F391043

General Info

Members Datasets Scaffolds Average Seq Length
292 145 292 181

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0828037|Ga0373937_0828037_163_711
Length 182
Sequence MARVPLILSKDQVAPEHHAIVDSIIGSRGALHGPFSVFLHSPEIAGRVAHLGALVRFEGSLDMRVRVLAAMVVAREFEAEYVWGAQTGGARRQNVPEATITAIRQNAPLTGVPPEDAMIIEYTRTLLRKHRIPAAMDKAMRDRFGNDQMIQLTGAIGYYSMLAMTVNACELEAAPGAEVLKV

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10007023 3300003911 Unclassified 2067
2 Ga0058859_11766983 3300004798 Unclassified 1208
3 Ga0058860_12194889 3300004801 Bacteria 4209
4 Ga0070669_100347171 3300005353 Bacteria 1204
5 Ga0070709_10032874 3300005434 Bacteria 3132
6 Ga0070714_100054044 3300005435 Bacteria 3430
7 Ga0070714_100069468 3300005435 Bacteria 3042
8 Ga0070714_100085570 3300005435 Bacteria 2754
9 Ga0070714_100113717 3300005435 Bacteria 2400
10 Ga0070714_100366921 3300005435 Bacteria 1355
11 Ga0070713_100051236 3300005436 Plasmid 3413
12 Ga0070713_100189252 3300005436 Bacteria 1854
13 Ga0070713_100212220 3300005436 Bacteria 1753
14 Ga0070713_100604109 3300005436 Bacteria 1042
15 Ga0070713_100789964 3300005436 Bacteria 910
16 Ga0070713_100810875 3300005436 Bacteria 897
17 Ga0070713_101246878 3300005436 Bacteria 720
18 Ga0070710_10045578 3300005437 Unclassified 2438
19 Ga0070710_10157448 3300005437 Bacteria 1406
20 Ga0070710_10188719 3300005437 Bacteria 1295
21 Ga0070711_100154645 3300005439 Bacteria 1733
22 Ga0070711_100237364 3300005439 Bacteria 1424
23 Ga0070711_100764603 3300005439 Unclassified 817
24 Ga0070708_100011035 3300005445 Bacteria 7339
25 Ga0070708_100107465 3300005445 Bacteria 2561
26 Ga0070681_10463896 3300005458 Unclassified 1179
27 Ga0070685_10658383 3300005466 Bacteria 759
28 Ga0070706_100257070 3300005467 Bacteria 1630
29 Ga0070707_100038959 3300005468 Bacteria 4541
30 Ga0070707_100253516 3300005468 Bacteria 1712
31 Ga0070698_100014951 3300005471 Bacteria 8205
32 Ga0070698_100131779 3300005471 Bacteria 2455
33 Ga0070699_100188606 3300005518 Unclassified 1831
34 Ga0070699_100307883 3300005518 Bacteria 1422
35 Ga0070684_100630051 3300005535 Bacteria 998
36 Ga0070665_100691927 3300005548 Bacteria 1033
37 Ga0070704_100093596 3300005549 Bacteria 2246
38 Ga0068855_101159816 3300005563 Bacteria 805
39 Ga0068855_101229475 3300005563 Unclassified 778
40 Ga0068856_100073362 3300005614 Bacteria 3389
41 Ga0068862_100727835 3300005844 Bacteria 963
42 Ga0081455_10002329 3300005937 Bacteria 22659
43 Ga0081455_10283035 3300005937 Bacteria 1197
44 Ga0081538_10019717 3300005981 Bacteria 4995
45 Ga0081538_10034687 3300005981 Bacteria 3330
46 Ga0081538_10044914 3300005981 Bacteria 2747
47 Ga0081540_1010090 3300005983 Bacteria 6429
48 Ga0081540_1078027 3300005983 Unclassified 1503
49 Ga0081539_10095874 3300005985 Bacteria 1523
50 Ga0070717_10269531 3300006028 Bacteria 1508
51 Ga0070717_10535664 3300006028 Unclassified 1060
52 Ga0070717_10627848 3300006028 Bacteria 975
53 Ga0075432_10229718 3300006058 Bacteria 745
54 Ga0070716_100237065 3300006173 Bacteria 1235
55 Ga0070712_100016876 3300006175 Bacteria 4722
56 Ga0070712_100147284 3300006175 Bacteria 1803
57 Ga0070712_100544820 3300006175 Bacteria 977
58 Ga0068871_100713752 3300006358 Unclassified 919
59 Ga0075428_100002984 3300006844 Bacteria 18435
60 Ga0075428_100020658 3300006844 Bacteria 7291
61 Ga0075428_100640744 3300006844 Unclassified 1134
62 Ga0075428_100831632 3300006844 Bacteria 981
63 Ga0075430_100016566 3300006846 Bacteria 6278
64 Ga0075430_100051075 3300006846 Plasmid 3485
65 Ga0075430_100186035 3300006846 Unclassified 1727
66 Ga0075430_100428617 3300006846 Unclassified 1092
67 Ga0075431_100004342 3300006847 Bacteria 13895
68 Ga0075431_100211637 3300006847 Bacteria 1980
69 Ga0075431_100339470 3300006847 Unclassified 1512
70 Ga0075431_100523123 3300006847 Unclassified 1175
71 Ga0075433_10003852 3300006852 Bacteria 11616
72 Ga0075433_10049284 3300006852 Bacteria 3664
73 Ga0075433_10088797 3300006852 Bacteria 2732
74 Ga0075434_100029386 3300006871 Bacteria 5407
75 Ga0075434_100241264 3300006871 Bacteria 1827
76 Ga0075434_100423776 3300006871 Unclassified 1352
77 Ga0075434_100563722 3300006871 Bacteria 1158
78 Ga0075434_100986497 3300006871 Bacteria 856
79 Ga0075429_100042671 3300006880 Bacteria 3947
80 Ga0075429_100076032 3300006880 Bacteria 2925
