F390998

General Info

Members Datasets Scaffolds Average Seq Length
292 110 249 232

Family's Representative Sequence

Representative Sequence 3300030735|Ga0316178_1123156|Ga0316178_11231561
Length 267
Sequence VSDRSSGLGGFTGARQVGRLAPVRRTSTVDLIADRLREAVVDGSLPPGAALGEAELAYQLGVSRGPLREAMQRLTAEGLLVIPRRRGLAVRTMTPEDVRDIHWLRARIEPELGRRILARPLAERKTVLAELGTEVKRMQRALKKDDARALGDAYLDFHRGLAAWGGSIRLARMMSTLLIETRLCTFSMYEHFEVAVDLVPEHAAFVDALAAEDAVRFESLMCAHLDAEVRRLLAEPEAAKVEDADRLLAETPDEPQPLDRLDLPEGI

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
4 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
5 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
8 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
9 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
10 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
11 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
12 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
13 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
14 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
15 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
16 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
17 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
18 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
19 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
20 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
21 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
22 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
23 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
50 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
72 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
76 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
77 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
84 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
85 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
86 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
91 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
107 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
108 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
109 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
110 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.7
Metatranscriptomes 0
Isolates 11.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 1.37
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001341 3300002773 Bacteria 10824
2 JGI25151J46595_10047711 3300003187 Bacteria 1487
3 rootH2_10037287 3300003320 Bacteria 1260
4 Ga0065714_10105298 3300005288 Bacteria 1568
5 Ga0065712_10204430 3300005290 Bacteria 1096
6 Ga0065712_10244562 3300005290 Bacteria 975
7 Ga0081455_10002303 3300005937 Bacteria 22753
8 Ga0075432_10013726 3300006058 Bacteria 2755
9 Ga0075432_10040241 3300006058 Bacteria 1631
10 Ga0070715_10005616 3300006163 Bacteria 4198
11 Ga0075370_10229647 3300006353 Bacteria 1098
12 Ga0105244_10000643 3300009036 Bacteria 30795
13 Ga0105244_10031144 3300009036 Bacteria 2832
14 Ga0105244_10036188 3300009036 Bacteria 2588
15 Ga0105243_10008416 3300009148 Bacteria 7918
16 Ga0105243_10019412 3300009148 Bacteria 5154
17 Ga0105243_10072209 3300009148 Bacteria 2793
18 Ga0105242_10510216 3300009176 Bacteria 1145
19 Ga0105033_103496 3300009986 Bacteria 1322
20 Ga0105246_10000274 3300011119 Bacteria 26886
21 Ga0105246_10010521 3300011119 Bacteria 5728
22 Ga0105246_10010625 3300011119 Bacteria 5703
23 Ga0105246_10040430 3300011119 Bacteria 3147
24 Ga0105246_10058125 3300011119 Bacteria 2678
25 Ga0105246_10064624 3300011119 Bacteria 2557
26 Ga0105246_10224908 3300011119 Bacteria 1473
27 Ga0157369_10421973 3300013105 Bacteria 1383
28 Ga0157374_11310620 3300013296 Bacteria 746
29 Ga0209129_1000159 3300025258 Bacteria 103426
30 Ga0207673_1004876 3300025290 Bacteria 1618
31 Ga0209025_1000211 3300025294 Bacteria 139109
32 Ga0209051_1014306 3300025303 Bacteria 3710
33 Ga0207697_10001299 3300025315 Bacteria 13720
34 Ga0207697_10011582 3300025315 Bacteria 3726
35 Ga0207655_1002201 3300025728 Bacteria 16184
36 Ga0207655_1024657 3300025728 Bacteria 2942
37 Ga0207655_1076301 3300025728 Bacteria 1226
