F390941

General Info

Members Datasets Scaffolds Average Seq Length
292 160 293 185

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10071993|Ga0182008_100719932
Length 196
Sequence MTLFSAAEAQRVRLLGLDVDGVLTDNGVFIGPIGTGTVELKRFDIQDGLGLILLGTAGMPVVWISGRRSEATSVRAAELGVELLQAPGPGKAAAFDEVLTRRGVGWEEAAFVGDDLADLPILRRVGLPIAVANAVTDVKQVATYTTSAAGGHGAVREVIEALLRARGEWSDILERYFAGGVQKTVRRRGHGERTGR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
93 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
139 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
140 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
141 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
147 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.64
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10143376 3300003316 Bacteria 1501
2 rootH1_10143376 3300003323 Bacteria 3787
3 rootL2_10111054 3300003322 Bacteria 1565
4 Ga0070676_10251146 3300005328 Bacteria 1180
5 Ga0070677_10143048 3300005333 Bacteria 1105
6 Ga0068869_100416875 3300005334 Bacteria 1107
7 Ga0068869_100520721 3300005334 Bacteria 995
8 Ga0070680_100372791 3300005336 Unclassified 1215
9 Ga0070680_100753605 3300005336 Bacteria 838
10 Ga0070689_100808996 3300005340 Unclassified 824
11 Ga0070668_100086841 3300005347 Bacteria 2460
12 Ga0070675_100712007 3300005354 Bacteria 915
13 Ga0070659_100191305 3300005366 Bacteria 1682
14 Ga0070709_10007945 3300005434 Bacteria 5825
15 Ga0070714_100721286 3300005435 Bacteria 963
16 Ga0070705_100033217 3300005440 Bacteria 2874
17 Ga0070705_100211143 3300005440 Bacteria 1338
18 Ga0070705_100321340 3300005440 Bacteria 1117
19 Ga0070694_100119208 3300005444 Bacteria 1891
20 Ga0070694_100383075 3300005444 Bacteria 1097
21 Ga0070708_100004286 3300005445 Bacteria 11212
22 Ga0070708_100007056 3300005445 Bacteria 8965
23 Ga0070708_100134442 3300005445 Bacteria 2290
24 Ga0070662_100771327 3300005457 Bacteria 816
25 Ga0070662_100786167 3300005457 Bacteria 809
26 Ga0070681_10287119 3300005458 Bacteria 1556
27 Ga0070706_100015912 3300005467 Bacteria 6945
28 Ga0070706_100195671 3300005467 Bacteria 1889
29 Ga0070707_100008444 3300005468 Bacteria 9567
30 Ga0070707_100232665 3300005468 Bacteria 1793
31 Ga0070698_100005894 3300005471 Bacteria 13374
32 Ga0070698_100033847 3300005471 Bacteria 5293
33 Ga0070699_100001113 3300005518 Bacteria 25024
34 Ga0070699_100030317 3300005518 Bacteria 4668
35 Ga0070699_100040732 3300005518 Bacteria 4021
36 Ga0070699_100084676 3300005518 Bacteria 2767
37 Ga0070697_100002673 3300005536 Bacteria 13709
38 Ga0070697_100490649 3300005536 Bacteria 1073
39 Ga0070697_100638602 3300005536 Bacteria 937
40 Ga0070697_100945987 3300005536 Bacteria 765
41 Ga0068853_101353605 3300005539 Bacteria 688
42 Ga0070672_100074059 3300005543 Bacteria 2716
43 Ga0070695_100044653 3300005545 Bacteria 2822
44 Ga0070695_100113981 3300005545 Bacteria 1839
45 Ga0070695_100174552 3300005545 Bacteria 1518
46 Ga0070696_100111172 3300005546 Bacteria 1973
47 Ga0070696_100205065 3300005546 Bacteria 1473
48 Ga0070696_100240396 3300005546 Bacteria 1365
49 Ga0070704_100050056 3300005549 Unclassified 2934
50 Ga0070664_100271426 3300005564 Bacteria 1528
51 Ga0070664_100641216 3300005564 Unclassified 987
52 Ga0068854_100593964 3300005578 Bacteria 944
53 Ga0068866_10735979 3300005718 Bacteria 680
54 Ga0068861_100756321 3300005719 Bacteria 908
55 Ga0068863_100053203 3300005841 Bacteria 3837
56 Ga0068863_100363158 3300005841 Bacteria 1412
57 Ga0068863_100925430 3300005841 Unclassified 873
