F390948

General Info

Members Datasets Scaffolds Average Seq Length
292 197 584 107

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10057514|Ga0213872_100575142
Length 118
Sequence MRMKLNQISLKREKLVDRLPVTGEILRGTLLERSIRSHTNGCAKCASGEGHPVWVLTVTYPGGRTKQLSLRSEQVPEVRRWLHNYQNMKEMIEAICELNQQLLRANRDASKARGKGND

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
89 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
179 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
180 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
181 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
182 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
183 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
184 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
185 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
186 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
187 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
188 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
189 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
190 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
191 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
192 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
193 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
194 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
195 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
196 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
197 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 1.03
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 7.53
Rhizoplane 1.03
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 26.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10057514 3300021361 Bacteria 1761
2 CNAas_1013322 3300000532 Unclassified 569
3 Ga0070683_100081291 3300005329 Bacteria 3034
4 Ga0070683_101713604 3300005329 Bacteria 604
5 Ga0070683_101930056 3300005329 Unclassified 567
6 Ga0070682_100417198 3300005337 Bacteria 1019
7 Ga0068868_100375546 3300005338 Bacteria 1222
8 Ga0070660_100121351 3300005339 Bacteria 2086
9 Ga0070659_100104955 3300005366 Bacteria 2277
10 Ga0070709_10040024 3300005434 Bacteria 2880
11 Ga0070709_10122824 3300005434 Bacteria 1762
12 Ga0070713_100150057 3300005436 Bacteria 2073
13 Ga0070713_100270482 3300005436 Bacteria 1556
14 Ga0070710_10102090 3300005437 Unclassified 1710
15 Ga0070710_10193175 3300005437 Bacteria 1281
16 Ga0070711_100084190 3300005439 Bacteria 2274
17 Ga0070711_100510313 3300005439 Unclassified 992
18 Ga0070708_100161177 3300005445 Bacteria 2090
19 Ga0070708_100493236 3300005445 Bacteria 1155
20 Ga0070662_100272776 3300005457 Bacteria 1366
21 Ga0070662_100299616 3300005457 Bacteria 1306
22 Ga0070706_100046573 3300005467 Bacteria 4003
23 Ga0070707_100137222 3300005468 Unclassified 2379
24 Ga0070698_100132405 3300005471 Unclassified 2448
25 Ga0070698_101461869 3300005471 Unclassified 635
26 Ga0070679_100533643 3300005530 Bacteria 1117
