F391020

General Info

Members Datasets Scaffolds Average Seq Length
292 178 584 112

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10094314|Ga0307407_100943143
Length 132
Sequence MRYLLTIYGDESGWNDATPEQVGAIMAAYGAFGEKAQAAGVMLGGEGLQTSDSATTIRVRDGETLTTDGPFAETREQLGGYYLLECNDLDEAIGWAAQIPGAQDGCVEVRPVMDYAAMGDTEPQAAAEGANR

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 2.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.16
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10094314 3300031903 Bacteria 1842
2 JGI25407J50210_10008259 3300003373 Bacteria 2622
3 Ga0070658_10363465 3300005327 Bacteria 1240
4 Ga0070658_10691036 3300005327 Bacteria 885
5 Ga0070658_11943828 3300005327 Bacteria 508
6 Ga0070658_11994336 3300005327 Bacteria 501
7 Ga0070683_100054526 3300005329 Bacteria 3707
8 Ga0070683_100057478 3300005329 Bacteria 3614
9 Ga0070683_100439000 3300005329 Bacteria 1245
10 Ga0070683_100691753 3300005329 Bacteria 976
11 Ga0070680_100943687 3300005336 Unclassified 745
12 Ga0070682_100077442 3300005337 Bacteria 2143
13 Ga0070660_100009895 3300005339 Bacteria 6726
14 Ga0070660_100023521 3300005339 Bacteria 4564
15 Ga0070660_100391752 3300005339 Bacteria 1148
16 Ga0070661_100018083 3300005344 Bacteria 5007
17 Ga0070661_100024775 3300005344 Bacteria 4306
18 Ga0070661_100316720 3300005344 Bacteria 1217
19 Ga0070661_100338514 3300005344 Bacteria 1178
20 Ga0070661_101925952 3300005344 Bacteria 503
21 Ga0070659_100164887 3300005366 Bacteria 1813
22 Ga0070659_100230006 3300005366 Bacteria 1532
23 Ga0070659_100620369 3300005366 Bacteria 931
24 Ga0070709_10443242 3300005434 Bacteria 977
25 Ga0070709_11441695 3300005434 Unclassified 558
26 Ga0070714_100037311 3300005435 Bacteria 4083
27 Ga0070714_100165368 3300005435 Bacteria 2005
28 Ga0070714_101083194 3300005435 Bacteria 781
29 Ga0070713_102155854 3300005436 Unclassified 540
30 Ga0070711_100294636 3300005439 Bacteria 1288
31 Ga0070708_100167508 3300005445 Bacteria 2050
32 Ga0070663_100250375 3300005455 Bacteria 1402
33 Ga0070681_10006125 3300005458 Bacteria 11675
34 Ga0070681_10072498 3300005458 Bacteria 3407
35 Ga0070681_11173071 3300005458 Bacteria 690
36 Ga0070706_100146485 3300005467 Bacteria 2205
37 Ga0070707_100008146 3300005468 Bacteria 9723
38 Ga0070707_100491957 3300005468 Bacteria 1188
39 Ga0070698_100153037 3300005471 Bacteria 2253
40 Ga0070679_100083064 3300005530 Bacteria 3192
41 Ga0070679_100270773 3300005530 Bacteria 1652
42 Ga0070684_100042134 3300005535 Bacteria 3940
43 Ga0070684_100204748 3300005535 Bacteria 1798
44 Ga0068853_100121232 3300005539 Bacteria 2333
45 Ga0070696_100216292 3300005546 Bacteria 1436
46 Ga0070693_100226051 3300005547 Bacteria 1229
47 Ga0068855_100053846 3300005563 Bacteria 4733
48 Ga0068855_100115993 3300005563 Bacteria 3069
49 Ga0068855_100137883 3300005563 Bacteria 2783
50 Ga0070664_100618095 3300005564 Bacteria 1006
51 Ga0070664_101452562 3300005564 Bacteria 649
52 Ga0068857_100501988 3300005577 Bacteria 1139
53 Ga0068857_101876370 3300005577 Bacteria 587
54 Ga0068854_100223199 3300005578 Bacteria 1492
55 Ga0068856_100083664 3300005614 Bacteria 3169
56 Ga0068856_100115271 3300005614 Bacteria 2686