81 Ga0075436_100600737 3300006914 Bacteria 811
82 Ga0075435_100003117 3300007076 Bacteria 11199
83 Ga0075435_100011459 3300007076 Bacteria 6525
84 Ga0075435_100068444 3300007076 Bacteria 2892
85 Ga0075435_100744686 3300007076 Bacteria 852
86 Ga0099794_10130406 3300007265 Bacteria 1269
87 Ga0099794_10139507 3300007265 Bacteria 1227
88 Ga0099794_10438453 3300007265 Unclassified 684
89 Ga0099795_10027803 3300007788 Bacteria 1917
90 Ga0111539_10002746 3300009094 Bacteria 23359
91 Ga0111539_10094928 3300009094 Bacteria 3504
92 Ga0111539_10650212 3300009094 Unclassified 1228
93 Ga0111539_11288854 3300009094 Unclassified 848
94 Ga0105245_10688958 3300009098 Bacteria 1054
95 Ga0105247_11261242 3300009101 Bacteria 591
96 Ga0114129_10007733 3300009147 Bacteria 15294
97 Ga0114129_10019045 3300009147 Bacteria 9777
98 Ga0114129_10235719 3300009147 Bacteria 2462
99 Ga0114129_10793378 3300009147 Bacteria 1209
100 Ga0114129_11684696 3300009147 Bacteria 774
101 Ga0105248_10043175 3300009177 Bacteria 5055
102 Ga0105238_10568648 3300009551 Bacteria 1139
103 Ga0099796_10225735 3300010159 Bacteria 769
104 Ga0105239_10199422 3300010375 Bacteria 2242
105 Ga0163162_10183834 3300013306 Bacteria 2217
106 Ga0163162_10287320 3300013306 Bacteria 1776
107 Ga0157380_10474585 3300014326 Bacteria 1208
108 Ga0182008_10012543 3300014497 Bacteria 4472
109 Ga0157379_10029307 3300014968 Bacteria 4894
110 Ga0157376_10135581 3300014969 Bacteria 2202
111 Ga0206356_10525886 3300020070 Bacteria 1153
112 Ga0213874_10175267 3300021377 Unclassified 761
113 Ga0207692_10014715 3300025898 Bacteria 3424
114 Ga0207692_10032322 3300025898 Bacteria 2514
115 Ga0207692_10134529 3300025898 Bacteria 1400
116 Ga0207699_10033545 3300025906 Bacteria 2903
117 Ga0207699_10048678 3300025906 Bacteria 2491
118 Ga0207684_10008748 3300025910 Bacteria 8990
119 Ga0207684_10076416 3300025910 Bacteria 2846
120 Ga0207693_10001346 3300025915 Bacteria 21707
121 Ga0207693_10019762 3300025915 Bacteria 5355
122 Ga0207693_10067942 3300025915 Bacteria 2790
123 Ga0207693_10784625 3300025915 Unclassified 735
124 Ga0207663_10048633 3300025916 Bacteria 2626
125 Ga0207646_10011285 3300025922 Bacteria 8677
126 Ga0207646_10031717 3300025922 Bacteria 4783
127 Ga0207646_10136471 3300025922 Bacteria 2209
128 Ga0207694_10529468 3300025924 Bacteria 988
129 Ga0207687_10724318 3300025927 Bacteria 845
130 Ga0207700_10011538 3300025928 Bacteria 5641
131 Ga0207700_10012671 3300025928 Bacteria 5450
132 Ga0207700_10051686 3300025928 Bacteria 3068
133 Ga0207700_10062833 3300025928 Bacteria 2821
134 Ga0207664_10024804 3300025929 Bacteria 4509
135 Ga0207664_10057743 3300025929 Bacteria 3085
136 Ga0207665_10036772 3300025939 Bacteria 3257
137 Ga0207665_10152429 3300025939 Viruses 1657
138 Ga0207667_10574364 3300025949 Bacteria 1139
139 Ga0207667_11197373 3300025949 Bacteria 739
140 Ga0207640_11232906 3300025981 Unclassified 666
141 Ga0207702_10269808 3300026078 Bacteria 1604
142 Ga0207702_10653218 3300026078 Bacteria 1034
143 Ga0207428_10005402 3300027907 Bacteria 11920
144 Ga0207428_10074027 3300027907 Bacteria 2671
145 Ga0207428_10197476 3300027907 Unclassified 1514
146 Ga0268266_10625327 3300028379 Bacteria 1035
147 Ga0268265_10888526 3300028380 Bacteria 874
148 Ga0265338_10013596 3300028800 Bacteria 9170
149 Ga0265320_10203761 3300031240 Unclassified 883
150 Ga0307408_100160468 3300031548 Bacteria 1785
151 Ga0307406_10242113 3300031901 Unclassified 1353
152 Ga0373941_0096379 3300035115 Bacteria 1023
153 Ga0373953_0091010 3300035117 Bacteria 1276
154 Ga0373957_0015526 3300035120 Bacteria 2623
155 Ga0373960_0180995 3300035121 Bacteria 736
156 Ga0373943_0432881 3300035170 Unclassified 762
157 Ga0373931_0176536 3300035691 Unclassified 1262
158 Ga0373937_0143492 3300036401 Bacteria 2234
159 Ga0373937_0828037 3300036401 Unclassified 874
160 Ga0395905_0861921 3300037471 Bacteria 809
161 Ga0436364_0081218 3300037853 Bacteria 12494
162 Ga0395901_0800902 3300038443 Bacteria 931
163 Ga0436365_0824948 3300039437 Bacteria 2403
164 Ga0436365_1917384 3300039437 Unclassified 902
165 Ga0436360_0252015 3300039438 Bacteria 2673
166 Ga0436360_0393653 3300039438 Bacteria 720
167 Ga0436360_0415270 3300039438 Bacteria 905
168 Ga0436360_1286995 3300039438 Bacteria 2363