27 Ga0070684_100164371 3300005535 Bacteria 2014
28 Ga0068855_101919901 3300005563 Bacteria 599
29 Ga0068855_102538989 3300005563 Bacteria 509
30 Ga0068856_100043199 3300005614 Unclassified 4435
31 Ga0068856_100104495 3300005614 Bacteria 2826
32 Ga0068852_101457823 3300005616 Bacteria 707
33 Ga0068852_102520556 3300005616 Unclassified 534
34 Ga0068866_10448123 3300005718 Bacteria 843
35 Ga0068860_102046104 3300005843 Bacteria 594
36 Ga0081455_10013896 3300005937 Bacteria 7914
37 Ga0081455_10600187 3300005937 Bacteria 718
38 Ga0081455_10648509 3300005937 Unclassified 680
39 Ga0070715_10295643 3300006163 Unclassified 864
40 Ga0070715_10454893 3300006163 Unclassified 723
41 Ga0070716_100301831 3300006173 Bacteria 1114
42 Ga0070716_100798955 3300006173 Bacteria 730
43 Ga0070716_100887081 3300006173 Bacteria 697
44 Ga0070712_100174870 3300006175 Bacteria 1669
45 Ga0068871_100142201 3300006358 Bacteria 2041
46 Ga0075428_101320913 3300006844 Bacteria 758
47 Ga0075430_100078037 3300006846 Plasmid 2776
48 Ga0075431_100390470 3300006847 Unclassified 1394
49 Ga0075429_100988978 3300006880 Bacteria 736
50 Ga0075436_100010175 3300006914 Bacteria 6441
51 Ga0075436_100649366 3300006914 Unclassified 779
52 Ga0105240_10091689 3300009093 Bacteria 3712
53 Ga0105240_10272620 3300009093 Unclassified 1947
54 Ga0105240_10305679 3300009093 Unclassified 1818
55 Ga0105240_11357330 3300009093 Bacteria 748
56 Ga0105240_11628843 3300009093 Bacteria 675
57 Ga0105245_10590417 3300009098 Bacteria 1136
58 Ga0114129_10295762 3300009147 Bacteria 2160
59 Ga0105243_12185087 3300009148 Unclassified 590
60 Ga0105241_10387624 3300009174 Bacteria 1223
61 Ga0105248_10211613 3300009177 Bacteria 2185
62 Ga0105237_10127226 3300009545 Bacteria 2542
63 Ga0105237_10191653 3300009545 Bacteria 2044
64 Ga0105238_10443530 3300009551 Bacteria 1294
65 Ga0099796_10560679 3300010159 Unclassified 514
66 Ga0105239_10026157 3300010375 Bacteria 6424
67 Ga0105239_10378041 3300010375 Bacteria 1601
68 Ga0105239_10619144 3300010375 Bacteria 1235
69 Ga0105239_13295676 3300010375 Bacteria 526
70 Ga0105246_11405819 3300011119 Bacteria 651
71 Ga0157373_10207204 3300013100 Bacteria 1382
72 Ga0157373_11071855 3300013100 Unclassified 604
73 Ga0157373_11202720 3300013100 Bacteria 571
74 Ga0157371_10055858 3300013102 Bacteria 2801
75 Ga0157370_10106431 3300013104 Bacteria 2625
76 Ga0157369_10198450 3300013105 Bacteria 2106
77 Ga0157374_10014080 3300013296 Bacteria 6993
78 Ga0157374_10163331 3300013296 Bacteria 2170
79 Ga0157374_10197332 3300013296 Bacteria 1970
80 Ga0157378_10851243 3300013297 Bacteria 940
81 Ga0157378_12685292 3300013297 Bacteria 550
82 Ga0163162_10483672 3300013306 Bacteria 1369
83 Ga0157372_10056976 3300013307 Unclassified 4368
84 Ga0157372_10252612 3300013307 Bacteria 2047
85 Ga0157372_12660465 3300013307 Unclassified 574
86 Ga0163163_11115519 3300014325 Bacteria 852
87 Ga0157379_10773176 3300014968 Bacteria 905
88 Ga0157379_12367774 3300014968 Unclassified 530