58 Ga0081455_10099512 3300005937 Bacteria 2338
59 Ga0070716_100071112 3300006173 Bacteria 2045
60 Ga0070716_100369344 3300006173 Unclassified 1022
61 Ga0070712_100236069 3300006175 Bacteria 1454
62 Ga0070712_100491640 3300006175 Bacteria 1027
63 Ga0075430_100020103 3300006846 Bacteria 5682
64 Ga0075431_100013935 3300006847 Bacteria 8120
65 Ga0075431_100789165 3300006847 Bacteria 923
66 Ga0075433_10021805 3300006852 Bacteria 5374
67 Ga0075433_10038426 3300006852 Bacteria 4134
68 Ga0075433_10829618 3300006852 Bacteria 807
69 Ga0075434_100012189 3300006871 Bacteria 8146
70 Ga0075434_100023830 3300006871 Bacteria 5973
71 Ga0068865_100169842 3300006881 Bacteria 1671
72 Ga0075436_100000571 3300006914 Bacteria 24085
73 Ga0075436_100464567 3300006914 Bacteria 923
74 Ga0097620_100648504 3300006931 Unclassified 1148
75 Ga0075435_100002070 3300007076 Bacteria 13150
76 Ga0075435_100094553 3300007076 Bacteria 2471
77 Ga0111539_11395198 3300009094 Unclassified 813
78 Ga0114129_10040973 3300009147 Bacteria 6527
79 Ga0105248_10424617 3300009177 Bacteria 1497
80 Ga0105246_10284143 3300011119 Unclassified 1329
81 Ga0157375_10431623 3300013308 Bacteria 1483
82 Ga0157375_10643683 3300013308 Unclassified 1217
83 Ga0182008_10071993 3300014497 Bacteria 1701
84 Ga0157379_10040306 3300014968 Bacteria 4168
85 Ga0157376_10564052 3300014969 Unclassified 1128
86 Ga0207682_10205129 3300025893 Bacteria 908
87 Ga0207682_10257523 3300025893 Unclassified 813
88 Ga0207699_10021318 3300025906 Bacteria 3490
89 Ga0207643_10031277 3300025908 Bacteria 2966
90 Ga0207684_10013810 3300025910 Bacteria 6975
91 Ga0207684_10143957 3300025910 Bacteria 2050
92 Ga0207684_10531752 3300025910 Bacteria 1006
93 Ga0207693_10182436 3300025915 Bacteria 1652
94 Ga0207663_10000059 3300025916 Bacteria 56317
95 Ga0207660_10527980 3300025917 Bacteria 959
96 Ga0207652_10831257 3300025921 Bacteria 819
97 Ga0207646_10003549 3300025922 Bacteria 17535
98 Ga0207646_10010262 3300025922 Bacteria 9170
99 Ga0207646_10089170 3300025922 Bacteria 2760
100 Ga0207646_10201040 3300025922 Bacteria 1800
101 Ga0207646_10564996 3300025922 Unclassified 1022
102 Ga0207659_10109056 3300025926 Bacteria 2101
103 Ga0207664_10346213 3300025929 Bacteria 1315
104 Ga0207644_10282732 3300025931 Bacteria 1332
105 Ga0207706_10642535 3300025933 Bacteria 909
106 Ga0207704_10079322 3300025938 Bacteria 2115
107 Ga0207665_10001924 3300025939 Bacteria 13978
108 Ga0207665_10178231 3300025939 Bacteria 1538
109 Ga0207691_10058174 3300025940 Bacteria 3516
110 Ga0207691_10601470 3300025940 Bacteria 931
111 Ga0207711_10421199 3300025941 Bacteria 1242
112 Ga0207679_10825421 3300025945 Bacteria 846
113 Ga0207640_10526273 3300025981 Bacteria 989
114 Ga0207678_10197658 3300026067 Bacteria 1719
115 Ga0207641_10054366 3300026088 Bacteria 3397
116 Ga0207675_100348252 3300026118 Bacteria 1451
117 Ga0207698_10330482 3300026142 Bacteria 1432
118 Ga0209966_1034818 3300027695 Bacteria 1031
119 Ga0209998_10011777 3300027717 Bacteria 1814
120 Ga0307408_100049960 3300031548 Bacteria 3005
121 Ga0307408_100051380 3300031548 Bacteria 2969
122 Ga0307408_100259558 3300031548 Bacteria 1437
123 Ga0307405_10022030 3300031731 Bacteria 3595
124 Ga0307405_10117331 3300031731 Bacteria 1814
125 Ga0307405_10545469 3300031731 Bacteria 937
126 Ga0307413_10017681 3300031824 Bacteria 3719
127 Ga0307413_10132182 3300031824 Bacteria 1710
128 Ga0307413_10135425 3300031824 Bacteria 1693
129 Ga0307413_10284334 3300031824 Unclassified 1246
130 Ga0307410_10012352 3300031852 Bacteria 4936
131 Ga0307410_10069969 3300031852 Bacteria 2429