57 Ga0068852_100003964 3300005616 Bacteria 10400
58 Ga0068851_10201855 3300005834 Bacteria 1110
59 Ga0081538_10012663 3300005981 Bacteria 6745
60 Ga0081538_10109521 3300005981 Bacteria 1360
61 Ga0075434_100644248 3300006871 Bacteria 1078
62 Ga0075435_101261245 3300007076 Bacteria 647
63 Ga0105240_10508482 3300009093 Bacteria 1338
64 Ga0105240_10698304 3300009093 Bacteria 1108
65 Ga0105245_10002719 3300009098 Bacteria 15915
66 Ga0105245_10371130 3300009098 Bacteria 1422
67 Ga0105245_11126798 3300009098 Bacteria 831
68 Ga0105241_10003410 3300009174 Bacteria 11829
69 Ga0105241_10491196 3300009174 Bacteria 1093
70 Ga0105241_10921469 3300009174 Bacteria 813
71 Ga0105237_10003715 3300009545 Bacteria 17976
72 Ga0105237_10060154 3300009545 Bacteria 3800
73 Ga0105237_10540448 3300009545 Bacteria 1172
74 Ga0105237_11156607 3300009545 Bacteria 780
75 Ga0105238_10035210 3300009551 Bacteria 5091
76 Ga0105239_10807962 3300010375 Bacteria 1075
77 Ga0105239_10924788 3300010375 Bacteria 1001
78 Ga0157370_10203467 3300013104 Bacteria 1836
79 Ga0157369_10206806 3300013105 Bacteria 2058
80 Ga0157369_10760680 3300013105 Bacteria 996
81 Ga0157374_10114539 3300013296 Bacteria 2596
82 Ga0157372_10812555 3300013307 Bacteria 1086
83 Ga0157372_11569512 3300013307 Bacteria 758
84 Ga0157372_12524517 3300013307 Bacteria 590
85 Ga0182008_10687298 3300014497 Bacteria 583
86 Ga0182008_10816342 3300014497 Bacteria 542
87 Ga0157376_10013807 3300014969 Bacteria 6038
88 Ga0206356_10450769 3300020070 Bacteria 1049
89 Ga0206356_11462718 3300020070 Bacteria 2477
90 Ga0206354_10653384 3300020081 Bacteria 685
91 Ga0206354_10948981 3300020081 Bacteria 4733
92 Ga0206353_10510998 3300020082 Bacteria 3200
93 Ga0213874_10042945 3300021377 Bacteria 1360
94 Ga0224712_10268460 3300022467 Bacteria 792
95 Ga0207656_10184350 3300025321 Bacteria 1003
96 Ga0207692_10116523 3300025898 Bacteria 1490
97 Ga0207699_10208812 3300025906 Bacteria 1327
98 Ga0207705_10954783 3300025909 Bacteria 663
99 Ga0207684_10093446 3300025910 Bacteria 2565
100 Ga0207684_10813848 3300025910 Bacteria 789
101 Ga0207654_10095581 3300025911 Bacteria 1820
102 Ga0207654_10530499 3300025911 Bacteria 834
103 Ga0207707_10016226 3300025912 Bacteria 6498
104 Ga0207707_10024455 3300025912 Bacteria 5285
105 Ga0207707_10059084 3300025912 Bacteria 3336
106 Ga0207707_10065472 3300025912 Bacteria 3165
107 Ga0207707_10101086 3300025912 Bacteria 2520
108 Ga0207695_10698493 3300025913 Bacteria 895
109 Ga0207671_10001958 3300025914 Bacteria 22715
110 Ga0207663_10853638 3300025916 Bacteria 727
111 Ga0207660_10577501 3300025917 Bacteria 915
112 Ga0207660_10884997 3300025917 Bacteria 729
113 Ga0207657_10006020 3300025919 Bacteria 12619
114 Ga0207657_10036429 3300025919 Bacteria 4403
115 Ga0207657_10082895 3300025919 Bacteria 2691
116 Ga0207649_10022568 3300025920 Bacteria 3637
117 Ga0207649_10280184 3300025920 Bacteria 1212
118 Ga0207649_10346238 3300025920 Bacteria 1099
119 Ga0207649_10696214 3300025920 Bacteria 788
120 Ga0207649_11051149 3300025920 Bacteria 642
121 Ga0207649_11415749 3300025920 Bacteria 550
122 Ga0207652_10018379 3300025921 Bacteria 5732