89 Ga0213872_10054140 3300021361 Bacteria 1819
90 Ga0213874_10124743 3300021377 Unclassified 878
91 Ga0213875_10035839 3300021388 Bacteria 2340
92 Ga0213875_10081956 3300021388 Unclassified 1505
93 Ga0213871_10124310 3300021441 Unclassified 771
94 Ga0207692_10460102 3300025898 Unclassified 802
95 Ga0207692_10782048 3300025898 Bacteria 623
96 Ga0207680_10080847 3300025903 Bacteria 2041
97 Ga0207685_10679481 3300025905 Bacteria 559
98 Ga0207699_10125094 3300025906 Unclassified 1668
99 Ga0207699_10948959 3300025906 Unclassified 635
100 Ga0207684_10506764 3300025910 Bacteria 1034
101 Ga0207654_11234155 3300025911 Bacteria 545
102 Ga0207695_10099967 3300025913 Bacteria 2897
103 Ga0207695_10847117 3300025913 Bacteria 794
104 Ga0207671_10186998 3300025914 Bacteria 1614
105 Ga0207693_10252980 3300025915 Bacteria 1382
106 Ga0207660_10152451 3300025917 Bacteria 1777
107 Ga0207657_10126509 3300025919 Bacteria 2099
108 Ga0207694_10224895 3300025924 Bacteria 1531
109 Ga0207700_10086134 3300025928 Bacteria 2468
110 Ga0207690_10016464 3300025932 Bacteria 4498
111 Ga0207706_10461531 3300025933 Bacteria 1098
112 Ga0207686_10104895 3300025934 Bacteria 1895
113 Ga0207665_10119884 3300025939 Bacteria 1857
114 Ga0207661_10294416 3300025944 Bacteria 1453
115 Ga0207679_10544196 3300025945 Bacteria 1041
116 Ga0207667_10307432 3300025949 Bacteria 1620
117 Ga0207667_11890416 3300025949 Bacteria 559
118 Ga0207677_10063523 3300026023 Bacteria 2567
119 Ga0207677_10278902 3300026023 Bacteria 1371
120 Ga0207702_10034214 3300026078 Unclassified 4248
121 Ga0207702_10051633 3300026078 Bacteria 3476
122 Ga0207676_11218677 3300026095 Unclassified 746
123 Ga0268264_10794877 3300028381 Bacteria 945
124 Ga0265770_1018522 3300030878 Bacteria 1085
125 Ga0265760_10066880 3300031090 Unclassified 1098
126 Ga0265760_10102709 3300031090 Unclassified 905
127 Ga0265330_10328992 3300031235 Unclassified 645
128 Ga0265325_10035945 3300031241 Bacteria 2627
129 Ga0265329_10260999 3300031242 Unclassified 579
130 Ga0265331_10291694 3300031250 Unclassified 731
131 Ga0316215_1027919 3300033544 Unclassified 583
132 Ga0316212_1031070 3300033547 Unclassified 751
133 Ga0373926_0006037 3300035083 Bacteria 4009
134 Ga0373926_0022820 3300035083 Bacteria 2171
135 Ga0373934_0024794 3300035086 Bacteria 2320
136 Ga0373934_0144564 3300035086 Bacteria 973
137 Ga0373944_0013830 3300035089 Bacteria 2245
138 Ga0373944_0014965 3300035089 Bacteria 2171
139 Ga0373936_0027406 3300035113 Bacteria 2234
140 Ga0373936_0144906 3300035113 Bacteria 1027
141 Ga0373945_0020143 3300035116 Bacteria 2280
142 Ga0373945_0026413 3300035116 Bacteria 2022
143 Ga0373945_0072248 3300035116 Bacteria 1308
144 Ga0373953_0149075 3300035117 Bacteria 1002
145 Ga0373953_0214666 3300035117 Bacteria 833
146 Ga0373954_0312076 3300035118 Bacteria 776
147 Ga0373954_0426032 3300035118 Unclassified 657
148 Ga0373956_0174079 3300035119 Bacteria 1016
149 Ga0373943_0037909 3300035170 Bacteria 2315
150 Ga0373943_0038728 3300035170 Bacteria 2293