132 Ga0307410_10217275 3300031852 Bacteria 1468
133 Ga0307406_10072237 3300031901 Bacteria 2264
134 Ga0307406_10212814 3300031901 Bacteria 1431
135 Ga0307406_10383261 3300031901 Bacteria 1109
136 Ga0307406_10389754 3300031901 Unclassified 1101
137 Ga0307406_10688301 3300031901 Unclassified 852
138 Ga0307406_10734832 3300031901 Bacteria 827
139 Ga0307407_10047270 3300031903 Bacteria 2441
140 Ga0307407_10145412 3300031903 Bacteria 1534
141 Ga0307407_10312130 3300031903 Bacteria 1100
142 Ga0307412_10054742 3300031911 Bacteria 2650
143 Ga0307412_10096362 3300031911 Bacteria 2082
144 Ga0307412_10352806 3300031911 Bacteria 1182
145 Ga0307409_100014801 3300031995 Bacteria 5091
146 Ga0307409_100024651 3300031995 Bacteria 4200
147 Ga0307409_100032271 3300031995 Bacteria 3794
148 Ga0307409_100033519 3300031995 Bacteria 3738
149 Ga0307409_100369138 3300031995 Bacteria 1360
150 Ga0307409_100396769 3300031995 Unclassified 1316
151 Ga0307409_100399086 3300031995 Bacteria 1313
152 Ga0307409_101265240 3300031995 Bacteria 762
153 Ga0307416_100011135 3300032002 Bacteria 5982
154 Ga0307416_100014591 3300032002 Bacteria 5393
155 Ga0307416_100024458 3300032002 Bacteria 4410
156 Ga0307416_100029581 3300032002 Bacteria 4095
157 Ga0307416_100045967 3300032002 Bacteria 3442
158 Ga0307416_100053080 3300032002 Bacteria 3250
159 Ga0307416_100108993 3300032002 Bacteria 2434
160 Ga0307416_100273408 3300032002 Bacteria 1660
161 Ga0307416_100643316 3300032002 Bacteria 1144
162 Ga0307414_10180290 3300032004 Bacteria 1698
163 Ga0307414_10250051 3300032004 Bacteria 1473
164 Ga0307414_11286016 3300032004 Unclassified 678
165 Ga0307411_10004742 3300032005 Bacteria 6574
166 Ga0307411_10007717 3300032005 Bacteria 5511
167 Ga0307411_10069268 3300032005 Bacteria 2382
168 Ga0307411_10075501 3300032005 Bacteria 2301
169 Ga0307411_10160218 3300032005 Bacteria 1684
170 Ga0307415_100024805 3300032126 Bacteria 3752
171 Ga0307415_100046699 3300032126 Bacteria 2910
172 Ga0307415_100135246 3300032126 Bacteria 1873
173 Ga0307415_100175389 3300032126 Bacteria 1676
174 Ga0307415_100231523 3300032126 Bacteria 1488
175 Ga0307415_100364324 3300032126 Bacteria 1221
176 Ga0307415_100420007 3300032126 Bacteria 1147
177 Ga0373958_0019571 3300034819 Bacteria 1239
178 Ga0373958_0036621 3300034819 Bacteria 987
179 Ga0373959_0131980 3300034820 Unclassified 619
180 Ga0373928_0030152 3300035084 Bacteria 1197
181 Ga0373949_0094513 3300035090 Unclassified 812
182 Ga0373941_0166362 3300035115 Unclassified 819
183 Ga0373961_0242484 3300035241 Unclassified 650
184 Ga0373931_0031797 3300035691 Bacteria 2727
185 Ga0373931_0059689 3300035691 Bacteria 2052
186 Ga0395905_0035774 3300037471 Bacteria 4664
187 Ga0395905_0235684 3300037471 Bacteria 1711
188 Ga0395905_0358544 3300037471 Bacteria 1351
189 Ga0395905_0789003 3300037471 Bacteria 853
190 Ga0395901_0285483 3300038443 Bacteria 1714
191 Ga0439459_0020714 3300042438 Bacteria 1257
192 Ga0451577_0195646 3300042876 Unclassified 1825
193 Ga0453684_0490019 3300044712 Bacteria 1363
194 Ga0451576_0006696 3300045051 Bacteria 14051
195 Ga0466967_1353481 3300045976 Bacteria 709
196 Ga0495633_0262131 3300046558 Bacteria 788
197 Ga0496101_0034124 3300048904 Bacteria 3593
198 Ga0496101_0339245 3300048904 Bacteria 1180
199 Ga0496102_0035474 3300048905 Bacteria 4489
200 Ga0496102_0045816 3300048905 Bacteria 3971
201 Ga0496103_0139278 3300048906 Bacteria 1551
202 Ga0496103_0429911 3300048906 Bacteria 847
203 Ga0496104_0053357 3300048907 Bacteria 3819