169 Ga0436363_0097518 3300039450 Bacteria 1319
170 Ga0436363_1043372 3300039450 Unclassified 704
171 Ga0436363_1051040 3300039450 Bacteria 3738
172 Ga0436363_1699705 3300039450 Unclassified 846
173 Ga0436362_0806138 3300039453 Bacteria 670
174 Ga0436362_0884136 3300039453 Unclassified 1025
175 Ga0439464_0085309 3300042439 Bacteria 947
176 Ga0451577_0184630 3300042876 Unclassified 1881
177 Ga0453683_0088580 3300044673 Bacteria 1940
178 Ga0453683_0219365 3300044673 Bacteria 1209
179 Ga0453683_0532949 3300044673 Bacteria 763
180 Ga0453683_0617249 3300044673 Bacteria 708
181 Ga0451576_0829720 3300045051 Unclassified 970
182 Ga0466958_0669243 3300045836 Bacteria 676
183 Ga0466967_0736989 3300045976 Bacteria 977
184 Ga0466967_1183031 3300045976 Unclassified 762
185 Ga0495592_0040807 3300046454 Bacteria 3481
186 Ga0495592_0516988 3300046454 Bacteria 739
187 Ga0495629_0308485 3300046459 Bacteria 1083
188 Ga0495639_0293150 3300046475 Bacteria 810
189 Ga0495662_0055983 3300046476 Bacteria 1905
190 Ga0495618_0020462 3300046514 Bacteria 4073
191 Ga0495637_0205933 3300046520 Bacteria 721
192 Ga0495586_0197077 3300046535 Bacteria 1141
193 Ga0495667_0012917 3300046559 Bacteria 5660
194 Ga0495634_0081903 3300046642 Bacteria 2110
195 Ga0495635_0036471 3300046663 Bacteria 3408
196 Ga0495658_0700438 3300046683 Unclassified 649
197 Ga0495600_0024071 3300046809 Bacteria 3920
198 Ga0495680_0094697 3300047322 Bacteria 2234
199 Ga0496106_0049249 3300048909 Bacteria 3174
200 Ga0496107_0616419 3300048910 Unclassified 801
201 Ga0496112_0063522 3300048915 Bacteria 3642
202 Ga0496112_0099749 3300048915 Bacteria 2874
203 Ga0496114_1002266 3300048917 Unclassified 718
204 Ga0501298_071676 3300049521 Bacteria 749
205 Ga0501039_0784840 3300049575 Bacteria 743
206 Ga0501040_0586385 3300049576 Bacteria 805
207 Ga0501041_0406809 3300049577 Bacteria 862
208 Ga0501041_0601830 3300049577 Bacteria 702
209 Ga0501042_0422981 3300049578 Bacteria 965
210 Ga0501046_0382735 3300049580 Unclassified 1018
211 Ga0501046_0581260 3300049580 Bacteria 796
212 Ga0501048_0151975 3300049582 Bacteria 1638
213 Ga0501048_0201940 3300049582 Bacteria 1409
214 Ga0501068_0282623 3300049584 Unclassified 1061
215 Ga0501072_0014855 3300049588 Bacteria 5968
216 Ga0501072_0060702 3300049588 Bacteria 2981
217 Ga0501072_0110765 3300049588 Bacteria 2185
218 Ga0501072_0171822 3300049588 Bacteria 1730
219 Ga0501072_0675097 3300049588 Bacteria 813
220 Ga0501072_0890298 3300049588 Unclassified 695
221 Ga0501074_0044241 3300049590 Bacteria 3224
222 Ga0501074_0447412 3300049590 Bacteria 916
223 Ga0501075_0456635 3300049591 Bacteria 974
224 Ga0501075_0487727 3300049591 Bacteria 940
225 Ga0501075_1141246 3300049591 Bacteria 592
226 Ga0501076_0074937 3300049592 Bacteria 2712
227 Ga0501076_0104571 3300049592 Bacteria 2285
228 Ga0501076_0129637 3300049592 Bacteria 2045
229 Ga0501076_0803468 3300049592 Bacteria 776
230 Ga0501077_0031638 3300049593 Bacteria 3367
231 Ga0501077_0134802 3300049593 Bacteria 1566
232 Ga0501077_0426179 3300049593 Bacteria 849
233 Ga0501081_0183882 3300049743 Unclassified 1512
234 Ga0501081_0365604 3300049743 Bacteria 1065
235 Ga0501081_0478336 3300049743 Bacteria 927
236 Ga0501081_0563863 3300049743 Bacteria 851
237 Ga0501035_0887210 3300049822 Bacteria 707
238 Ga0501045_0169617 3300049824 Bacteria 1626
239 Ga0501045_0201952 3300049824 Bacteria 1481
240 nmdc:mga05p37_1216936_c1 3300050507 Bacteria 776
241 nmdc:mga05p37_307675_c1 3300050507 Bacteria 1880
242 nmdc:mga05p37_34559_c1 3300050507 Bacteria 6192
243 nmdc:mga05p37_503868_c1 3300050507 Bacteria 1389
244 nmdc:mga05p37_6286_c1 3300050507 Bacteria 13973
245 nmdc:mga09592_129128_c1 3300050508 Bacteria 2174
246 nmdc:mga09592_32665_c1 3300050508 Bacteria 4339
247 nmdc:mga09592_72724_c1 3300050508 Bacteria 2920
248 nmdc:mga0qj67_1038977_c1 3300050509 Unclassified 642
249 nmdc:mga0qj67_253756_c1 3300050509 Unclassified 1427
250 nmdc:mga0qj67_2959_c1 3300050509 Bacteria 12182
251 nmdc:mga0qj67_396187_c1 3300050509 Bacteria 1114
252 nmdc:mga06r32_120787_c1 3300050510 Bacteria 2584
253 nmdc:mga06r32_166952_c1 3300050510 Bacteria 2184
254 nmdc:mga06r32_23911_c1 3300050510 Bacteria 5663
255 nmdc:mga06r32_341883_c1 3300050510 Bacteria 1481
256 nmdc:mga06r32_359292_c1 3300050510 Bacteria 1440
257 nmdc:mga06r32_47775_c1 3300050510 Bacteria 4089