151 Ga0373946_0019389 3300035171 Bacteria 2620
152 Ga0373946_0022654 3300035171 Bacteria 2447
153 Ga0373955_0410559 3300035172 Unclassified 823
154 Ga0373924_0054765 3300035410 Bacteria 1659
155 Ga0373924_0333433 3300035410 Unclassified 675
156 Ga0373935_0042028 3300035692 Bacteria 2873
157 Ga0373935_0044615 3300035692 Bacteria 2794
158 Ga0373935_0060733 3300035692 Bacteria 2418
159 Ga0373935_0313257 3300035692 Bacteria 1112
160 Ga0373927_0038707 3300035695 Bacteria 3095
161 Ga0373927_0044080 3300035695 Bacteria 2886
162 Ga0373927_0047110 3300035695 Bacteria 2788
163 Ga0373947_0058070 3300035725 Bacteria 2343
164 Ga0373947_0074036 3300035725 Bacteria 2094
165 Ga0373947_0076932 3300035725 Bacteria 2057
166 Ga0373937_0123662 3300036401 Bacteria 2412
167 Ga0373937_0123781 3300036401 Bacteria 2411
168 Ga0373925_0049959 3300037068 Bacteria 3118
169 Ga0373925_0064570 3300037068 Bacteria 2755
170 Ga0373925_0115468 3300037068 Bacteria 2078
171 Ga0436364_0305044 3300037853 Bacteria 704
172 Ga0436364_0884578 3300037853 Unclassified 1737
173 Ga0436364_1093738 3300037853 Unclassified 514
174 Ga0436365_1854753 3300039437 Unclassified 580
175 Ga0436360_0651086 3300039438 Bacteria 908
176 Ga0436361_0557148 3300039447 Bacteria 2418
177 Ga0436361_0648897 3300039447 Unclassified 815
178 Ga0436361_1101127 3300039447 Bacteria 1949
179 Ga0436361_1193671 3300039447 Bacteria 694
180 Ga0436363_0587947 3300039450 Unclassified 2149
181 Ga0436363_0674190 3300039450 Bacteria 910
182 Ga0436363_1564452 3300039450 Unclassified 3502
183 Ga0436362_0817871 3300039453 Unclassified 856
184 Ga0436362_0908820 3300039453 Unclassified 1090
185 Ga0436362_1284216 3300039453 Unclassified 715
186 Ga0466969_0069557 3300044656 Bacteria 1695
187 Ga0466963_0009029 3300044694 Bacteria 5988
188 Ga0466963_0162414 3300044694 Unclassified 1555
189 Ga0466963_0962766 3300044694 Unclassified 601
190 Ga0453684_1413739 3300044712 Unclassified 721
191 Ga0466957_0065672 3300044842 Unclassified 2235
192 Ga0466967_0466141 3300045976 Bacteria 1236
193 Ga0466967_0591656 3300045976 Bacteria 1094
194 Ga0495603_0057160 3300046455 Bacteria 2308
195 Ga0495603_0332788 3300046455 Bacteria 871
196 Ga0495641_0055253 3300046461 Bacteria 1803
197 Ga0495651_0077211 3300046462 Plasmid 2521
198 Ga0495580_0035584 3300046472 Unclassified 3580
199 Ga0495580_0100096 3300046472 Bacteria 2016
200 Ga0495582_0047872 3300046473 Bacteria 2354
201 Ga0495662_0146964 3300046476 Bacteria 1161
202 Ga0495585_0052231 3300046492 Bacteria 2263
203 Ga0495594_0053695 3300046499 Unclassified 2220
204 Ga0495594_0062912 3300046499 Bacteria 2055
205 Ga0495583_0045760 3300046506 Bacteria 2022
206 Ga0495644_0094361 3300046523 Bacteria 1130
207 Ga0495666_0027423 3300046526 Bacteria 2803
208 Ga0495665_0045072 3300046531 Bacteria 2342
209 Ga0495665_0234469 3300046531 Unclassified 947
210 Ga0495635_0164877 3300046663 Bacteria 1508
211 Ga0495635_0471100 3300046663 Unclassified 829
212 Ga0495659_0195558 3300046664 Bacteria 828