123 Ga0207652_10529065 3300025921 Bacteria 1060
124 Ga0207646_10056810 3300025922 Bacteria 3498
125 Ga0207694_10111812 3300025924 Bacteria 2173
126 Ga0207687_10004864 3300025927 Bacteria 8930
127 Ga0207687_10118866 3300025927 Bacteria 1973
128 Ga0207664_10629970 3300025929 Bacteria 963
129 Ga0207690_10101741 3300025932 Bacteria 2053
130 Ga0207661_10106533 3300025944 Bacteria 2363
131 Ga0207661_10140495 3300025944 Bacteria 2078
132 Ga0207661_11311244 3300025944 Bacteria 665
133 Ga0207679_10009680 3300025945 Bacteria 6178
134 Ga0207679_10277062 3300025945 Bacteria 1437
135 Ga0207667_10171931 3300025949 Bacteria 2226
136 Ga0207667_10446687 3300025949 Bacteria 1314
137 Ga0207712_10572361 3300025961 Bacteria 974
138 Ga0207640_10514015 3300025981 Bacteria 1000
139 Ga0207639_10137780 3300026041 Bacteria 2029
140 Ga0207639_11259769 3300026041 Bacteria 694
141 Ga0207678_10903629 3300026067 Bacteria 781
142 Ga0207702_10489594 3300026078 Bacteria 1198
143 Ga0207702_11327919 3300026078 Bacteria 713
144 Ga0207674_10004721 3300026116 Bacteria 16335
145 Ga0207674_10019068 3300026116 Bacteria 7435
146 Ga0207698_10048193 3300026142 Bacteria 3233
147 Ga0268266_10397844 3300028379 Bacteria 1302
148 Ga0265338_10113648 3300028800 Bacteria 2175
149 Ga0307405_10600598 3300031731 Bacteria 898
150 Ga0307416_100053242 3300032002 Bacteria 3246
151 Ga0307414_10407775 3300032004 Bacteria 1182
152 Ga0307415_100802741 3300032126 Bacteria 859
153 Ga0395900_0286124 3300037418 Bacteria 1639
154 Ga0395898_0497685 3300037466 Bacteria 1159
155 Ga0395905_0477078 3300037471 Bacteria 1146
156 Ga0395905_0597199 3300037471 Bacteria 1006
157 Ga0436364_0566576 3300037853 Bacteria 664
158 Ga0395901_0349649 3300038443 Bacteria 1526
159 Ga0395901_0548948 3300038443 Bacteria 1171
160 Ga0395901_1350856 3300038443 Bacteria 673
161 Ga0436365_1025929 3300039437 Bacteria 1190
162 Ga0436365_1116954 3300039437 Bacteria 1693
163 Ga0436365_1317854 3300039437 Bacteria 992
164 Ga0436363_1479900 3300039450 Bacteria 1751
165 Ga0436363_1577495 3300039450 Bacteria 2051
166 Ga0439448_0218967 3300042005 Bacteria 669
167 Ga0450907_101267 3300042146 Bacteria 502
168 Ga0439464_0132111 3300042439 Bacteria 774
169 Ga0466965_0126933 3300044683 Bacteria 1320
170 Ga0466966_0013176 3300044684 Bacteria 5475
171 Ga0466966_0059076 3300044684 Bacteria 2422
172 Ga0466963_0009562 3300044694 Bacteria 5842
173 Ga0466963_0013692 3300044694 Bacteria 4987
174 Ga0466963_0039765 3300044694 Bacteria 3081
175 Ga0466963_0041946 3300044694 Bacteria 3002
176 Ga0466963_0259478 3300044694 Bacteria 1220
177 Ga0466963_0368885 3300044694 Bacteria 1011
178 Ga0466963_0477388 3300044694 Bacteria 880
179 Ga0466964_0001186 3300044706 Bacteria 8792
180 Ga0466964_0029829 3300044706 Bacteria 2156
181 Ga0466964_0034062 3300044706 Bacteria 2031
182 Ga0466971_0043107 3300044719 Bacteria 2028
183 Ga0466971_0045406 3300044719 Bacteria 1973
184 Ga0466957_0008422 3300044842 Bacteria 5864
185 Ga0466957_0026685 3300044842 Bacteria 3428
186 Ga0466957_0059530 3300044842 Bacteria 2341
187 Ga0466957_0111312 3300044842 Bacteria 1736
188 Ga0466959_0007527 3300045049 Bacteria 7649
189 Ga0466959_0127634 3300045049 Bacteria 1804
