD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.8836 152 183 1.10.1040.10
af_P39163_42_205_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.8642 14 169 3.10.490.10
af_Q8I2Z9_3_647_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8534 151 179 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A536TRB2-F1-model_v4 Gamma-glutamylcyclotransferase 0.9524 75 183 GO:0006751
GO:0061928
AF-A0A435FYG3-F1-model_v4 Gamma-glutamylcyclotransferase 0.9427 98 185 GO:0006751
GO:0061928
AF-A0A388RHH0-F1-model_v4 deleted 0.9392 99 185
AF-A0A3D3V9J7-F1-model_v4 Gamma-glutamylcyclotransferase 0.9354 98 187 GO:0006751
GO:0061928
AF-A0A424WCN3-F1-model_v4 glutathione-specific gamma-glutamylcyclotransferase (EC 4.3.2.7) 0.935 98 181 GO:0005737
GO:0006751
GO:0061928

Feature Viewer

pLDDT pTM Quality
82.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map