258 nmdc:mga06r32_662397_c1 3300050510 Bacteria 1011
259 nmdc:mga08y16_285110_c1 3300050511 Bacteria 1703
260 nmdc:mga08y16_364230_c1 3300050511 Unclassified 1484
261 nmdc:mga08y16_3719_c1 3300050511 Bacteria 15885
262 nmdc:mga08y16_520827_c1 3300050511 Bacteria 1206
263 nmdc:mga08y16_526830_c1 3300050511 Unclassified 1198
264 nmdc:mga08y16_913252_c1 3300050511 Bacteria 863
265 nmdc:mga0n895_1920_c1 3300050512 Bacteria 15927
266 nmdc:mga0n895_25024_c1 3300050512 Bacteria 5635
267 nmdc:mga0n895_517513_c1 3300050512 Unclassified 1201
268 nmdc:mga0n895_859427_c1 3300050512 Bacteria 895
269 nmdc:mga0rr50_148143_c1 3300050513 Bacteria 1894
270 nmdc:mga0rr50_1578_c1 3300050513 Bacteria 12573
271 nmdc:mga0rr50_91301_c1 3300050513 Bacteria 2372
272 nmdc:mga08x19_205226_c1 3300050514 Bacteria 1352
273 nmdc:mga08x19_2408_c1 3300050514 Bacteria 11349
274 nmdc:mga08x19_44545_c1 3300050514 Bacteria 2833
275 nmdc:mga0a205_410562_c1 3300050515 Bacteria 1217
276 nmdc:mga0a205_45870_c1 3300050515 Bacteria 4215
277 nmdc:mga0a205_6367_c1 3300050515 Bacteria 10664
278 nmdc:mga0a205_91373_c1 3300050515 Bacteria 2942
279 Ga0495601_0017684 3300053077 Bacteria 4330
280 Ga0495595_0061167 3300053084 Bacteria 1763
281 Ga0495619_0002239 3300053085 Bacteria 12800
282 Ga0495619_0020181 3300053085 Bacteria 4241
283 Ga0501084_0630011 3300054114 Bacteria 906
284 Ga0501084_0804888 3300054114 Bacteria 791
285 Ga0501082_0424711 3300060353 Bacteria 1161
286 Ga0501082_0534890 3300060353 Bacteria 1025
287 Ga0501082_0630277 3300060353 Bacteria 938
288 Ga0501082_1382983 3300060353 Bacteria 615
289 Ga0530510_0009828 3300061734 Bacteria 6713
290 Ga0530510_0106039 3300061734 Bacteria 2057
291 Ga0530510_0389350 3300061734 Bacteria 1050
292 Ga0530510_0570682 3300061734 Unclassified 860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_11197373 Ga0207667_111973732 159
2 3300044673 Ga0453683_0088580 Ga0453683_0088580_281_829 166
3 3300046459 Ga0495629_0308485 Ga0495629_0308485_26_535 169
4 3300046475 Ga0495639_0293150 Ga0495639_0293150_274_783 169
5 3300049591 Ga0501075_1141246 Ga0501075_1141246_33_542 169
6 3300050509 nmdc:mga0qj67_253756_c1 nmdc:mga0qj67_253756_c1_838_1347 169
7 3300050511 nmdc:mga08y16_364230_c1 nmdc:mga08y16_364230_c1_419_928 169
8 3300005467 Ga0070706_100257070 Ga0070706_1002570702 180
9 3300005468 Ga0070707_100253516 Ga0070707_1002535161 180
10 3300007265 Ga0099794_10139507 Ga0099794_101395072 180
11 3300009147 Ga0114129_10793378 Ga0114129_107933782 180
12 3300025922 Ga0207646_10136471 Ga0207646_101364712 180
13 3300003911 JGI25405J52794_10007023 JGI25405J52794_100070231 181
14 3300004798 Ga0058859_11766983 Ga0058859_117669831 181
15 3300004801 Ga0058860_12194889 Ga0058860_121948893 181
16 3300005353 Ga0070669_100347171 Ga0070669_1003471712 181
17 3300005434 Ga0070709_10032874 Ga0070709_100328744 181
18 3300005435 Ga0070714_100054044 Ga0070714_1000540442 181
19 3300005435 Ga0070714_100069468 Ga0070714_1000694683 181
20 3300005435 Ga0070714_100085570 Ga0070714_1000855702 181
21 3300005435 Ga0070714_100113717 Ga0070714_1001137171 181
22 3300005435 Ga0070714_100366921 Ga0070714_1003669212 181
23 3300005436 Ga0070713_100051236 Ga0070713_1000512362 181
24 3300005436 Ga0070713_100189252 Ga0070713_1001892522 181
25 3300005436 Ga0070713_100212220 Ga0070713_1002122202 181
26 3300005436 Ga0070713_100604109 Ga0070713_1006041091 181
27 3300005436 Ga0070713_100789964 Ga0070713_1007899642 181
28 3300005436 Ga0070713_100810875 Ga0070713_1008108751 181
29 3300005436 Ga0070713_101246878 Ga0070713_1012468781 181
30 3300005437 Ga0070710_10045578 Ga0070710_100455782 181
31 3300005437 Ga0070710_10157448 Ga0070710_101574482 181
32 3300005437 Ga0070710_10188719 Ga0070710_101887192 181
33 3300005439 Ga0070711_100154645 Ga0070711_1001546451 181
34 3300005439 Ga0070711_100237364 Ga0070711_1002373641 181
35 3300005439 Ga0070711_100764603 Ga0070711_1007646031 181
36 3300005445 Ga0070708_100011035 Ga0070708_1000110355 181
37 3300005445 Ga0070708_100107465 Ga0070708_1001074652 181
38 3300005458 Ga0070681_10463896 Ga0070681_104638962 181
39 3300005466 Ga0070685_10658383 Ga0070685_106583831 181
40 3300005468 Ga0070707_100038959 Ga0070707_1000389595 181
41 3300005471 Ga0070698_100014951 Ga0070698_1000149514 181