190 Ga0466958_0010780 3300045836 Bacteria 5128
191 Ga0466958_0065700 3300045836 Bacteria 2214
192 Ga0466958_0093810 3300045836 Bacteria 1859
193 Ga0466967_0001304 3300045976 Bacteria 14235
194 Ga0466967_0006467 3300045976 Bacteria 8296
195 Ga0466967_0014193 3300045976 Bacteria 6194
196 Ga0466967_0017451 3300045976 Bacteria 5699
197 Ga0466967_0024610 3300045976 Bacteria 4953
198 Ga0466967_0043030 3300045976 Bacteria 3908
199 Ga0466967_0057000 3300045976 Bacteria 3447
200 Ga0466967_0066096 3300045976 Bacteria 3221
201 Ga0466967_0361319 3300045976 Bacteria 1407
202 Ga0466967_0497955 3300045976 Bacteria 1195
203 Ga0466967_1818431 3300045976 Bacteria 606
204 Ga0466967_2004789 3300045976 Bacteria 575
205 Ga0466967_2272772 3300045976 Bacteria 538
206 Ga0495592_0021456 3300046454 Bacteria 4911
207 Ga0495641_0056007 3300046461 Bacteria 1788
208 Ga0495641_0168490 3300046461 Bacteria 980
209 Ga0495651_0007432 3300046462 Bacteria 8379
210 Ga0495653_0006673 3300046463 Bacteria 9471
211 Ga0495580_0369556 3300046472 Bacteria 970
212 Ga0495639_0139861 3300046475 Bacteria 1163
213 Ga0495594_0118267 3300046499 Bacteria 1497
214 Ga0495608_0028985 3300046511 Bacteria 3760
215 Ga0495628_0125747 3300046516 Bacteria 1964
216 Ga0495630_0001315 3300046517 Bacteria 17081
217 Ga0495666_0071512 3300046526 Bacteria 1649
218 Ga0495666_0426090 3300046526 Bacteria 595
219 Ga0495652_0152404 3300046529 Bacteria 1804
220 Ga0495640_0172957 3300046533 Bacteria 1379
221 Ga0495586_0177111 3300046535 Bacteria 1206
222 Ga0495667_0006305 3300046559 Bacteria 8048
223 Ga0495634_0559380 3300046642 Bacteria 666
224 Ga0495658_0095299 3300046683 Bacteria 1769
225 Ga0495658_0977257 3300046683 Bacteria 541
226 Ga0495613_0097847 3300046689 Bacteria 2120
227 Ga0495581_0462207 3300047315 Bacteria 739
228 Ga0495674_0000604 3300047319 Bacteria 33665
229 Ga0495672_0013085 3300047320 Bacteria 5742
230 Ga0495676_0447056 3300047321 Bacteria 853
231 Ga0495680_0001294 3300047322 Bacteria 27286
232 Ga0495684_0003511 3300047471 Bacteria 12266
233 Ga0495614_0303636 3300048089 Bacteria 738
234 Ga0496100_0014310 3300048903 Bacteria 4604
235 Ga0496100_1003057 3300048903 Bacteria 657
236 Ga0496101_0002404 3300048904 Bacteria 11487
237 Ga0496101_0003189 3300048904 Bacteria 10166
238 Ga0496102_0024685 3300048905 Bacteria 5346
239 Ga0496102_0237479 3300048905 Bacteria 1719
240 Ga0496103_0299539 3300048906 Bacteria 1034
241 Ga0496104_0038081 3300048907 Bacteria 4498
242 Ga0496105_0076158 3300048908 Bacteria 2770
243 Ga0496106_0020541 3300048909 Bacteria 4903
244 Ga0496107_0009510 3300048910 Bacteria 6744
245 Ga0496107_0068385 3300048910 Bacteria 2578
246 Ga0496110_0217601 3300048913 Bacteria 1737
247 Ga0496113_0489516 3300048916 Bacteria 988
248 Ga0496114_0041501 3300048917 Bacteria 3813
249 Ga0496115_0000028 3300048918 Bacteria 141457
250 Ga0496115_0000047 3300048918 Bacteria 111160
251 Ga0496115_0000307 3300048918 Bacteria 41675
252 Ga0496122_0180643 3300048925 Bacteria 1259
253 Ga0501031_0002346 3300049568 Bacteria 11987
254 Ga0501033_0058563 3300049570 Bacteria 2845
255 Ga0501036_0000312 3300049572 Bacteria 33881
256 Ga0501037_0011398 3300049573 Bacteria 6545