213 Ga0495588_0046923 3300046674 Bacteria 2216
214 Ga0495657_0057599 3300046675 Bacteria 2583
215 Ga0495599_0299143 3300046678 Bacteria 972
216 Ga0495623_0637678 3300046679 Bacteria 550
217 Ga0495647_0029388 3300046681 Bacteria 2032
218 Ga0495647_0213845 3300046681 Bacteria 849
219 Ga0495658_0054029 3300046683 Bacteria 2283
220 Ga0495658_0179422 3300046683 Bacteria 1313
221 Ga0495669_0487798 3300046684 Bacteria 599
222 Ga0495624_0034727 3300046690 Bacteria 3260
223 Ga0495649_0046266 3300046694 Unclassified 2369
224 Ga0495581_0154883 3300047315 Bacteria 1339
225 Ga0495604_0088565 3300047317 Bacteria 2302
226 Ga0495604_0651517 3300047317 Bacteria 672
227 Ga0495674_0563087 3300047319 Bacteria 906
228 Ga0495676_0090283 3300047321 Bacteria 2293
229 Ga0495675_0209376 3300047444 Bacteria 1184
230 Ga0495684_0617195 3300047471 Unclassified 730
231 Ga0495593_0140102 3300047673 Bacteria 1225
232 Ga0495602_0170320 3300048088 Unclassified 1691
233 Ga0495602_0403303 3300048088 Bacteria 975
234 Ga0495614_0497667 3300048089 Bacteria 580
235 Ga0496102_0393613 3300048905 Bacteria 1303
236 Ga0496112_0216601 3300048915 Bacteria 1871
237 Ga0496115_0122746 3300048918 Bacteria 2138
238 Ga0501031_0098372 3300049568 Bacteria 1909
239 Ga0501032_1006960 3300049569 Bacteria 523
240 Ga0501036_0153495 3300049572 Bacteria 1942
241 Ga0501038_0138565 3300049574 Unclassified 1992
242 Ga0501039_0081318 3300049575 Unclassified 2522
243 Ga0501041_0060052 3300049577 Unclassified 2327
244 Ga0501042_0068333 3300049578 Unclassified 2541
245 Ga0501046_0390121 3300049580 Unclassified 1007
246 Ga0501048_0029600 3300049582 Bacteria 3969
247 Ga0501048_0970735 3300049582 Unclassified 611
248 Ga0501069_0147478 3300049585 Bacteria 1351
249 Ga0501071_0095016 3300049587 Bacteria 2193
250 Ga0501072_0110063 3300049588 Bacteria 2192
251 Ga0501075_0104613 3300049591 Unclassified 2151
252 Ga0501076_0107741 3300049592 Unclassified 2250
253 Ga0501080_0171980 3300049742 Unclassified 1998
254 Ga0501080_0862602 3300049742 Unclassified 791
255 Ga0501081_0212701 3300049743 Bacteria 1404
256 Ga0501045_0123605 3300049824 Bacteria 1922
257 Ga0501045_1352372 3300049824 Unclassified 518
258 nmdc:mga05p37_596499_c1 3300050507 Unclassified 1248
259 nmdc:mga09592_152103_c1 3300050508 Unclassified 1997
260 nmdc:mga0qj67_68113_c1 3300050509 Unclassified 2837
261 nmdc:mga06r32_381317_c1 3300050510 Unclassified 1393
262 nmdc:mga08x19_1226313_c1 3300050514 Unclassified 532
263 nmdc:mga08x19_446667_c1 3300050514 Unclassified 910
264 Ga0501084_0108399 3300054114 Bacteria 2333
265 Ga0501082_0476712 3300060353 Bacteria 1091
266 Ga0530510_0107762 3300061734 Bacteria 2039
267 2723844744 2721755755 Bacteria 8322773
268 2728751696 2728368998 Bacteria 8720350
269 2876817516 2876808645 Bacteria 8824342
270 2879113812 2879110137 Bacteria 8907982
271 2879118213 2879110137 Bacteria 8907982
272 2906634986 2906626472 Bacteria 8826946
273 8006973509 8006964411 Bacteria 8966052