42 3300005471 Ga0070698_100131779 Ga0070698_1001317793 181
43 3300005518 Ga0070699_100188606 Ga0070699_1001886063 181
44 3300005518 Ga0070699_100307883 Ga0070699_1003078832 181
45 3300005535 Ga0070684_100630051 Ga0070684_1006300512 181
46 3300005548 Ga0070665_100691927 Ga0070665_1006919271 181
47 3300005549 Ga0070704_100093596 Ga0070704_1000935963 181
48 3300005563 Ga0068855_101159816 Ga0068855_1011598162 181
49 3300005563 Ga0068855_101229475 Ga0068855_1012294751 181
50 3300005614 Ga0068856_100073362 Ga0068856_1000733624 181
51 3300005844 Ga0068862_100727835 Ga0068862_1007278352 181
52 3300005937 Ga0081455_10002329 Ga0081455_100023299 181
53 3300005937 Ga0081455_10283035 Ga0081455_102830352 181
54 3300005981 Ga0081538_10019717 Ga0081538_100197172 181
55 3300005981 Ga0081538_10034687 Ga0081538_100346873 181
56 3300005981 Ga0081538_10044914 Ga0081538_100449143 181
57 3300005983 Ga0081540_1010090 Ga0081540_10100903 181
58 3300005983 Ga0081540_1078027 Ga0081540_10780272 181
59 3300005985 Ga0081539_10095874 Ga0081539_100958742 181
60 3300006028 Ga0070717_10269531 Ga0070717_102695312 181
61 3300006028 Ga0070717_10535664 Ga0070717_105356642 181
62 3300006028 Ga0070717_10627848 Ga0070717_106278482 181
63 3300006058 Ga0075432_10229718 Ga0075432_102297181 181
64 3300006173 Ga0070716_100237065 Ga0070716_1002370652 181
65 3300006175 Ga0070712_100016876 Ga0070712_1000168767 181
66 3300006175 Ga0070712_100147284 Ga0070712_1001472842 181
67 3300006175 Ga0070712_100544820 Ga0070712_1005448202 181
68 3300006358 Ga0068871_100713752 Ga0068871_1007137522 181
69 3300006844 Ga0075428_100002984 Ga0075428_10000298417 181
70 3300006844 Ga0075428_100020658 Ga0075428_1000206587 181
71 3300006844 Ga0075428_100640744 Ga0075428_1006407442 181
72 3300006844 Ga0075428_100831632 Ga0075428_1008316321 181
73 3300006846 Ga0075430_100016566 Ga0075430_1000165668 181
74 3300006846 Ga0075430_100051075 Ga0075430_1000510754 181
75 3300006846 Ga0075430_100186035 Ga0075430_1001860352 181
76 3300006846 Ga0075430_100428617 Ga0075430_1004286171 181
77 3300006847 Ga0075431_100004342 Ga0075431_10000434214 181
78 3300006847 Ga0075431_100211637 Ga0075431_1002116372 181
79 3300006847 Ga0075431_100339470 Ga0075431_1003394702 181
80 3300006847 Ga0075431_100523123 Ga0075431_1005231231 181
81 3300006852 Ga0075433_10003852 Ga0075433_100038527 181
82 3300006852 Ga0075433_10049284 Ga0075433_100492841 181
83 3300006852 Ga0075433_10088797 Ga0075433_100887972 181
84 3300006871 Ga0075434_100029386 Ga0075434_1000293864 181
85 3300006871 Ga0075434_100241264 Ga0075434_1002412642 181
86 3300006871 Ga0075434_100423776 Ga0075434_1004237762 181
87 3300006871 Ga0075434_100563722 Ga0075434_1005637222 181
88 3300006871 Ga0075434_100986497 Ga0075434_1009864971 181
89 3300006880 Ga0075429_100042671 Ga0075429_1000426715 181
90 3300006880 Ga0075429_100076032 Ga0075429_1000760322 181
91 3300006914 Ga0075436_100600737 Ga0075436_1006007372 181
92 3300007076 Ga0075435_100003117 Ga0075435_10000311712 181
93 3300007076 Ga0075435_100011459 Ga0075435_1000114593 181
94 3300007076 Ga0075435_100068444 Ga0075435_1000684443 181
95 3300007076 Ga0075435_100744686 Ga0075435_1007446861 181
96 3300007265 Ga0099794_10130406 Ga0099794_101304062 181
97 3300007265 Ga0099794_10438453 Ga0099794_104384531 181
98 3300007788 Ga0099795_10027803 Ga0099795_100278031 181
99 3300009094 Ga0111539_10002746 Ga0111539_1000274617 181
100 3300009094 Ga0111539_10094928 Ga0111539_100949283 181
101 3300009094 Ga0111539_10650212 Ga0111539_106502122 181
102 3300009094 Ga0111539_11288854 Ga0111539_112888542 181
103 3300009098 Ga0105245_10688958 Ga0105245_106889582 181
104 3300009101 Ga0105247_11261242 Ga0105247_112612421 181
105 3300009147 Ga0114129_10007733 Ga0114129_1000773312 181
106 3300009147 Ga0114129_10019045 Ga0114129_100190459 181
107 3300009147 Ga0114129_10235719 Ga0114129_102357193 181
108 3300009147 Ga0114129_11684696 Ga0114129_116846961 181
109 3300009177 Ga0105248_10043175 Ga0105248_100431755 181
110 3300009551 Ga0105238_10568648 Ga0105238_105686482 181
111 3300010159 Ga0099796_10225735 Ga0099796_102257351 181
112 3300010375 Ga0105239_10199422 Ga0105239_101994223 181
113 3300013306 Ga0163162_10183834 Ga0163162_101838342 181
114 3300013306 Ga0163162_10287320 Ga0163162_102873201 181