204 Ga0496104_0117857 3300048907 Bacteria 2548
205 Ga0496105_0126606 3300048908 Bacteria 2106
206 Ga0496105_1000163 3300048908 Bacteria 625
207 Ga0496106_0071610 3300048909 Bacteria 2650
208 Ga0496107_0316154 3300048910 Bacteria 1162
209 Ga0496108_0004484 3300048911 Bacteria 11242
210 Ga0496108_0023724 3300048911 Bacteria 5048
211 Ga0496108_0051589 3300048911 Bacteria 3446
212 Ga0496108_0254168 3300048911 Bacteria 1529
213 Ga0496109_0017968 3300048912 Bacteria 6209
214 Ga0496109_0029817 3300048912 Bacteria 4888
215 Ga0496109_0173698 3300048912 Bacteria 2022
216 Ga0496110_0002484 3300048913 Bacteria 13822
217 Ga0496110_0185956 3300048913 Bacteria 1886
218 Ga0496110_0476175 3300048913 Bacteria 1137
219 Ga0496110_0832094 3300048913 Bacteria 828
220 Ga0496111_0001425 3300048914 Bacteria 13631
221 Ga0496111_0027552 3300048914 Bacteria 4021
222 Ga0496111_0212414 3300048914 Bacteria 1437
223 Ga0496112_0006611 3300048915 Bacteria 10206
224 Ga0496112_0012579 3300048915 Bacteria 7777
225 Ga0496112_0076233 3300048915 Bacteria 3316
226 Ga0496112_0594032 3300048915 Unclassified 1039
227 Ga0496113_0004992 3300048916 Bacteria 8224
228 Ga0496113_0032288 3300048916 Bacteria 3805
229 Ga0496113_0043376 3300048916 Bacteria 3328
230 Ga0496114_0193201 3300048917 Bacteria 1781
231 Ga0501297_018861 3300049520 Bacteria 850
232 Ga0501032_0075140 3300049569 Bacteria 2251
233 Ga0501033_0062473 3300049570 Bacteria 2743
234 Ga0501033_0090638 3300049570 Bacteria 2237
235 Ga0501034_0018062 3300049571 Bacteria 7238
236 Ga0501034_0081437 3300049571 Bacteria 3240
237 Ga0501036_0369428 3300049572 Bacteria 1197
238 Ga0501037_0169102 3300049573 Bacteria 1555
239 Ga0501037_0389807 3300049573 Bacteria 956
240 Ga0501037_0846492 3300049573 Bacteria 602
241 Ga0501038_0039891 3300049574 Bacteria 4105
242 Ga0501038_0109864 3300049574 Bacteria 2285
243 Ga0501039_0077907 3300049575 Bacteria 2578
244 Ga0501039_0351932 3300049575 Bacteria 1157
245 Ga0501043_0018756 3300049579 Bacteria 5429
246 Ga0501047_0000510 3300049581 Bacteria 41925
247 Ga0501047_0055372 3300049581 Bacteria 3836
248 Ga0501067_0078711 3300049583 Bacteria 1827
249 Ga0501068_0404612 3300049584 Bacteria 880
250 Ga0501068_0567018 3300049584 Unclassified 739
251 Ga0501069_0146509 3300049585 Bacteria 1356
252 Ga0501070_0375000 3300049586 Bacteria 1153
253 Ga0501071_0078701 3300049587 Bacteria 2410
254 Ga0501071_0867495 3300049587 Bacteria 696
255 Ga0501072_0541283 3300049588 Bacteria 920
256 Ga0501073_0802102 3300049589 Bacteria 649
257 Ga0501075_0312381 3300049591 Bacteria 1198
258 Ga0501076_0151378 3300049592 Bacteria 1887
259 Ga0501076_0273209 3300049592 Bacteria 1384
260 Ga0501077_0052210 3300049593 Bacteria 2597
261 Ga0501077_0084455 3300049593 Bacteria 2013
262 Ga0501216_019177 3300049660 Bacteria 1184
263 Ga0501217_015113 3300049661 Bacteria 1754
264 Ga0501239_000995 3300049672 Bacteria 2332
265 Ga0501247_005246 3300049677 Bacteria 1438
266 Ga0501249_011922 3300049679 Bacteria 1832
267 Ga0501249_022107 3300049679 Bacteria 1391
268 Ga0501257_007548 3300049686 Bacteria 2430
269 Ga0501079_0125012 3300049741 Bacteria 2001
270 Ga0501079_1008551 3300049741 Bacteria 656
271 Ga0501081_0025629 3300049743 Bacteria 3969
272 Ga0501266_033637 3300049763 Bacteria 740
273 Ga0501273_001501 3300049770 Bacteria 2237
274 Ga0501035_0000178 3300049822 Bacteria 77921
275 Ga0501035_0065321 3300049822 Bacteria 3232
276 Ga0501044_0000487 3300049823 Bacteria 48187
277 Ga0501045_0446155 3300049824 Bacteria 962
278 Ga0501212_014463 3300049851 Unclassified 1168