38 Ga0207709_10027913 3300025935 Bacteria 3258
39 Ga0207658_10604454 3300025986 Bacteria 985
40 Ga0207428_10006595 3300027907 Bacteria 10687
41 Ga0316178_1123156 3300030735 Bacteria 1344
42 Ga0316182_1306886 3300030745 Bacteria 2906
43 Ga0307513_10000002 3300031456 Bacteria 842612
44 Ga0307513_10018611 3300031456 Bacteria 8294
45 Ga0307408_100001029 3300031548 Bacteria 21440
46 Ga0307408_100005739 3300031548 Bacteria 8270
47 Ga0307408_100011268 3300031548 Bacteria 5905
48 Ga0307408_100021425 3300031548 Bacteria 4374
49 Ga0307408_100024282 3300031548 Bacteria 4137
50 Ga0307408_100051000 3300031548 Bacteria 2978
51 Ga0307408_100112682 3300031548 Bacteria 2092
52 Ga0307408_100120344 3300031548 Bacteria 2033
53 Ga0307408_100177003 3300031548 Bacteria 1707
54 Ga0307408_100214532 3300031548 Bacteria 1566
55 Ga0307408_100236513 3300031548 Bacteria 1499
56 Ga0307408_100385474 3300031548 Bacteria 1199
57 Ga0307408_100463902 3300031548 Bacteria 1101
58 Ga0307408_100537327 3300031548 Bacteria 1029
59 Ga0307405_10000213 3300031731 Bacteria 20985
60 Ga0307405_10040717 3300031731 Bacteria 2816
61 Ga0307405_10088589 3300031731 Bacteria 2042
62 Ga0307405_10131713 3300031731 Bacteria 1729
63 Ga0307405_10473720 3300031731 Bacteria 998
64 Ga0307405_10525450 3300031731 Bacteria 953
65 Ga0307413_10026857 3300031824 Bacteria 3180
66 Ga0307413_10039295 3300031824 Bacteria 2751
67 Ga0307413_10137792 3300031824 Bacteria 1681
68 Ga0307413_10754952 3300031824 Bacteria 813
69 Ga0307518_10205131 3300031838 Bacteria 1304
70 Ga0307410_10006691 3300031852 Bacteria 6243
71 Ga0307410_10014847 3300031852 Bacteria 4598
72 Ga0307410_10027079 3300031852 Bacteria 3619
73 Ga0307410_10045298 3300031852 Bacteria 2928
74 Ga0307410_10076565 3300031852 Bacteria 2335
75 Ga0307410_10080392 3300031852 Bacteria 2286
76 Ga0307410_10088429 3300031852 Bacteria 2193
77 Ga0307410_10285909 3300031852 Bacteria 1296
78 Ga0307410_10515055 3300031852 Bacteria 986
79 Ga0307407_10052522 3300031903 Bacteria 2341
80 Ga0307407_10060837 3300031903 Bacteria 2205
81 Ga0307407_10135765 3300031903 Bacteria 1580
82 Ga0307407_10148317 3300031903 Bacteria 1521
83 Ga0307407_10266547 3300031903 Bacteria 1180
84 Ga0307412_10003011 3300031911 Bacteria 9331
85 Ga0307412_10004588 3300031911 Bacteria 7702
86 Ga0307412_10007746 3300031911 Bacteria 6107
87 Ga0307412_10018225 3300031911 Bacteria 4220
88 Ga0307412_10018833 3300031911 Bacteria 4165
89 Ga0307412_10045495 3300031911 Bacteria 2869
90 Ga0307412_10050172 3300031911 Bacteria 2753
91 Ga0307412_10054880 3300031911 Bacteria 2647
92 Ga0307412_10278437 3300031911 Bacteria 1312
93 Ga0307412_10349618 3300031911 Bacteria 1186
94 Ga0307412_10425449 3300031911 Bacteria 1087
95 Ga0307409_100037160 3300031995 Bacteria 3588
96 Ga0307409_100072171 3300031995 Bacteria 2748
97 Ga0307409_100151047 3300031995 Bacteria 2016
98 Ga0307409_100496117 3300031995 Bacteria 1188
99 Ga0307416_100000775 3300032002 Bacteria 16777
100 Ga0307416_100019714 3300032002 Bacteria 4790
101 Ga0307416_100131520 3300032002 Bacteria 2254
102 Ga0307416_100513864 3300032002 Bacteria 1265
103 Ga0307416_100758205 3300032002 Bacteria 1064
104 Ga0307414_10100274 3300032004 Bacteria 2178
105 Ga0307414_10145476 3300032004 Bacteria 1862
106 Ga0307414_10371427 3300032004 Bacteria 1234
107 Ga0307411_10327382 3300032005 Bacteria 1240
108 Ga0307415_100009025 3300032126 Bacteria 5563
109 Ga0307415_100062441 3300032126 Bacteria 2584
110 Ga0307415_100512947 3300032126 Bacteria 1051
111 Ga0307507_10107530 3300033179 Bacteria 2298
112 Ga0395900_0123363 3300037418 Bacteria 2657
113 Ga0395898_0230426 3300037466 Bacteria 1767
114 Ga0395898_0370183 3300037466 Bacteria 1366
115 Ga0395901_0042067 3300038443 Bacteria 4736
116 Ga0439436_0003294 3300041404 Bacteria 4897
117 Ga0439436_0005596 3300041404 Bacteria 3852
118 Ga0439436_0007432 3300041404 Bacteria 3372
119 Ga0439436_0013736 3300041404 Bacteria 2448
120 Ga0439436_0020419 3300041404 Bacteria 1973
121 Ga0439436_0028567 3300041404 Bacteria 1628
122 Ga0439436_0038861 3300041404 Bacteria 1367
123 Ga0439436_0043309 3300041404 Bacteria 1284
124 Ga0439438_001302 3300041405 Bacteria 11050