115 3300014326 Ga0157380_10474585 Ga0157380_104745852 181
116 3300014497 Ga0182008_10012543 Ga0182008_100125432 181
117 3300014968 Ga0157379_10029307 Ga0157379_100293072 181
118 3300014969 Ga0157376_10135581 Ga0157376_101355812 181
119 3300020070 Ga0206356_10525886 Ga0206356_105258862 181
120 3300021377 Ga0213874_10175267 Ga0213874_101752671 181
121 3300025898 Ga0207692_10014715 Ga0207692_100147154 181
122 3300025898 Ga0207692_10032322 Ga0207692_100323223 181
123 3300025898 Ga0207692_10134529 Ga0207692_101345292 181
124 3300025906 Ga0207699_10033545 Ga0207699_100335454 181
125 3300025906 Ga0207699_10048678 Ga0207699_100486783 181
126 3300025910 Ga0207684_10008748 Ga0207684_100087489 181
127 3300025910 Ga0207684_10076416 Ga0207684_100764162 181
128 3300025915 Ga0207693_10001346 Ga0207693_1000134620 181
129 3300025915 Ga0207693_10019762 Ga0207693_100197623 181
130 3300025915 Ga0207693_10067942 Ga0207693_100679422 181
131 3300025915 Ga0207693_10784625 Ga0207693_107846251 181
132 3300025916 Ga0207663_10048633 Ga0207663_100486332 181
133 3300025922 Ga0207646_10011285 Ga0207646_100112856 181
134 3300025922 Ga0207646_10031717 Ga0207646_100317175 181
135 3300025924 Ga0207694_10529468 Ga0207694_105294682 181
136 3300025927 Ga0207687_10724318 Ga0207687_107243182 181
137 3300025928 Ga0207700_10011538 Ga0207700_100115382 181
138 3300025928 Ga0207700_10012671 Ga0207700_100126714 181
139 3300025928 Ga0207700_10051686 Ga0207700_100516865 181
140 3300025928 Ga0207700_10062833 Ga0207700_100628331 181
141 3300025929 Ga0207664_10024804 Ga0207664_100248043 181
142 3300025929 Ga0207664_10057743 Ga0207664_100577434 181
143 3300025939 Ga0207665_10036772 Ga0207665_100367724 181
144 3300025939 Ga0207665_10152429 Ga0207665_101524291 181
145 3300025949 Ga0207667_10574364 Ga0207667_105743642 181
146 3300025981 Ga0207640_11232906 Ga0207640_112329061 181
147 3300026078 Ga0207702_10269808 Ga0207702_102698082 181
148 3300026078 Ga0207702_10653218 Ga0207702_106532182 181
149 3300027907 Ga0207428_10005402 Ga0207428_100054027 181
150 3300027907 Ga0207428_10074027 Ga0207428_100740272 181
151 3300027907 Ga0207428_10197476 Ga0207428_101974761 181
152 3300028379 Ga0268266_10625327 Ga0268266_106253271 181
153 3300028380 Ga0268265_10888526 Ga0268265_108885262 181
154 3300028800 Ga0265338_10013596 Ga0265338_1001359611 181
155 3300031240 Ga0265320_10203761 Ga0265320_102037611 181
156 3300031548 Ga0307408_100160468 Ga0307408_1001604683 181
157 3300031901 Ga0307406_10242113 Ga0307406_102421131 181
158 3300035115 Ga0373941_0096379 Ga0373941_0096379_421_966 181
159 3300035117 Ga0373953_0091010 Ga0373953_0091010_41_586 181
160 3300035120 Ga0373957_0015526 Ga0373957_0015526_412_957 181
161 3300035121 Ga0373960_0180995 Ga0373960_0180995_103_648 181
162 3300035170 Ga0373943_0432881 Ga0373943_0432881_98_643 181
163 3300035691 Ga0373931_0176536 Ga0373931_0176536_180_725 181
164 3300036401 Ga0373937_0143492 Ga0373937_0143492_798_1343 181
165 3300036401 Ga0373937_0828037 Ga0373937_0828037_163_711 181
166 3300037471 Ga0395905_0861921 Ga0395905_0861921_99_644 181
167 3300037853 Ga0436364_0081218 Ga0436364_0081218_652_1197 181
168 3300038443 Ga0395901_0800902 Ga0395901_0800902_224_781 181
169 3300039437 Ga0436365_0824948 Ga0436365_0824948_247_792 181
170 3300039437 Ga0436365_1917384 Ga0436365_1917384_267_851 181
171 3300039438 Ga0436360_0252015 Ga0436360_0252015_141_686 181
172 3300039438 Ga0436360_0393653 Ga0436360_0393653_98_643 181
173 3300039438 Ga0436360_0415270 Ga0436360_0415270_89_706 181
174 3300039438 Ga0436360_1286995 Ga0436360_1286995_953_1498 181
175 3300039450 Ga0436363_0097518 Ga0436363_0097518_289_834 181
176 3300039450 Ga0436363_1043372 Ga0436363_1043372_64_609 181
177 3300039450 Ga0436363_1051040 Ga0436363_1051040_67_612 181
178 3300039450 Ga0436363_1699705 Ga0436363_1699705_72_656 181
179 3300039453 Ga0436362_0806138 Ga0436362_0806138_53_598 181
180 3300039453 Ga0436362_0884136 Ga0436362_0884136_225_770 181
181 3300042439 Ga0439464_0085309 Ga0439464_0085309_91_636 181
182 3300042876 Ga0451577_0184630 Ga0451577_0184630_745_1290 181
183 3300044673 Ga0453683_0219365 Ga0453683_0219365_557_1102 181
184 3300044673 Ga0453683_0532949 Ga0453683_0532949_33_590 181
185 3300044673 Ga0453683_0617249 Ga0453683_0617249_115_660 181