257 Ga0501038_0014298 3300049574 Bacteria 7232
258 Ga0501039_0001066 3300049575 Bacteria 20087
259 Ga0501040_0000053 3300049576 Bacteria 53956
260 Ga0501041_0000122 3300049577 Bacteria 32701
261 Ga0501042_0001805 3300049578 Bacteria 12825
262 Ga0501042_1096522 3300049578 Bacteria 580
263 Ga0501043_0052451 3300049579 Bacteria 3203
264 Ga0501046_0000559 3300049580 Bacteria 36920
265 Ga0501048_0000244 3300049582 Bacteria 36293
266 Ga0501069_0024481 3300049585 Bacteria 3293
267 Ga0501069_0063062 3300049585 Bacteria 2070
268 Ga0501070_0265250 3300049586 Bacteria 1403
269 Ga0501071_0000505 3300049587 Bacteria 19871
270 Ga0501071_0594126 3300049587 Bacteria 851
271 Ga0501072_0000123 3300049588 Bacteria 57275
272 Ga0501073_0031949 3300049589 Bacteria 3756
273 Ga0501074_0007173 3300049590 Bacteria 8047
274 Ga0501075_0000119 3300049591 Bacteria 38122
275 Ga0501076_0011027 3300049592 Bacteria 6720
276 Ga0501077_0000484 3300049593 Bacteria 24168
277 Ga0501079_0006119 3300049741 Bacteria 9022
278 Ga0501079_1302707 3300049741 Bacteria 572
279 Ga0501080_0069677 3300049742 Bacteria 3271
280 Ga0501081_0003192 3300049743 Bacteria 10421
281 Ga0501083_0054478 3300049744 Bacteria 2684
282 Ga0501035_0012657 3300049822 Bacteria 7796
283 Ga0501045_0000147 3300049824 Bacteria 37693
284 nmdc:mga08x19_990743_c1 3300050514 Bacteria 597
285 Ga0495601_0100693 3300053077 Bacteria 1866
286 Ga0495612_0409365 3300053078 Bacteria 617
287 Ga0495619_0232776 3300053085 Bacteria 1276
288 Ga0501084_0002465 3300054114 Bacteria 14904
289 Ga0501082_0002826 3300060353 Bacteria 15128
290 Ga0466962_0040135 3300061719 Bacteria 2241
291 Ga0466962_0073863 3300061719 Bacteria 1629
292 Ga0530510_0000063 3300061734 Bacteria 52586
293 Ga0307407_10094314
294 JGI25407J50210_10008259
295 Ga0070658_10363465
296 Ga0070658_10691036
297 Ga0070658_11943828
298 Ga0070658_11994336
299 Ga0070683_100054526
300 Ga0070683_100057478
301 Ga0070683_100439000
302 Ga0070683_100691753
303 Ga0070680_100943687
304 Ga0070682_100077442
305 Ga0070660_100009895
306 Ga0070660_100023521
307 Ga0070660_100391752
308 Ga0070661_100018083
309 Ga0070661_100024775
310 Ga0070661_100316720
311 Ga0070661_100338514
312 Ga0070661_101925952
313 Ga0070659_100164887
314 Ga0070659_100230006
315 Ga0070659_100620369
316 Ga0070709_10443242
317 Ga0070709_11441695
318 Ga0070714_100037311
319 Ga0070714_100165368
320 Ga0070714_101083194
321 Ga0070713_102155854
322 Ga0070711_100294636
323 Ga0070708_100167508
324 Ga0070663_100250375
325 Ga0070681_10006125
326 Ga0070681_10072498
327 Ga0070681_11173071
328 Ga0070706_100146485
329 Ga0070707_100008146
330 Ga0070707_100491957
331 Ga0070698_100153037
332 Ga0070679_100083064
333 Ga0070679_100270773
334 Ga0070684_100042134
335 Ga0070684_100204748
336 Ga0068853_100121232
337 Ga0070696_100216292
338 Ga0070693_100226051
339 Ga0068855_100053846
340 Ga0068855_100115993
341 Ga0068855_100137883
342 Ga0070664_100618095
343 Ga0070664_101452562
344 Ga0068857_100501988
345 Ga0068857_101876370
346 Ga0068854_100223199
347 Ga0068856_100083664
348 Ga0068856_100115271
349 Ga0068852_100003964
350 Ga0068851_10201855
351 Ga0081538_10012663