125 Ga0439438_018186 3300041405 Bacteria 2007
126 Ga0439438_027668 3300041405 Bacteria 1529
127 Ga0439438_044965 3300041405 Bacteria 1137
128 Ga0439439_0000070 3300041406 Bacteria 13061
129 Ga0439439_0000787 3300041406 Bacteria 5749
130 Ga0439439_0002690 3300041406 Bacteria 3811
131 Ga0439439_0002918 3300041406 Bacteria 3715
132 Ga0439439_0056090 3300041406 Bacteria 1040
133 Ga0439439_0080435 3300041406 Bacteria 881
134 Ga0439447_035506 3300041407 Bacteria 1236
135 Ga0439447_048867 3300041407 Bacteria 1014
136 Ga0439447_058222 3300041407 Bacteria 912
137 Ga0439461_0000511 3300041410 Bacteria 5641
138 Ga0439461_0043022 3300041410 Bacteria 981
139 Ga0439466_0005218 3300041411 Bacteria 4972
140 Ga0439466_0008070 3300041411 Bacteria 3970
141 Ga0439466_0012634 3300041411 Bacteria 3104
142 Ga0439466_0020775 3300041411 Bacteria 2337
143 Ga0439466_0028332 3300041411 Bacteria 1934
144 Ga0439466_0032839 3300041411 Bacteria 1767
145 Ga0439466_0065305 3300041411 Bacteria 1166
146 Ga0439465_0009793 3300041413 Bacteria 3019
147 Ga0439465_0073963 3300041413 Bacteria 1146
148 Ga0439431_0029733 3300041997 Bacteria 1351
149 Ga0439433_0000533 3300041999 Bacteria 7162
150 Ga0439433_0004217 3300041999 Bacteria 3088
151 Ga0439433_0011987 3300041999 Bacteria 1899
152 Ga0439433_0012207 3300041999 Bacteria 1883
153 Ga0439433_0013075 3300041999 Bacteria 1822
154 Ga0439442_000121 3300042002 Bacteria 19650
155 Ga0439442_000292 3300042002 Bacteria 12137
156 Ga0439442_000388 3300042002 Bacteria 10321
157 Ga0439442_000395 3300042002 Bacteria 10227
158 Ga0439442_000655 3300042002 Bacteria 7359
159 Ga0439442_000985 3300042002 Bacteria 5756
160 Ga0439442_002174 3300042002 Bacteria 3858
161 Ga0439442_002312 3300042002 Bacteria 3741
162 Ga0439442_003526 3300042002 Bacteria 3093
163 Ga0439442_004922 3300042002 Bacteria 2660
164 Ga0439442_005081 3300042002 Bacteria 2631
165 Ga0439442_041875 3300042002 Bacteria 962
166 Ga0439442_046889 3300042002 Bacteria 910
167 Ga0439445_0007885 3300042004 Bacteria 2481
168 Ga0439432_001049 3300042006 Bacteria 10493
169 Ga0439432_019978 3300042006 Bacteria 2229
170 Ga0439432_041019 3300042006 Bacteria 1467
171 Ga0439432_083062 3300042006 Bacteria 969
172 Ga0439449_0005321 3300042007 Bacteria 4932
173 Ga0439449_0007431 3300042007 Bacteria 4167
174 Ga0439449_0007547 3300042007 Bacteria 4133
175 Ga0439449_0015047 3300042007 Bacteria 2907
176 Ga0439449_0020796 3300042007 Bacteria 2458
177 Ga0439449_0053476 3300042007 Bacteria 1492
178 Ga0439449_0073512 3300042007 Bacteria 1259
179 Ga0439449_0084157 3300042007 Bacteria 1173
180 Ga0439449_0088919 3300042007 Bacteria 1140
181 Ga0439449_0123121 3300042007 Bacteria 963
182 Ga0439452_007900 3300042010 Bacteria 3225
183 Ga0439452_048752 3300042010 Bacteria 976
184 Ga0439457_005052 3300042014 Bacteria 3362
185 Ga0439457_005111 3300042014 Bacteria 3340
186 Ga0439457_005711 3300042014 Bacteria 3095
187 Ga0439457_007812 3300042014 Bacteria 2552
188 Ga0439457_025961 3300042014 Bacteria 1296
189 Ga0439462_0004570 3300042015 Bacteria 3385
190 Ga0439462_0019985 3300042015 Bacteria 1745
191 Ga0439462_0039365 3300042015 Bacteria 1260
192 Ga0439462_0045480 3300042015 Bacteria 1175
193 Ga0450919_001587 3300042121 Bacteria 2968
194 Ga0450919_006088 3300042121 Bacteria 1433
195 Ga0450919_010743 3300042121 Bacteria 1043
196 Ga0450920_000188 3300042122 Bacteria 8931
197 Ga0450920_000687 3300042122 Bacteria 5444
198 Ga0450920_002327 3300042122 Bacteria 3221
199 Ga0450920_003199 3300042122 Bacteria 2830
200 Ga0450920_004151 3300042122 Bacteria 2536
201 Ga0450920_005509 3300042122 Bacteria 2251
202 Ga0450920_008730 3300042122 Bacteria 1856
203 Ga0450920_009395 3300042122 Bacteria 1798
204 Ga0450920_010812 3300042122 Bacteria 1695
205 Ga0450920_017721 3300042122 Bacteria 1363
206 Ga0450920_032663 3300042122 Bacteria 1027
207 Ga0450923_038147 3300042125 Unclassified 1002
208 Ga0450906_027441 3300042145 Bacteria 1010
209 Ga0450907_000473 3300042146 Bacteria 11398
210 Ga0450907_001162 3300042146 Bacteria 5963
211 Ga0450907_001988 3300042146 Bacteria 4118
212 Ga0450907_004154 3300042146 Bacteria 2506
213 Ga0450907_005496 3300042146 Bacteria 2136