186 3300045051 Ga0451576_0829720 Ga0451576_0829720_15_560 181
187 3300045836 Ga0466958_0669243 Ga0466958_0669243_80_625 181
188 3300045976 Ga0466967_0736989 Ga0466967_0736989_88_633 181
189 3300045976 Ga0466967_1183031 Ga0466967_1183031_144_689 181
190 3300046454 Ga0495592_0040807 Ga0495592_0040807_57_602 181
191 3300046454 Ga0495592_0516988 Ga0495592_0516988_179_724 181
192 3300046476 Ga0495662_0055983 Ga0495662_0055983_1143_1688 181
193 3300046514 Ga0495618_0020462 Ga0495618_0020462_1070_1615 181
194 3300046520 Ga0495637_0205933 Ga0495637_0205933_102_647 181
195 3300046535 Ga0495586_0197077 Ga0495586_0197077_504_1049 181
196 3300046559 Ga0495667_0012917 Ga0495667_0012917_2921_3466 181
197 3300046642 Ga0495634_0081903 Ga0495634_0081903_481_1026 181
198 3300046663 Ga0495635_0036471 Ga0495635_0036471_653_1198 181
199 3300046683 Ga0495658_0700438 Ga0495658_0700438_89_634 181
200 3300046809 Ga0495600_0024071 Ga0495600_0024071_255_800 181
201 3300047322 Ga0495680_0094697 Ga0495680_0094697_986_1531 181
202 3300048909 Ga0496106_0049249 Ga0496106_0049249_1465_2013 181
203 3300048910 Ga0496107_0616419 Ga0496107_0616419_137_685 181
204 3300048915 Ga0496112_0063522 Ga0496112_0063522_289_834 181
205 3300048915 Ga0496112_0099749 Ga0496112_0099749_2233_2778 181
206 3300048917 Ga0496114_1002266 Ga0496114_1002266_117_665 181
207 3300049521 Ga0501298_071676 Ga0501298_071676_152_700 181
208 3300049575 Ga0501039_0784840 Ga0501039_0784840_188_733 181
209 3300049576 Ga0501040_0586385 Ga0501040_0586385_161_709 181
210 3300049577 Ga0501041_0406809 Ga0501041_0406809_297_842 181
211 3300049577 Ga0501041_0601830 Ga0501041_0601830_13_561 181
212 3300049578 Ga0501042_0422981 Ga0501042_0422981_350_895 181
213 3300049580 Ga0501046_0382735 Ga0501046_0382735_177_722 181
214 3300049580 Ga0501046_0581260 Ga0501046_0581260_86_631 181
215 3300049582 Ga0501048_0151975 Ga0501048_0151975_1059_1604 181
216 3300049582 Ga0501048_0201940 Ga0501048_0201940_807_1355 181
217 3300049584 Ga0501068_0282623 Ga0501068_0282623_169_717 181
218 3300049588 Ga0501072_0014855 Ga0501072_0014855_610_1158 181
219 3300049588 Ga0501072_0060702 Ga0501072_0060702_2077_2622 181
220 3300049588 Ga0501072_0110765 Ga0501072_0110765_1215_1763 181
221 3300049588 Ga0501072_0171822 Ga0501072_0171822_588_1133 181
222 3300049588 Ga0501072_0675097 Ga0501072_0675097_42_587 181
223 3300049588 Ga0501072_0890298 Ga0501072_0890298_138_683 181
224 3300049590 Ga0501074_0044241 Ga0501074_0044241_993_1553 181
225 3300049590 Ga0501074_0447412 Ga0501074_0447412_181_729 181
226 3300049591 Ga0501075_0456635 Ga0501075_0456635_71_619 181
227 3300049591 Ga0501075_0487727 Ga0501075_0487727_274_819 181
228 3300049592 Ga0501076_0074937 Ga0501076_0074937_954_1502 181
229 3300049592 Ga0501076_0104571 Ga0501076_0104571_222_767 181
230 3300049592 Ga0501076_0129637 Ga0501076_0129637_701_1249 181
231 3300049592 Ga0501076_0803468 Ga0501076_0803468_62_607 181
232 3300049593 Ga0501077_0031638 Ga0501077_0031638_535_1083 181
233 3300049593 Ga0501077_0134802 Ga0501077_0134802_603_1151 181
234 3300049593 Ga0501077_0426179 Ga0501077_0426179_95_640 181
235 3300049743 Ga0501081_0183882 Ga0501081_0183882_281_826 181
236 3300049743 Ga0501081_0365604 Ga0501081_0365604_197_796 181
237 3300049743 Ga0501081_0478336 Ga0501081_0478336_141_689 181
238 3300049743 Ga0501081_0563863 Ga0501081_0563863_149_697 181
239 3300049822 Ga0501035_0887210 Ga0501035_0887210_12_557 181
240 3300049824 Ga0501045_0169617 Ga0501045_0169617_438_983 181
241 3300049824 Ga0501045_0201952 Ga0501045_0201952_436_981 181
242 3300050507 nmdc:mga05p37_1216936_c1 nmdc:mga05p37_1216936_c1_150_695 181
243 3300050507 nmdc:mga05p37_307675_c1 nmdc:mga05p37_307675_c1_798_1343 181
244 3300050507 nmdc:mga05p37_34559_c1 nmdc:mga05p37_34559_c1_1967_2515 181
245 3300050507 nmdc:mga05p37_503868_c1 nmdc:mga05p37_503868_c1_639_1184 181
246 3300050507 nmdc:mga05p37_6286_c1 nmdc:mga05p37_6286_c1_2091_2642 181
247 3300050508 nmdc:mga09592_129128_c1 nmdc:mga09592_129128_c1_277_822 181
248 3300050508 nmdc:mga09592_32665_c1 nmdc:mga09592_32665_c1_429_977 181
249 3300050508 nmdc:mga09592_72724_c1 nmdc:mga09592_72724_c1_1097_1642 181
250 3300050509 nmdc:mga0qj67_1038977_c1 nmdc:mga0qj67_1038977_c1_78_623 181
251 3300050509 nmdc:mga0qj67_2959_c1 nmdc:mga0qj67_2959_c1_570_1118 181