352 Ga0081538_10109521
353 Ga0075434_100644248
354 Ga0075435_101261245
355 Ga0105240_10508482
356 Ga0105240_10698304
357 Ga0105245_10002719
358 Ga0105245_10371130
359 Ga0105245_11126798
360 Ga0105241_10003410
361 Ga0105241_10491196
362 Ga0105241_10921469
363 Ga0105237_10003715
364 Ga0105237_10060154
365 Ga0105237_10540448
366 Ga0105237_11156607
367 Ga0105238_10035210
368 Ga0105239_10807962
369 Ga0105239_10924788
370 Ga0157370_10203467
371 Ga0157369_10206806
372 Ga0157369_10760680
373 Ga0157374_10114539
374 Ga0157372_10812555
375 Ga0157372_11569512
376 Ga0157372_12524517
377 Ga0182008_10687298
378 Ga0182008_10816342
379 Ga0157376_10013807
380 Ga0206356_10450769
381 Ga0206356_11462718
382 Ga0206354_10653384
383 Ga0206354_10948981
384 Ga0206353_10510998
385 Ga0213874_10042945
386 Ga0224712_10268460
387 Ga0207656_10184350
388 Ga0207692_10116523
389 Ga0207699_10208812
390 Ga0207705_10954783
391 Ga0207684_10093446
392 Ga0207684_10813848
393 Ga0207654_10095581
394 Ga0207654_10530499
395 Ga0207707_10016226
396 Ga0207707_10024455
397 Ga0207707_10059084
398 Ga0207707_10065472
399 Ga0207707_10101086
400 Ga0207695_10698493
401 Ga0207671_10001958
402 Ga0207663_10853638
403 Ga0207660_10577501
404 Ga0207660_10884997
405 Ga0207657_10006020
406 Ga0207657_10036429
407 Ga0207657_10082895
408 Ga0207649_10022568
409 Ga0207649_10280184
410 Ga0207649_10346238
411 Ga0207649_10696214
412 Ga0207649_11051149
413 Ga0207649_11415749
414 Ga0207652_10018379
415 Ga0207652_10529065
416 Ga0207646_10056810
417 Ga0207694_10111812
418 Ga0207687_10004864
419 Ga0207687_10118866
420 Ga0207664_10629970
421 Ga0207690_10101741
422 Ga0207661_10106533
423 Ga0207661_10140495
424 Ga0207661_11311244
425 Ga0207679_10009680
426 Ga0207679_10277062
427 Ga0207667_10171931
428 Ga0207667_10446687
429 Ga0207712_10572361
430 Ga0207640_10514015
431 Ga0207639_10137780
432 Ga0207639_11259769
433 Ga0207678_10903629
434 Ga0207702_10489594
435 Ga0207702_11327919
436 Ga0207674_10004721
437 Ga0207674_10019068
438 Ga0207698_10048193
439 Ga0268266_10397844
440 Ga0265338_10113648
441 Ga0307405_10600598
442 Ga0307416_100053242
443 Ga0307414_10407775
444 Ga0307415_100802741
445 Ga0395900_0286124
446 Ga0395898_0497685
447 Ga0395905_0477078
448 Ga0395905_0597199
449 Ga0436364_0566576
450 Ga0395901_0349649
451 Ga0395901_0548948
452 Ga0395901_1350856
453 Ga0436365_1025929
454 Ga0436365_1116954
455 Ga0436365_1317854
456 Ga0436363_1479900
457 Ga0436363_1577495
458 Ga0439448_0218967
459 Ga0450907_101267
460 Ga0439464_0132111
461 Ga0466965_0126933
462 Ga0466966_0013176
463 Ga0466966_0059076
464 Ga0466963_0009562
465 Ga0466963_0013692
466 Ga0466963_0039765
467 Ga0466963_0041946
468 Ga0466963_0259478
469 Ga0466963_0368885
470 Ga0466963_0477388
471 Ga0466964_0001186
472 Ga0466964_0029829
473 Ga0466964_0034062
474 Ga0466971_0043107
475 Ga0466971_0045406
476 Ga0466957_0008422
477 Ga0466957_0026685
478 Ga0466957_0059530
479 Ga0466957_0111312
480 Ga0466959_0007527
481 Ga0466959_0127634
482 Ga0466958_0010780
483 Ga0466958_0065700
484 Ga0466958_0093810
485 Ga0466967_0001304
486 Ga0466967_0006467
487 Ga0466967_0014193
488 Ga0466967_0017451
489 Ga0466967_0024610
490 Ga0466967_0043030