279 nmdc:mga05p37_1580942_c1 3300050507 Unclassified 647
280 nmdc:mga05p37_2011_c1 3300050507 Bacteria 23721
281 nmdc:mga05p37_88639_c1 3300050507 Bacteria 3813
282 nmdc:mga06r32_52489_c1 3300050510 Bacteria 3905
283 nmdc:mga0n895_4240_c1 3300050512 Bacteria 11725
284 nmdc:mga0n895_4755_c1 3300050512 Bacteria 11224
285 nmdc:mga0rr50_120482_c1 3300050513 Bacteria 2088
286 nmdc:mga08x19_8215_c1 3300050514 Bacteria 6203
287 nmdc:mga0a205_370754_c1 3300050515 Unclassified 1298
288 nmdc:mga0a205_890158_c1 3300050515 Bacteria 737
289 nmdc:mga0a205_989_c1 3300050515 Bacteria 23529
290 Ga0501084_0065690 3300054114 Bacteria 3036
291 Ga0501082_0024762 3300060353 Bacteria 5174
292 Ga0501082_0567849 3300060353 Bacteria 992
293 Ga0530510_0260213 3300061734 Bacteria 1294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0195646 Ga0451577_0195646_356_817 153
2 3300044712 Ga0453684_0490019 Ga0453684_0490019_649_1110 153
3 3300045051 Ga0451576_0006696 Ga0451576_0006696_5397_5858 153
4 3300049589 Ga0501073_0802102 Ga0501073_0802102_25_486 153
5 3300049592 Ga0501076_0273209 Ga0501076_0273209_501_962 153
6 3300049593 Ga0501077_0052210 Ga0501077_0052210_442_903 153
7 3300049741 Ga0501079_0125012 Ga0501079_0125012_1274_1735 153
8 3300060353 Ga0501082_0567849 Ga0501082_0567849_331_792 153
9 3300054114 Ga0501084_0065690 Ga0501084_0065690_2061_2555 162
10 3300049573 Ga0501037_0846492 Ga0501037_0846492_23_532 167
11 3300049575 Ga0501039_0077907 Ga0501039_0077907_1654_2163 167
12 3300049587 Ga0501071_0078701 Ga0501071_0078701_958_1467 167
13 3300049592 Ga0501076_0151378 Ga0501076_0151378_164_673 167
14 3300049593 Ga0501077_0084455 Ga0501077_0084455_484_993 167
15 3300049741 Ga0501079_1008551 Ga0501079_1008551_13_522 167
16 3300049743 Ga0501081_0025629 Ga0501081_0025629_694_1203 167
17 3300049824 Ga0501045_0446155 Ga0501045_0446155_207_716 167
18 3300060353 Ga0501082_0024762 Ga0501082_0024762_2733_3242 167
19 3300009094 Ga0111539_11395198 Ga0111539_113951982 170
20 3300049584 Ga0501068_0404612 Ga0501068_0404612_46_558 170
21 3300049587 Ga0501071_0867495 Ga0501071_0867495_153_671 172
22 3300049591 Ga0501075_0312381 Ga0501075_0312381_81_599 172
23 3300061734 Ga0530510_0260213 Ga0530510_0260213_50_568 172
24 3300048911 Ga0496108_0254168 Ga0496108_0254168_21_542 173
25 3300025910 Ga0207684_10531752 Ga0207684_105317522 174
26 3300025933 Ga0207706_10642535 Ga0207706_106425352 175
27 3300005340 Ga0070689_100808996 Ga0070689_1008089961 181
28 3300025926 Ga0207659_10109056 Ga0207659_101090562 181
29 3300014497 Ga0182008_10071993 Ga0182008_100719932 182
30 3300049584 Ga0501068_0567018 Ga0501068_0567018_160_708 182
31 3300049588 Ga0501072_0541283 Ga0501072_0541283_71_619 182
32 3300005336 Ga0070680_100753605 Ga0070680_1007536052 183
33 3300025917 Ga0207660_10527980 Ga0207660_105279802 183
34 3300049569 Ga0501032_0075140 Ga0501032_0075140_788_1348 183
35 3300049570 Ga0501033_0090638 Ga0501033_0090638_503_1063 183
36 3300049571 Ga0501034_0081437 Ga0501034_0081437_279_839 183
37 3300049573 Ga0501037_0169102 Ga0501037_0169102_231_791 183
38 3300049574 Ga0501038_0109864 Ga0501038_0109864_408_968 183
39 3300049575 Ga0501039_0351932 Ga0501039_0351932_511_1071 183
40 3300049581 Ga0501047_0000510 Ga0501047_0000510_12737_13297 183
41 3300049586 Ga0501070_0375000 Ga0501070_0375000_231_791 183
42 3300049822 Ga0501035_0000178 Ga0501035_0000178_29411_29971 183
43 3300049823 Ga0501044_0000487 Ga0501044_0000487_33985_34545 183
44 3300005333 Ga0070677_10143048 Ga0070677_101430481 184
45 3300005354 Ga0070675_100712007 Ga0070675_1007120072 184