214 Ga0450907_005919 3300042146 Bacteria 2052
215 Ga0450907_007714 3300042146 Bacteria 1794
216 Ga0450907_008358 3300042146 Bacteria 1721
217 Ga0439446_0010386 3300042156 Bacteria 2506
218 Ga0450908_003238 3300042184 Bacteria 3168
219 Ga0450908_003887 3300042184 Bacteria 2892
220 Ga0450909_009057 3300042185 Bacteria 1453
221 Ga0450909_009481 3300042185 Bacteria 1421
222 Ga0450909_013821 3300042185 Bacteria 1188
223 Ga0439434_0002748 3300042435 Bacteria 5128
224 Ga0439434_0004480 3300042435 Bacteria 4082
225 Ga0439434_0015577 3300042435 Bacteria 2267
226 Ga0439434_0021142 3300042435 Bacteria 1955
227 Ga0439434_0023727 3300042435 Bacteria 1847
228 Ga0439434_0038341 3300042435 Bacteria 1468
229 Ga0450918_000988 3300042531 Bacteria 5901
230 Ga0450918_002067 3300042531 Bacteria 3843
231 Ga0450918_004240 3300042531 Bacteria 2625
232 Ga0450918_014428 3300042531 Bacteria 1373
233 Ga0450918_021934 3300042531 Bacteria 1115
234 Ga0466970_0243690 3300044765 Bacteria 1006
235 Ga0466967_0011493 3300045976 Bacteria 6710
236 Ga0466967_1094590 3300045976 Bacteria 794
237 Ga0495665_0031789 3300046531 Bacteria 2824
238 Ga0495588_0104912 3300046674 Bacteria 1487
239 Ga0495588_0350284 3300046674 Unclassified 776
240 Ga0495581_0012496 3300047315 Bacteria 4919
241 Ga0495581_0033900 3300047315 Bacteria 2955
242 Ga0496102_0034029 3300048905 Bacteria 4583
243 Ga0496102_0340180 3300048905 Bacteria 1413
244 Ga0496103_0097890 3300048906 Bacteria 1855
245 Ga0496112_0037068 3300048915 Bacteria 4760
246 Ga0501034_0000010 3300049571 Bacteria 312213
247 Ga0501047_0018161 3300049581 Bacteria 6740
248 Ga0501077_0056746 3300049593 Bacteria 2486
249 Ga0501044_0911581 3300049823 Bacteria 753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041405 Ga0439438_027668 Ga0439438_027668_128_931 204
2 3300042007 Ga0439449_0005321 Ga0439449_0005321_1371_2174 204
3 3300042125 Ga0450923_038147 Ga0450923_038147_360_989 209
4 3300003320 rootH2_10037287 rootH2_100372871 212
5 iso_pu_bacteria 8004021418 8004023631 213
6 iso_pu_bacteria 3002998708 3003003791 215
7 iso_pu_bacteria 8053945823 8053950762 215
8 3300042007 Ga0439449_0007547 Ga0439449_0007547_533_1183 216
9 3300025986 Ga0207658_10604454 Ga0207658_106044542 217
10 3300031838 Ga0307518_10205131 Ga0307518_102051312 217
11 3300047315 Ga0495581_0033900 Ga0495581_0033900_900_1553 217
12 iso_pu_bacteria 2816332139 2816511555 217
13 3300031456 Ga0307513_10018611 Ga0307513_100186114 218
14 3300042156 Ga0439446_0010386 Ga0439446_0010386_613_1269 218
15 iso_pu_bacteria 2558860112 2558909295 218
16 3300006163 Ga0070715_10005616 Ga0070715_100056166 219
17 3300044765 Ga0466970_0243690 Ga0466970_0243690_314_973 219
18 3300049581 Ga0501047_0018161 Ga0501047_0018161_2476_3135 219
19 iso_pu_bacteria 2795385472 2795795738 219
20 iso_pu_bacteria 2870782633 2870783469 220
21 3300009986 Ga0105033_103496 Ga0105033_1034962 221
22 3300031456 Ga0307513_10000002 Ga0307513_10000002771 221
23 3300041406 Ga0439439_0002690 Ga0439439_0002690_167_904 221
24 3300041411 Ga0439466_0008070 Ga0439466_0008070_3068_3805 221
25 3300042014 Ga0439457_005111 Ga0439457_005111_1626_2363 221
26 3300049593 Ga0501077_0056746 Ga0501077_0056746_1144_1830 221
27 3300049823 Ga0501044_0911581 Ga0501044_0911581_50_715 221
28 iso_pu_bacteria 2775506925 2776376191 221
29 iso_pu_bacteria 2863067949 2863073767 221
30 iso_pu_bacteria 8056207758 8056214653 221
31 3300033179 Ga0307507_10107530 Ga0307507_101075302 222
32 3300042002 Ga0439442_002312 Ga0439442_002312_2878_3546 222
33 3300045976 Ga0466967_0011493 Ga0466967_0011493_140_817 222
34 iso_pu_bacteria 2866552031 2866554067 222
35 3300006058 Ga0075432_10013726 Ga0075432_100137262 223
36 3300027907 Ga0207428_10006595 Ga0207428_1000659510 223
37 3300031548 Ga0307408_100385474 Ga0307408_1003854741 223
38 3300032004 Ga0307414_10371427 Ga0307414_103714272 223
39 3300041411 Ga0439466_0020775 Ga0439466_0020775_120_791 223
40 3300041413 Ga0439465_0009793 Ga0439465_0009793_2065_2736 223
41 3300042004 Ga0439445_0007885 Ga0439445_0007885_577_1248 223
42 3300045976 Ga0466967_1094590 Ga0466967_1094590_42_740 223
43 3300048906 Ga0496103_0097890 Ga0496103_0097890_124_795 223