491 Ga0466967_0057000
492 Ga0466967_0066096
493 Ga0466967_0361319
494 Ga0466967_0497955
495 Ga0466967_1818431
496 Ga0466967_2004789
497 Ga0466967_2272772
498 Ga0495592_0021456
499 Ga0495641_0056007
500 Ga0495641_0168490
501 Ga0495651_0007432
502 Ga0495653_0006673
503 Ga0495580_0369556
504 Ga0495639_0139861
505 Ga0495594_0118267
506 Ga0495608_0028985
507 Ga0495628_0125747
508 Ga0495630_0001315
509 Ga0495666_0071512
510 Ga0495666_0426090
511 Ga0495652_0152404
512 Ga0495640_0172957
513 Ga0495586_0177111
514 Ga0495667_0006305
515 Ga0495634_0559380
516 Ga0495658_0095299
517 Ga0495658_0977257
518 Ga0495613_0097847
519 Ga0495581_0462207
520 Ga0495674_0000604
521 Ga0495672_0013085
522 Ga0495676_0447056
523 Ga0495680_0001294
524 Ga0495684_0003511
525 Ga0495614_0303636
526 Ga0496100_0014310
527 Ga0496100_1003057
528 Ga0496101_0002404
529 Ga0496101_0003189
530 Ga0496102_0024685
531 Ga0496102_0237479
532 Ga0496103_0299539
533 Ga0496104_0038081
534 Ga0496105_0076158
535 Ga0496106_0020541
536 Ga0496107_0009510
537 Ga0496107_0068385
538 Ga0496110_0217601
539 Ga0496113_0489516
540 Ga0496114_0041501
541 Ga0496115_0000028
542 Ga0496115_0000047
543 Ga0496115_0000307
544 Ga0496122_0180643
545 Ga0501031_0002346
546 Ga0501033_0058563
547 Ga0501036_0000312
548 Ga0501037_0011398
549 Ga0501038_0014298
550 Ga0501039_0001066
551 Ga0501040_0000053
552 Ga0501041_0000122
553 Ga0501042_0001805
554 Ga0501042_1096522
555 Ga0501043_0052451
556 Ga0501046_0000559
557 Ga0501048_0000244
558 Ga0501069_0024481
559 Ga0501069_0063062
560 Ga0501070_0265250
561 Ga0501071_0000505
562 Ga0501071_0594126
563 Ga0501072_0000123
564 Ga0501073_0031949
565 Ga0501074_0007173
566 Ga0501075_0000119
567 Ga0501076_0011027
568 Ga0501077_0000484
569 Ga0501079_0006119
570 Ga0501079_1302707
571 Ga0501080_0069677
572 Ga0501081_0003192
573 Ga0501083_0054478
574 Ga0501035_0012657
575 Ga0501045_0000147
576 nmdc:mga08x19_990743_c1
577 Ga0495601_0100693
578 Ga0495612_0409365
579 Ga0495619_0232776
580 Ga0501084_0002465
581 Ga0501082_0002826
582 Ga0466962_0040135
583 Ga0466962_0073863
584 Ga0530510_0000063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8614 2 121
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8175 2 121
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6706 2 118
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6678 1 116
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6606 1 123
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8614 2 121 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8174 2 121 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7272 1 121 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7008 1 121 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6814 1 119 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2N3WPT6-F1-model_v4 YCII-related domain-containing protein 0.9655 1 118
AF-A0A1E4HYZ4-F1-model_v4 YCII-related domain-containing protein 0.9627 1 118
AF-A0A845JI48-F1-model_v4 YciI family protein 0.9608 1 118
AF-A0A1Q4D5Y3-F1-model_v4 YCII-related domain-containing protein 0.9454 1 118
AF-A0A7W8A739-F1-model_v4 YCII-related domain-containing protein 0.9432 1 118

Map