46 3300005440 Ga0070705_100033217 Ga0070705_1000332174 184
47 3300005440 Ga0070705_100321340 Ga0070705_1003213402 184
48 3300005444 Ga0070694_100383075 Ga0070694_1003830752 184
49 3300005445 Ga0070708_100004286 Ga0070708_10000428611 184
50 3300005445 Ga0070708_100007056 Ga0070708_1000070564 184
51 3300005445 Ga0070708_100134442 Ga0070708_1001344422 184
52 3300005457 Ga0070662_100771327 Ga0070662_1007713272 184
53 3300005467 Ga0070706_100015912 Ga0070706_1000159123 184
54 3300005467 Ga0070706_100195671 Ga0070706_1001956712 184
55 3300005468 Ga0070707_100008444 Ga0070707_1000084443 184
56 3300005468 Ga0070707_100232665 Ga0070707_1002326652 184
57 3300005471 Ga0070698_100005894 Ga0070698_10000589411 184
58 3300005471 Ga0070698_100033847 Ga0070698_1000338476 184
59 3300005518 Ga0070699_100001113 Ga0070699_10000111325 184
60 3300005518 Ga0070699_100030317 Ga0070699_1000303174 184
61 3300005518 Ga0070699_100040732 Ga0070699_1000407322 184
62 3300005536 Ga0070697_100002673 Ga0070697_10000267314 184
63 3300005536 Ga0070697_100490649 Ga0070697_1004906491 184
64 3300005536 Ga0070697_100638602 Ga0070697_1006386022 184
65 3300005536 Ga0070697_100945987 Ga0070697_1009459871 184
66 3300005545 Ga0070695_100113981 Ga0070695_1001139811 184
67 3300005545 Ga0070695_100174552 Ga0070695_1001745522 184
68 3300005546 Ga0070696_100111172 Ga0070696_1001111723 184
69 3300005546 Ga0070696_100205065 Ga0070696_1002050651 184
70 3300005546 Ga0070696_100240396 Ga0070696_1002403962 184
71 3300005549 Ga0070704_100050056 Ga0070704_1000500561 184
72 3300005841 Ga0068863_100053203 Ga0068863_1000532033 184
73 3300006173 Ga0070716_100071112 Ga0070716_1000711123 184
74 3300006175 Ga0070712_100236069 Ga0070712_1002360692 184
75 3300006175 Ga0070712_100491640 Ga0070712_1004916402 184
76 3300006852 Ga0075433_10021805 Ga0075433_100218056 184
77 3300006852 Ga0075433_10038426 Ga0075433_100384263 184
78 3300006852 Ga0075433_10829618 Ga0075433_108296182 184
79 3300006871 Ga0075434_100012189 Ga0075434_10001218910 184
80 3300006871 Ga0075434_100023830 Ga0075434_1000238306 184
81 3300006914 Ga0075436_100464567 Ga0075436_1004645671 184
82 3300007076 Ga0075435_100002070 Ga0075435_10000207011 184
83 3300007076 Ga0075435_100094553 Ga0075435_1000945533 184
84 3300009147 Ga0114129_10040973 Ga0114129_100409736 184
85 3300009177 Ga0105248_10424617 Ga0105248_104246172 184
86 3300025893 Ga0207682_10257523 Ga0207682_102575232 184
87 3300025910 Ga0207684_10013810 Ga0207684_100138105 184
88 3300025910 Ga0207684_10143957 Ga0207684_101439572 184
89 3300025915 Ga0207693_10182436 Ga0207693_101824363 184
90 3300025921 Ga0207652_10831257 Ga0207652_108312572 184
91 3300025922 Ga0207646_10003549 Ga0207646_100035498 184
92 3300025922 Ga0207646_10010262 Ga0207646_100102628 184
93 3300025922 Ga0207646_10089170 Ga0207646_100891702 184
94 3300025922 Ga0207646_10201040 Ga0207646_102010402 184
95 3300025922 Ga0207646_10564996 Ga0207646_105649962 184
96 3300025931 Ga0207644_10282732 Ga0207644_102827322 184
97 3300025939 Ga0207665_10001924 Ga0207665_1000192410 184
98 3300026088 Ga0207641_10054366 Ga0207641_100543663 184
99 3300031824 Ga0307413_10132182 Ga0307413_101321822 184
100 3300031901 Ga0307406_10212814 Ga0307406_102128142 184
101 3300031901 Ga0307406_10389754 Ga0307406_103897542 184
102 3300031901 Ga0307406_10734832 Ga0307406_107348322 184
103 3300031995 Ga0307409_100024651 Ga0307409_1000246512 184
104 3300031995 Ga0307409_100399086 Ga0307409_1003990862 184
105 3300032002 Ga0307416_100024458 Ga0307416_1000244583 184