252 3300050509 nmdc:mga0qj67_396187_c1 nmdc:mga0qj67_396187_c1_505_1050 181
253 3300050510 nmdc:mga06r32_120787_c1 nmdc:mga06r32_120787_c1_1209_1754 181
254 3300050510 nmdc:mga06r32_166952_c1 nmdc:mga06r32_166952_c1_506_1051 181
255 3300050510 nmdc:mga06r32_23911_c1 nmdc:mga06r32_23911_c1_943_1491 181
256 3300050510 nmdc:mga06r32_341883_c1 nmdc:mga06r32_341883_c1_468_1013 181
257 3300050510 nmdc:mga06r32_359292_c1 nmdc:mga06r32_359292_c1_61_606 181
258 3300050510 nmdc:mga06r32_47775_c1 nmdc:mga06r32_47775_c1_260_805 181
259 3300050510 nmdc:mga06r32_662397_c1 nmdc:mga06r32_662397_c1_120_665 181
260 3300050511 nmdc:mga08y16_285110_c1 nmdc:mga08y16_285110_c1_800_1348 181
261 3300050511 nmdc:mga08y16_3719_c1 nmdc:mga08y16_3719_c1_11040_11585 181
262 3300050511 nmdc:mga08y16_520827_c1 nmdc:mga08y16_520827_c1_197_742 181
263 3300050511 nmdc:mga08y16_526830_c1 nmdc:mga08y16_526830_c1_229_774 181
264 3300050511 nmdc:mga08y16_913252_c1 nmdc:mga08y16_913252_c1_134_679 181
265 3300050512 nmdc:mga0n895_1920_c1 nmdc:mga0n895_1920_c1_10701_11252 181
266 3300050512 nmdc:mga0n895_25024_c1 nmdc:mga0n895_25024_c1_2287_2832 181
267 3300050512 nmdc:mga0n895_517513_c1 nmdc:mga0n895_517513_c1_480_1025 181
268 3300050512 nmdc:mga0n895_859427_c1 nmdc:mga0n895_859427_c1_105_650 181
269 3300050513 nmdc:mga0rr50_148143_c1 nmdc:mga0rr50_148143_c1_698_1243 181
270 3300050513 nmdc:mga0rr50_1578_c1 nmdc:mga0rr50_1578_c1_9490_10041 181
271 3300050513 nmdc:mga0rr50_91301_c1 nmdc:mga0rr50_91301_c1_1669_2214 181
272 3300050514 nmdc:mga08x19_205226_c1 nmdc:mga08x19_205226_c1_556_1101 181
273 3300050514 nmdc:mga08x19_2408_c1 nmdc:mga08x19_2408_c1_1309_1860 181
274 3300050514 nmdc:mga08x19_44545_c1 nmdc:mga08x19_44545_c1_1129_1674 181
275 3300050515 nmdc:mga0a205_410562_c1 nmdc:mga0a205_410562_c1_458_1003 181
276 3300050515 nmdc:mga0a205_45870_c1 nmdc:mga0a205_45870_c1_341_886 181
277 3300050515 nmdc:mga0a205_6367_c1 nmdc:mga0a205_6367_c1_3978_4529 181
278 3300050515 nmdc:mga0a205_91373_c1 nmdc:mga0a205_91373_c1_2125_2670 181
279 3300053077 Ga0495601_0017684 Ga0495601_0017684_1083_1628 181
280 3300053084 Ga0495595_0061167 Ga0495595_0061167_547_1092 181
281 3300053085 Ga0495619_0002239 Ga0495619_0002239_5742_6287 181
282 3300053085 Ga0495619_0020181 Ga0495619_0020181_3562_4107 181
283 3300054114 Ga0501084_0630011 Ga0501084_0630011_257_805 181
284 3300054114 Ga0501084_0804888 Ga0501084_0804888_76_624 181
285 3300060353 Ga0501082_0424711 Ga0501082_0424711_32_580 181
286 3300060353 Ga0501082_0534890 Ga0501082_0534890_465_1010 181
287 3300060353 Ga0501082_0630277 Ga0501082_0630277_93_638 181
288 3300060353 Ga0501082_1382983 Ga0501082_1382983_40_585 181
289 3300061734 Ga0530510_0009828 Ga0530510_0009828_3927_4472 181
290 3300061734 Ga0530510_0106039 Ga0530510_0106039_608_1156 181
291 3300061734 Ga0530510_0389350 Ga0530510_0389350_216_761 181
292 3300061734 Ga0530510_0570682 Ga0530510_0570682_20_601 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

42

120

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8752 38 174
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8695 38 173
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8496 41 167
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.8272 3 174
3lvy-assembly2.cif.gz_D crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.8238 7 174
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8855 35 178 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8773 47 173 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8771 43 173 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8714 38 176 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8708 39 169 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A1F4D2C5-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9986 1 181 GO:0003677
GO:0051920
AF-A0A1F4D2C5-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9932 1 181 GO:0003677
GO:0051920
AF-W4LIV0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9925 1 172 GO:0051920
AF-A0A2V6X7E7-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9921 1 181 GO:0051920
AF-W4LIV0-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9868 1 172 GO:0051920

Feature Viewer

pLDDT pTM Quality
96.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map