274 8006990258 8006984368 Bacteria 9651211
275 8006994231 8006984368 Bacteria 9651211
276 8007001576 8006994254 Bacteria 8309700
277 8007002445 8006994254 Bacteria 8309700
278 8016511967 8016511872 Bacteria 9921665
279 8016527503 8016522445 Bacteria 8156687
280 8016532599 8016530956 Bacteria 8155261
281 8016545825 8016539877 Bacteria 8155419
282 8016556284 8016548790 Bacteria 8155074
283 8016564649 8016557553 Bacteria 8154380
284 8016570903 8016566248 Bacteria 8158151
285 8016583408 8016575299 Bacteria 8154085
286 8016585448 8016583857 Bacteria 10421953
287 8016586598 8016583857 Bacteria 10421953
288 8016593811 8016583857 Bacteria 10421953
289 8016594181 8016583857 Bacteria 10421953
290 8016602305 8016595262 Bacteria 8149947
291 8017066495 8017057580 Bacteria 10023680
292 8019532413 8019530166 Bacteria 8155624
293 Ga0213872_10057514
294 CNAas_1013322
295 Ga0070683_100081291
296 Ga0070683_101713604
297 Ga0070683_101930056
298 Ga0070682_100417198
299 Ga0068868_100375546
300 Ga0070660_100121351
301 Ga0070659_100104955
302 Ga0070709_10040024
303 Ga0070709_10122824
304 Ga0070713_100150057
305 Ga0070713_100270482
306 Ga0070710_10102090
307 Ga0070710_10193175
308 Ga0070711_100084190
309 Ga0070711_100510313
310 Ga0070708_100161177
311 Ga0070708_100493236
312 Ga0070662_100272776
313 Ga0070662_100299616
314 Ga0070706_100046573
315 Ga0070707_100137222
316 Ga0070698_100132405
317 Ga0070698_101461869
318 Ga0070679_100533643
319 Ga0070684_100164371
320 Ga0068855_101919901
321 Ga0068855_102538989
322 Ga0068856_100043199
323 Ga0068856_100104495
324 Ga0068852_101457823
325 Ga0068852_102520556
326 Ga0068866_10448123
327 Ga0068860_102046104
328 Ga0081455_10013896
329 Ga0081455_10600187
330 Ga0081455_10648509
331 Ga0070715_10295643
332 Ga0070715_10454893
333 Ga0070716_100301831
334 Ga0070716_100798955
335 Ga0070716_100887081
336 Ga0070712_100174870
337 Ga0068871_100142201
338 Ga0075428_101320913
339 Ga0075430_100078037
340 Ga0075431_100390470
341 Ga0075429_100988978
342 Ga0075436_100010175
343 Ga0075436_100649366
344 Ga0105240_10091689
345 Ga0105240_10272620
346 Ga0105240_10305679
347 Ga0105240_11357330
348 Ga0105240_11628843
349 Ga0105245_10590417
350 Ga0114129_10295762
351 Ga0105243_12185087
352 Ga0105241_10387624
353 Ga0105248_10211613
354 Ga0105237_10127226
355 Ga0105237_10191653
356 Ga0105238_10443530
357 Ga0099796_10560679
358 Ga0105239_10026157
359 Ga0105239_10378041
360 Ga0105239_10619144
361 Ga0105239_13295676
362 Ga0105246_11405819
363 Ga0157373_10207204
364 Ga0157373_11071855
365 Ga0157373_11202720
366 Ga0157371_10055858
367 Ga0157370_10106431
368 Ga0157369_10198450
369 Ga0157374_10014080
370 Ga0157374_10163331
371 Ga0157374_10197332
372 Ga0157378_10851243
373 Ga0157378_12685292
374 Ga0163162_10483672
375 Ga0157372_10056976
376 Ga0157372_10252612
377 Ga0157372_12660465
378 Ga0163163_11115519
379 Ga0157379_10773176
380 Ga0157379_12367774
381 Ga0213872_10054140
382 Ga0213874_10124743
383 Ga0213875_10035839
384 Ga0213875_10081956