44 3300031548 Ga0307408_100177003 Ga0307408_1001770032 224
45 3300031548 Ga0307408_100214532 Ga0307408_1002145323 224
46 3300031548 Ga0307408_100236513 Ga0307408_1002365132 224
47 3300031852 Ga0307410_10045298 Ga0307410_100452981 224
48 3300031852 Ga0307410_10080392 Ga0307410_100803923 224
49 3300041411 Ga0439466_0065305 Ga0439466_0065305_103_777 224
50 3300042007 Ga0439449_0020796 Ga0439449_0020796_1187_1861 224
51 iso_pu_bacteria 8054107350 8054112126 224
52 3300006353 Ga0075370_10229647 Ga0075370_102296472 225
53 3300011119 Ga0105246_10040430 Ga0105246_100404302 225
54 3300031548 Ga0307408_100021425 Ga0307408_1000214254 225
55 3300031731 Ga0307405_10131713 Ga0307405_101317132 225
56 3300031911 Ga0307412_10018225 Ga0307412_100182253 225
57 3300046531 Ga0495665_0031789 Ga0495665_0031789_660_1337 225
58 3300046674 Ga0495588_0104912 Ga0495588_0104912_293_970 225
59 3300047315 Ga0495581_0012496 Ga0495581_0012496_2275_2952 225
60 iso_pu_bacteria 2523231044 2523383715 225
61 iso_pu_bacteria 2844849076 2844851341 225
62 iso_pu_bacteria 2946059875 2946061561 225
63 3300032002 Ga0307416_100131520 Ga0307416_1001315202 226
64 3300041404 Ga0439436_0043309 Ga0439436_0043309_398_1078 226
65 3300041405 Ga0439438_001302 Ga0439438_001302_9680_10360 226
66 3300041406 Ga0439439_0000070 Ga0439439_0000070_1212_1892 226
67 3300041407 Ga0439447_048867 Ga0439447_048867_34_714 226
68 3300041410 Ga0439461_0000511 Ga0439461_0000511_596_1276 226
69 3300041411 Ga0439466_0028332 Ga0439466_0028332_886_1566 226
70 3300041997 Ga0439431_0029733 Ga0439431_0029733_141_821 226
71 3300041999 Ga0439433_0011987 Ga0439433_0011987_159_839 226
72 3300042006 Ga0439432_001049 Ga0439432_001049_7892_8572 226
73 3300042014 Ga0439457_007812 Ga0439457_007812_1052_1732 226
74 3300042121 Ga0450919_006088 Ga0450919_006088_563_1243 226
75 3300042122 Ga0450920_000687 Ga0450920_000687_3386_4066 226
76 3300042122 Ga0450920_009395 Ga0450920_009395_700_1380 226
77 3300042146 Ga0450907_001988 Ga0450907_001988_274_954 226
78 3300042146 Ga0450907_004154 Ga0450907_004154_1163_1843 226
79 3300042185 Ga0450909_009481 Ga0450909_009481_370_1050 226
80 3300042531 Ga0450918_002067 Ga0450918_002067_1760_2440 226
81 iso_pu_bacteria 2904776348 2904777796 226
82 iso_pu_bacteria 2910809715 2910811460 226
83 iso_pu_bacteria 2919059106 2919061951 226
84 iso_pu_bacteria 2932426870 2932428433 226
85 iso_pu_bacteria 2933418574 2933422752 226
86 iso_pu_bacteria 2939647034 2939647684 226
87 iso_pu_bacteria 2939674588 2939675105 226
88 iso_pu_bacteria 2945941187 2945944984 226
89 iso_pu_bacteria 2953998280 2954000547 226
90 iso_pu_bacteria 8054107350 8054111246 226
91 iso_pu_bacteria 8054107350 8054111249 226
92 3300005937 Ga0081455_10002303 Ga0081455_1000230318 227
93 iso_pu_bacteria 2751185725 2753038456 227
94 iso_pu_bacteria 2751185792 2753327080 227
95 3300031548 Ga0307408_100463902 Ga0307408_1004639021 228
96 3300032002 Ga0307416_100758205 Ga0307416_1007582052 228
97 iso_pu_bacteria 2844849076 2844851386 228
98 iso_pu_bacteria 2857740372 2857742564 228
99 3300009036 Ga0105244_10036188 Ga0105244_100361882 229
100 3300009148 Ga0105243_10008416 Ga0105243_100084168 229
101 3300009148 Ga0105243_10019412 Ga0105243_100194122 229
102 3300011119 Ga0105246_10000274 Ga0105246_100002747 229
103 3300011119 Ga0105246_10010521 Ga0105246_100105212 229
104 3300013105 Ga0157369_10421973 Ga0157369_104219732 229
105 3300025728 Ga0207655_1076301 Ga0207655_10763012 229
106 3300025935 Ga0207709_10027913 Ga0207709_100279132 229
107 3300037466 Ga0395898_0230426 Ga0395898_0230426_615_1304 229
108 3300041404 Ga0439436_0003294 Ga0439436_0003294_163_852 229
109 3300041404 Ga0439436_0005596 Ga0439436_0005596_3088_3777 229
110 3300041406 Ga0439439_0000787 Ga0439439_0000787_4170_4859 229
111 3300042006 Ga0439432_041019 Ga0439432_041019_423_1112 229
112 3300042146 Ga0450907_007714 Ga0450907_007714_1044_1733 229
113 3300042435 Ga0439434_0002748 Ga0439434_0002748_24_713 229
114 3300046674 Ga0495588_0350284 Ga0495588_0350284_71_760 229
115 iso_pu_bacteria 2844849076 2844851384 229
116 3300002773 JGI25152J39213_1001341 JGI25152J39213_10013416 230