106 3300032002 Ga0307416_100029581 Ga0307416_1000295812 184
107 3300032002 Ga0307416_100053080 Ga0307416_1000530803 184
108 3300032004 Ga0307414_10180290 Ga0307414_101802902 184
109 3300032004 Ga0307414_11286016 Ga0307414_112860161 184
110 3300032005 Ga0307411_10069268 Ga0307411_100692683 184
111 3300032005 Ga0307411_10075501 Ga0307411_100755012 184
112 3300032126 Ga0307415_100420007 Ga0307415_1004200071 184
113 3300034819 Ga0373958_0036621 Ga0373958_0036621_72_626 184
114 3300035084 Ga0373928_0030152 Ga0373928_0030152_527_1081 184
115 3300035090 Ga0373949_0094513 Ga0373949_0094513_23_577 184
116 3300035115 Ga0373941_0166362 Ga0373941_0166362_204_758 184
117 3300035691 Ga0373931_0031797 Ga0373931_0031797_1313_1867 184
118 3300035691 Ga0373931_0059689 Ga0373931_0059689_842_1396 184
119 3300037471 Ga0395905_0035774 Ga0395905_0035774_3941_4495 184
120 3300037471 Ga0395905_0235684 Ga0395905_0235684_729_1283 184
121 3300037471 Ga0395905_0358544 Ga0395905_0358544_59_613 184
122 3300037471 Ga0395905_0789003 Ga0395905_0789003_206_763 184
123 3300038443 Ga0395901_0285483 Ga0395901_0285483_34_588 184
124 3300042438 Ga0439459_0020714 Ga0439459_0020714_388_942 184
125 3300045976 Ga0466967_1353481 Ga0466967_1353481_76_630 184
126 3300048904 Ga0496101_0339245 Ga0496101_0339245_72_626 184
127 3300048905 Ga0496102_0035474 Ga0496102_0035474_2470_3024 184
128 3300048905 Ga0496102_0045816 Ga0496102_0045816_1003_1557 184
129 3300048906 Ga0496103_0139278 Ga0496103_0139278_157_711 184
130 3300048906 Ga0496103_0429911 Ga0496103_0429911_223_777 184
131 3300048907 Ga0496104_0053357 Ga0496104_0053357_2231_2785 184
132 3300048907 Ga0496104_0117857 Ga0496104_0117857_10_564 184
133 3300048908 Ga0496105_0126606 Ga0496105_0126606_1033_1587 184
134 3300048908 Ga0496105_1000163 Ga0496105_1000163_44_598 184
135 3300048910 Ga0496107_0316154 Ga0496107_0316154_553_1107 184
136 3300048911 Ga0496108_0023724 Ga0496108_0023724_1306_1860 184
137 3300048911 Ga0496108_0051589 Ga0496108_0051589_1324_1878 184
138 3300048912 Ga0496109_0017968 Ga0496109_0017968_3649_4203 184
139 3300048912 Ga0496109_0173698 Ga0496109_0173698_1444_1998 184
140 3300048913 Ga0496110_0185956 Ga0496110_0185956_1040_1594 184
141 3300048913 Ga0496110_0476175 Ga0496110_0476175_73_627 184
142 3300048914 Ga0496111_0027552 Ga0496111_0027552_2332_2886 184
143 3300048914 Ga0496111_0212414 Ga0496111_0212414_826_1380 184
144 3300048915 Ga0496112_0006611 Ga0496112_0006611_7212_7766 184
145 3300048915 Ga0496112_0012579 Ga0496112_0012579_3186_3740 184
146 3300048915 Ga0496112_0594032 Ga0496112_0594032_107_661 184
147 3300048916 Ga0496113_0004992 Ga0496113_0004992_5763_6317 184
148 3300048916 Ga0496113_0043376 Ga0496113_0043376_997_1551 184
149 3300048917 Ga0496114_0193201 Ga0496114_0193201_431_985 184
150 3300049585 Ga0501069_0146509 Ga0501069_0146509_133_687 184
151 3300050507 nmdc:mga05p37_1580942_c1 nmdc:mga05p37_1580942_c1_24_578 184
152 3300050507 nmdc:mga05p37_2011_c1 nmdc:mga05p37_2011_c1_15034_15606 184
153 3300050507 nmdc:mga05p37_88639_c1 nmdc:mga05p37_88639_c1_950_1504 184
154 3300050512 nmdc:mga0n895_4240_c1 nmdc:mga0n895_4240_c1_9913_10485 184
155 3300050512 nmdc:mga0n895_4755_c1 nmdc:mga0n895_4755_c1_7498_8070 184
156 3300050513 nmdc:mga0rr50_120482_c1 nmdc:mga0rr50_120482_c1_51_623 184
157 3300050515 nmdc:mga0a205_370754_c1 nmdc:mga0a205_370754_c1_713_1285 184
158 3300050515 nmdc:mga0a205_890158_c1 nmdc:mga0a205_890158_c1_36_590 184
159 3300050515 nmdc:mga0a205_989_c1 nmdc:mga0a205_989_c1_8009_8581 184