385 Ga0213871_10124310
386 Ga0207692_10460102
387 Ga0207692_10782048
388 Ga0207680_10080847
389 Ga0207685_10679481
390 Ga0207699_10125094
391 Ga0207699_10948959
392 Ga0207684_10506764
393 Ga0207654_11234155
394 Ga0207695_10099967
395 Ga0207695_10847117
396 Ga0207671_10186998
397 Ga0207693_10252980
398 Ga0207660_10152451
399 Ga0207657_10126509
400 Ga0207694_10224895
401 Ga0207700_10086134
402 Ga0207690_10016464
403 Ga0207706_10461531
404 Ga0207686_10104895
405 Ga0207665_10119884
406 Ga0207661_10294416
407 Ga0207679_10544196
408 Ga0207667_10307432
409 Ga0207667_11890416
410 Ga0207677_10063523
411 Ga0207677_10278902
412 Ga0207702_10034214
413 Ga0207702_10051633
414 Ga0207676_11218677
415 Ga0268264_10794877
416 Ga0265770_1018522
417 Ga0265760_10066880
418 Ga0265760_10102709
419 Ga0265330_10328992
420 Ga0265325_10035945
421 Ga0265329_10260999
422 Ga0265331_10291694
423 Ga0316215_1027919
424 Ga0316212_1031070
425 Ga0373926_0006037
426 Ga0373926_0022820
427 Ga0373934_0024794
428 Ga0373934_0144564
429 Ga0373944_0013830
430 Ga0373944_0014965
431 Ga0373936_0027406
432 Ga0373936_0144906
433 Ga0373945_0020143
434 Ga0373945_0026413
435 Ga0373945_0072248
436 Ga0373953_0149075
437 Ga0373953_0214666
438 Ga0373954_0312076
439 Ga0373954_0426032
440 Ga0373956_0174079
441 Ga0373943_0037909
442 Ga0373943_0038728
443 Ga0373946_0019389
444 Ga0373946_0022654
445 Ga0373955_0410559
446 Ga0373924_0054765
447 Ga0373924_0333433
448 Ga0373935_0042028
449 Ga0373935_0044615
450 Ga0373935_0060733
451 Ga0373935_0313257
452 Ga0373927_0038707
453 Ga0373927_0044080
454 Ga0373927_0047110
455 Ga0373947_0058070
456 Ga0373947_0074036
457 Ga0373947_0076932
458 Ga0373937_0123662
459 Ga0373937_0123781
460 Ga0373925_0049959
461 Ga0373925_0064570
462 Ga0373925_0115468
463 Ga0436364_0305044
464 Ga0436364_0884578
465 Ga0436364_1093738
466 Ga0436365_1854753
467 Ga0436360_0651086
468 Ga0436361_0557148
469 Ga0436361_0648897
470 Ga0436361_1101127
471 Ga0436361_1193671
472 Ga0436363_0587947
473 Ga0436363_0674190
474 Ga0436363_1564452
475 Ga0436362_0817871
476 Ga0436362_0908820
477 Ga0436362_1284216
478 Ga0466969_0069557
479 Ga0466963_0009029
480 Ga0466963_0162414
481 Ga0466963_0962766
482 Ga0453684_1413739
483 Ga0466957_0065672
484 Ga0466967_0466141
485 Ga0466967_0591656
486 Ga0495603_0057160
487 Ga0495603_0332788
488 Ga0495641_0055253
489 Ga0495651_0077211
490 Ga0495580_0035584
491 Ga0495580_0100096
492 Ga0495582_0047872
493 Ga0495662_0146964
494 Ga0495585_0052231
495 Ga0495594_0053695
496 Ga0495594_0062912
497 Ga0495583_0045760
498 Ga0495644_0094361
499 Ga0495666_0027423
500 Ga0495665_0045072
501 Ga0495665_0234469
502 Ga0495635_0164877
503 Ga0495635_0471100
504 Ga0495659_0195558
505 Ga0495588_0046923
506 Ga0495657_0057599
507 Ga0495599_0299143
508 Ga0495623_0637678
509 Ga0495647_0029388
510 Ga0495647_0213845
511 Ga0495658_0054029
512 Ga0495658_0179422
513 Ga0495669_0487798
514 Ga0495624_0034727
515 Ga0495649_0046266
516 Ga0495581_0154883
517 Ga0495604_0088565