117 3300003187 JGI25151J46595_10047711 JGI25151J46595_100477112 230
118 3300005288 Ga0065714_10105298 Ga0065714_101052983 230
119 3300005290 Ga0065712_10204430 Ga0065712_102044302 230
120 3300005290 Ga0065712_10244562 Ga0065712_102445621 230
121 3300006058 Ga0075432_10040241 Ga0075432_100402413 230
122 3300009036 Ga0105244_10000643 Ga0105244_1000064324 230
123 3300009036 Ga0105244_10031144 Ga0105244_100311443 230
124 3300009148 Ga0105243_10072209 Ga0105243_100722092 230
125 3300009176 Ga0105242_10510216 Ga0105242_105102161 230
126 3300011119 Ga0105246_10000274 Ga0105246_100002742 230
127 3300011119 Ga0105246_10010625 Ga0105246_100106252 230
128 3300011119 Ga0105246_10058125 Ga0105246_100581252 230
129 3300011119 Ga0105246_10064624 Ga0105246_100646243 230
130 3300011119 Ga0105246_10224908 Ga0105246_102249081 230
131 3300013296 Ga0157374_11310620 Ga0157374_113106201 230
132 3300025258 Ga0209129_1000159 Ga0209129_10001594 230
133 3300025290 Ga0207673_1004876 Ga0207673_10048763 230
134 3300025294 Ga0209025_1000211 Ga0209025_1000211106 230
135 3300025303 Ga0209051_1014306 Ga0209051_10143062 230
136 3300025315 Ga0207697_10001299 Ga0207697_100012996 230
137 3300025315 Ga0207697_10011582 Ga0207697_100115823 230
138 3300025728 Ga0207655_1002201 Ga0207655_100220111 230
139 3300025728 Ga0207655_1024657 Ga0207655_10246572 230
140 3300027907 Ga0207428_10006595 Ga0207428_100065956 230
141 3300030735 Ga0316178_1123156 Ga0316178_11231561 230
142 3300030745 Ga0316182_1306886 Ga0316182_13068863 230
143 3300031548 Ga0307408_100001029 Ga0307408_10000102911 230
144 3300031548 Ga0307408_100001029 Ga0307408_1000010298 230
145 3300031548 Ga0307408_100005739 Ga0307408_1000057393 230
146 3300031548 Ga0307408_100011268 Ga0307408_1000112685 230
147 3300031548 Ga0307408_100024282 Ga0307408_1000242821 230
148 3300031548 Ga0307408_100024282 Ga0307408_1000242824 230
149 3300031548 Ga0307408_100051000 Ga0307408_1000510002 230
150 3300031548 Ga0307408_100112682 Ga0307408_1001126822 230
151 3300031548 Ga0307408_100120344 Ga0307408_1001203444 230
152 3300031548 Ga0307408_100537327 Ga0307408_1005373271 230
153 3300031731 Ga0307405_10000213 Ga0307405_100002136 230
154 3300031731 Ga0307405_10000213 Ga0307405_100002139 230
155 3300031731 Ga0307405_10040717 Ga0307405_100407173 230
156 3300031731 Ga0307405_10088589 Ga0307405_100885892 230
157 3300031731 Ga0307405_10473720 Ga0307405_104737202 230
158 3300031731 Ga0307405_10525450 Ga0307405_105254501 230
159 3300031824 Ga0307413_10026857 Ga0307413_100268574 230
160 3300031824 Ga0307413_10039295 Ga0307413_100392953 230
161 3300031824 Ga0307413_10137792 Ga0307413_101377922 230
162 3300031824 Ga0307413_10754952 Ga0307413_107549521 230
163 3300031852 Ga0307410_10006691 Ga0307410_100066916 230
164 3300031852 Ga0307410_10014847 Ga0307410_100148473 230
165 3300031852 Ga0307410_10027079 Ga0307410_100270791 230
166 3300031852 Ga0307410_10027079 Ga0307410_100270794 230
167 3300031852 Ga0307410_10076565 Ga0307410_100765652 230
168 3300031852 Ga0307410_10088429 Ga0307410_100884293 230
169 3300031852 Ga0307410_10285909 Ga0307410_102859091 230
170 3300031852 Ga0307410_10515055 Ga0307410_105150552 230
171 3300031903 Ga0307407_10052522 Ga0307407_100525223 230
172 3300031903 Ga0307407_10060837 Ga0307407_100608373 230
173 3300031903 Ga0307407_10135765 Ga0307407_101357652 230
174 3300031903 Ga0307407_10148317 Ga0307407_101483171 230
175 3300031903 Ga0307407_10266547 Ga0307407_102665472 230
176 3300031911 Ga0307412_10003011 Ga0307412_1000301110 230
177 3300031911 Ga0307412_10004588 Ga0307412_100045884 230
178 3300031911 Ga0307412_10004588 Ga0307412_100045887 230
179 3300031911 Ga0307412_10007746 Ga0307412_100077462 230
180 3300031911 Ga0307412_10018833 Ga0307412_100188333 230
181 3300031911 Ga0307412_10045495 Ga0307412_100454953 230
182 3300031911 Ga0307412_10050172 Ga0307412_100501722 230
183 3300031911 Ga0307412_10054880 Ga0307412_100548804 230
184 3300031911 Ga0307412_10278437 Ga0307412_102784372 230
185 3300031911 Ga0307412_10349618 Ga0307412_103496181 230
186 3300031911 Ga0307412_10425449 Ga0307412_104254492 230
187 3300031995 Ga0307409_100037160 Ga0307409_1000371602 230
188 3300031995 Ga0307409_100072171 Ga0307409_1000721714 230
189 3300031995 Ga0307409_100151047 Ga0307409_1001510472 230
190 3300031995 Ga0307409_100496117 Ga0307409_1004961172 230
191 3300032002 Ga0307416_100000775 Ga0307416_1000007754 230
192 3300032002 Ga0307416_100000775 Ga0307416_1000007757 230
193 3300032002 Ga0307416_100019714 Ga0307416_1000197144 230
194 3300032002 Ga0307416_100513864 Ga0307416_1005138641 230
195 3300032004 Ga0307414_10100274 Ga0307414_101002743 230
196 3300032004 Ga0307414_10145476 Ga0307414_101454762 230
197 3300032005 Ga0307411_10327382 Ga0307411_103273822 230
198 3300032126 Ga0307415_100009025 Ga0307415_1000090252 230
199 3300032126 Ga0307415_100062441 Ga0307415_1000624411 230
200 3300032126 Ga0307415_100512947 Ga0307415_1005129472 230
201 3300037418 Ga0395900_0123363 Ga0395900_0123363_743_1435 230
202 3300037466 Ga0395898_0370183 Ga0395898_0370183_33_725 230
203 3300038443 Ga0395901_0042067 Ga0395901_0042067_3463_4155 230
204 3300041404 Ga0439436_0007432 Ga0439436_0007432_2519_3211 230
205 3300041404 Ga0439436_0013736 Ga0439436_0013736_1272_1964 230
206 3300041404 Ga0439436_0020419 Ga0439436_0020419_862_1554 230
207 3300041404 Ga0439436_0028567 Ga0439436_0028567_439_1131 230
208 3300041404 Ga0439436_0038861 Ga0439436_0038861_405_1148 230
209 3300041405 Ga0439438_018186 Ga0439438_018186_497_1243 230
210 3300041405 Ga0439438_044965 Ga0439438_044965_141_836 230
211 3300041406 Ga0439439_0002918 Ga0439439_0002918_1886_2578 230
212 3300041406 Ga0439439_0056090 Ga0439439_0056090_196_891 230
213 3300041406 Ga0439439_0080435 Ga0439439_0080435_138_830 230
214 3300041407 Ga0439447_035506 Ga0439447_035506_148_891 230
215 3300041407 Ga0439447_058222 Ga0439447_058222_67_759 230
216 3300041410 Ga0439461_0043022 Ga0439461_0043022_155_901 230
217 3300041411 Ga0439466_0005218 Ga0439466_0005218_3830_4522 230
218 3300041411 Ga0439466_0012634 Ga0439466_0012634_1853_2599 230
219 3300041411 Ga0439466_0032839 Ga0439466_0032839_592_1311 230
220 3300041413 Ga0439465_0073963 Ga0439465_0073963_202_954 230
221 3300041999 Ga0439433_0000533 Ga0439433_0000533_5580_6299 230
222 3300041999 Ga0439433_0004217 Ga0439433_0004217_1625_2317 230
223 3300041999 Ga0439433_0012207 Ga0439433_0012207_58_750 230
224 3300041999 Ga0439433_0013075 Ga0439433_0013075_732_1424 230
225 3300042002 Ga0439442_000121 Ga0439442_000121_18746_19483 230
226 3300042002 Ga0439442_000292 Ga0439442_000292_136_846 230
227 3300042002 Ga0439442_000388 Ga0439442_000388_9085_9777 230
228 3300042002 Ga0439442_000395 Ga0439442_000395_9303_9995 230
229 3300042002 Ga0439442_000655 Ga0439442_000655_2064_2840 230
230 3300042002 Ga0439442_000985 Ga0439442_000985_4423_5169 230
231 3300042002 Ga0439442_002174 Ga0439442_002174_1875_2567 230
232 3300042002 Ga0439442_003526 Ga0439442_003526_2264_2986 230
233 3300042002 Ga0439442_004922 Ga0439442_004922_1347_2039 230
234 3300042002 Ga0439442_005081 Ga0439442_005081_668_1360 230
235 3300042002 Ga0439442_041875 Ga0439442_041875_99_794 230
236 3300042002 Ga0439442_046889 Ga0439442_046889_103_795 230
237 3300042006 Ga0439432_019978 Ga0439432_019978_928_1620 230
238 3300042006 Ga0439432_083062 Ga0439432_083062_85_831 230
239 3300042007 Ga0439449_0007431 Ga0439449_0007431_2069_2815 230
240 3300042007 Ga0439449_0015047 Ga0439449_0015047_535_1227 230
241 3300042007 Ga0439449_0053476 Ga0439449_0053476_758_1450 230
242 3300042007 Ga0439449_0073512 Ga0439449_0073512_140_835 230
243 3300042007 Ga0439449_0084157 Ga0439449_0084157_72_764 230
244 3300042007 Ga0439449_0088919 Ga0439449_0088919_278_1015 230
245 3300042007 Ga0439449_0123121 Ga0439449_0123121_129_821 230
246 3300042010 Ga0439452_007900 Ga0439452_007900_1631_2323 230
247 3300042010 Ga0439452_048752 Ga0439452_048752_52_744 230
248 3300042014 Ga0439457_005052 Ga0439457_005052_1608_2300 230
249 3300042014 Ga0439457_005711 Ga0439457_005711_241_987 230
250 3300042014 Ga0439457_025961 Ga0439457_025961_290_1009 230
251 3300042015 Ga0439462_0004570 Ga0439462_0004570_1636_2328 230
252 3300042015 Ga0439462_0019985 Ga0439462_0019985_191_937 230
253 3300042015 Ga0439462_0039365 Ga0439462_0039365_275_1018 230