518 Ga0495604_0651517
519 Ga0495674_0563087
520 Ga0495676_0090283
521 Ga0495675_0209376
522 Ga0495684_0617195
523 Ga0495593_0140102
524 Ga0495602_0170320
525 Ga0495602_0403303
526 Ga0495614_0497667
527 Ga0496102_0393613
528 Ga0496112_0216601
529 Ga0496115_0122746
530 Ga0501031_0098372
531 Ga0501032_1006960
532 Ga0501036_0153495
533 Ga0501038_0138565
534 Ga0501039_0081318
535 Ga0501041_0060052
536 Ga0501042_0068333
537 Ga0501046_0390121
538 Ga0501048_0029600
539 Ga0501048_0970735
540 Ga0501069_0147478
541 Ga0501071_0095016
542 Ga0501072_0110063
543 Ga0501075_0104613
544 Ga0501076_0107741
545 Ga0501080_0171980
546 Ga0501080_0862602
547 Ga0501081_0212701
548 Ga0501045_0123605
549 Ga0501045_1352372
550 nmdc:mga05p37_596499_c1
551 nmdc:mga09592_152103_c1
552 nmdc:mga0qj67_68113_c1
553 nmdc:mga06r32_381317_c1
554 nmdc:mga08x19_1226313_c1
555 nmdc:mga08x19_446667_c1
556 Ga0501084_0108399
557 Ga0501082_0476712
558 Ga0530510_0107762
559 2723844744
560 2728751696
561 2876817516
562 2879113812
563 2879118213
564 2906634986
565 8006973509
566 8006990258
567 8006994231
568 8007001576
569 8007002445
570 8016511967
571 8016527503
572 8016532599
573 8016545825
574 8016556284
575 8016564649
576 8016570903
577 8016583408
578 8016585448
579 8016586598
580 8016593811
581 8016594181
582 8016602305
583 8017066495
584 8019532413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20586

DUF6788

Family of unknown function (DUF6788)

5

106

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p99-assembly4.cif.gz_D ca2+-stabilized adhesin helps an antarctic bacterium reach out and bind ice 0.7165 49 66
4p79-assembly1.cif.gz_A crystal structure of mouse claudin-15 0.6801 49 73
1o96-assembly3.cif.gz_E structure of electron transferring flavoprotein for methylophilus methylotrophus. 0.672 50 66
1o97-assembly1.cif.gz_C structure of electron transferring flavoprotein from methylophilus methylotrophus, recognition loop removed by limited proteolysis 0.6663 50 66
3oe3-assembly3.cif.gz_F crystal structure of plic-st, periplasmic lysozyme inhibitor of c-type lysozyme from salmonella typhimurium 0.663 25 69
ID Description Score Start End Superfamily
af_A4I4F5_20_409_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.8509 49 66 3.40.850.10
3dg3A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.691 22 66 3.30.390.10
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6742 50 66 3.40.50.620
af_Q4CQ87_202_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6664 48 66 3.40.50.300
1o96A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6652 50 66 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Q6YUN5-F1-model_v4 Uncharacterized protein 0.9679 12 100
AF-A0A2V8PRJ8-F1-model_v4 Uncharacterized protein 0.9594 1 102
AF-A0A0R3L9P9-F1-model_v4 Uncharacterized protein 0.9554 1 104
AF-A0A2V8YG37-F1-model_v4 Uncharacterized protein 0.9529 1 101
AF-A0A7C6E5H7-F1-model_v4 Transposase IS4-like domain-containing protein 0.9464 1 99 GO:0016020

Map