254 3300042015 Ga0439462_0045480 Ga0439462_0045480_270_965 230
255 3300042121 Ga0450919_001587 Ga0450919_001587_16_708 230
256 3300042121 Ga0450919_010743 Ga0450919_010743_125_820 230
257 3300042122 Ga0450920_000188 Ga0450920_000188_7873_8610 230
258 3300042122 Ga0450920_000687 Ga0450920_000687_423_1166 230
259 3300042122 Ga0450920_002327 Ga0450920_002327_2138_2836 230
260 3300042122 Ga0450920_003199 Ga0450920_003199_92_838 230
261 3300042122 Ga0450920_004151 Ga0450920_004151_216_908 230
262 3300042122 Ga0450920_005509 Ga0450920_005509_618_1310 230
263 3300042122 Ga0450920_008730 Ga0450920_008730_974_1666 230
264 3300042122 Ga0450920_010812 Ga0450920_010812_92_784 230
265 3300042122 Ga0450920_017721 Ga0450920_017721_168_860 230
266 3300042122 Ga0450920_032663 Ga0450920_032663_148_843 230
267 3300042145 Ga0450906_027441 Ga0450906_027441_156_848 230
268 3300042146 Ga0450907_000473 Ga0450907_000473_1221_1913 230
269 3300042146 Ga0450907_001162 Ga0450907_001162_5059_5796 230
270 3300042146 Ga0450907_001988 Ga0450907_001988_3174_3917 230
271 3300042146 Ga0450907_005496 Ga0450907_005496_702_1505 230
272 3300042146 Ga0450907_005919 Ga0450907_005919_429_1121 230
273 3300042146 Ga0450907_008358 Ga0450907_008358_204_899 230
274 3300042184 Ga0450908_003238 Ga0450908_003238_473_1216 230
275 3300042184 Ga0450908_003887 Ga0450908_003887_1835_2530 230
276 3300042185 Ga0450909_009057 Ga0450909_009057_243_953 230
277 3300042185 Ga0450909_013821 Ga0450909_013821_361_1104 230
278 3300042435 Ga0439434_0004480 Ga0439434_0004480_652_1389 230
279 3300042435 Ga0439434_0015577 Ga0439434_0015577_160_879 230
280 3300042435 Ga0439434_0021142 Ga0439434_0021142_291_983 230
281 3300042435 Ga0439434_0023727 Ga0439434_0023727_249_941 230
282 3300042435 Ga0439434_0038341 Ga0439434_0038341_120_866 230
283 3300042531 Ga0450918_000988 Ga0450918_000988_3992_4684 230
284 3300042531 Ga0450918_004240 Ga0450918_004240_900_1592 230
285 3300042531 Ga0450918_014428 Ga0450918_014428_472_1209 230
286 3300042531 Ga0450918_021934 Ga0450918_021934_252_947 230
287 3300048905 Ga0496102_0034029 Ga0496102_0034029_3278_3970 230
288 3300048905 Ga0496102_0340180 Ga0496102_0340180_569_1261 230
289 3300048915 Ga0496112_0037068 Ga0496112_0037068_2741_3433 230
290 3300049571 Ga0501034_0000010 Ga0501034_0000010_309172_309864 230
291 iso_pu_bacteria 2945941187 2945944980 230
292 iso_pu_bacteria 8056054917 8056057509 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

28

90

0.96

PF07729

FCD

FCD domain

100

227

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eet-assembly1.cif.gz_A-2 crystal structure of putative gntr-family transcriptional regulator 0.8795 13 79
4n0b-assembly1.cif.gz_B crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.8655 16 81
7c7e-assembly1.cif.gz_A-2 crystal structure of c terminal domain of escherichia coli dgor 0.8595 79 216
3ihu-assembly2.cif.gz_B crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution 0.8578 14 222
3sxy-assembly1.cif.gz_B metal-free full-length structure of tm0439, a metal-binding fcd family transcriptional regulator 0.8568 17 220
ID Description Score Start End Superfamily
2hs5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9759 16 79 1.10.10.10
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 15 77 1.10.10.10
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 17 79 1.10.10.10
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.954 13 77 1.10.10.10
af_P31475_2_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9506 15 79 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H3YB92-F1-model_v4 DNA-binding transcriptional regulator, GntR family 0.9339 15 219 GO:0003677
GO:0003700
AF-A0A7U3GG87-F1-model_v4 deleted 0.9173 15 216
AF-A0A7K0W6K8-F1-model_v4 GntR family transcriptional regulator 0.917 16 222 GO:0003677
GO:0003700
AF-A0A4Y6RSK2-F1-model_v4 GntR family transcriptional regulator 0.9155 7 221 GO:0003677
GO:0003700
AF-A0A0M0F7V3-F1-model_v4 HTH gntR-type domain-containing protein 0.9091 13 219 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
86.49 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map