160 3300003316 rootH1_10143376 rootH1_101433762 185
161 3300003322 rootL2_10111054 rootL2_101110542 185
162 3300005328 Ga0070676_10251146 Ga0070676_102511462 185
163 3300005334 Ga0068869_100416875 Ga0068869_1004168751 185
164 3300005334 Ga0068869_100520721 Ga0068869_1005207212 185
165 3300005336 Ga0070680_100372791 Ga0070680_1003727912 185
166 3300005347 Ga0070668_100086841 Ga0070668_1000868412 185
167 3300005366 Ga0070659_100191305 Ga0070659_1001913052 185
168 3300005434 Ga0070709_10007945 Ga0070709_100079452 185
169 3300005435 Ga0070714_100721286 Ga0070714_1007212862 185
170 3300005440 Ga0070705_100211143 Ga0070705_1002111432 185
171 3300005444 Ga0070694_100119208 Ga0070694_1001192082 185
172 3300005457 Ga0070662_100786167 Ga0070662_1007861672 185
173 3300005458 Ga0070681_10287119 Ga0070681_102871192 185
174 3300005518 Ga0070699_100084676 Ga0070699_1000846764 185
175 3300005539 Ga0068853_101353605 Ga0068853_1013536051 185
176 3300005543 Ga0070672_100074059 Ga0070672_1000740592 185
177 3300005545 Ga0070695_100044653 Ga0070695_1000446533 185
178 3300005564 Ga0070664_100271426 Ga0070664_1002714262 185
179 3300005564 Ga0070664_100641216 Ga0070664_1006412162 185
180 3300005578 Ga0068854_100593964 Ga0068854_1005939641 185
181 3300005718 Ga0068866_10735979 Ga0068866_107359791 185
182 3300005719 Ga0068861_100756321 Ga0068861_1007563212 185
183 3300005841 Ga0068863_100363158 Ga0068863_1003631582 185
184 3300005841 Ga0068863_100925430 Ga0068863_1009254302 185
185 3300005937 Ga0081455_10099512 Ga0081455_100995122 185
186 3300006173 Ga0070716_100369344 Ga0070716_1003693442 185
187 3300006846 Ga0075430_100020103 Ga0075430_1000201033 185
188 3300006847 Ga0075431_100013935 Ga0075431_1000139355 185
189 3300006847 Ga0075431_100789165 Ga0075431_1007891652 185
190 3300006881 Ga0068865_100169842 Ga0068865_1001698422 185
191 3300006914 Ga0075436_100000571 Ga0075436_10000057117 185
192 3300006931 Ga0097620_100648504 Ga0097620_1006485042 185
193 3300011119 Ga0105246_10284143 Ga0105246_102841432 185
194 3300013308 Ga0157375_10431623 Ga0157375_104316232 185
195 3300013308 Ga0157375_10643683 Ga0157375_106436832 185
196 3300014968 Ga0157379_10040306 Ga0157379_100403063 185
197 3300014969 Ga0157376_10564052 Ga0157376_105640522 185
198 3300025893 Ga0207682_10205129 Ga0207682_102051291 185
199 3300025906 Ga0207699_10021318 Ga0207699_100213184 185
200 3300025908 Ga0207643_10031277 Ga0207643_100312772 185
201 3300025916 Ga0207663_10000059 Ga0207663_100000594 185
202 3300025929 Ga0207664_10346213 Ga0207664_103462132 185
203 3300025938 Ga0207704_10079322 Ga0207704_100793222 185
204 3300025939 Ga0207665_10178231 Ga0207665_101782312 185
205 3300025940 Ga0207691_10058174 Ga0207691_100581743 185
206 3300025940 Ga0207691_10601470 Ga0207691_106014702 185
207 3300025941 Ga0207711_10421199 Ga0207711_104211992 185
208 3300025945 Ga0207679_10825421 Ga0207679_108254212 185
209 3300025981 Ga0207640_10526273 Ga0207640_105262732 185
210 3300026067 Ga0207678_10197658 Ga0207678_101976582 185
211 3300026118 Ga0207675_100348252 Ga0207675_1003482522 185
212 3300026142 Ga0207698_10330482 Ga0207698_103304822 185
213 3300027695 Ga0209966_1034818 Ga0209966_10348182 185
214 3300027717 Ga0209998_10011777 Ga0209998_100117773 185
215 3300031548 Ga0307408_100049960 Ga0307408_1000499603 185
216 3300031548 Ga0307408_100051380 Ga0307408_1000513801 185
217 3300031548 Ga0307408_100259558 Ga0307408_1002595582 185
218 3300031731 Ga0307405_10022030 Ga0307405_100220303 185
219 3300031731 Ga0307405_10117331 Ga0307405_101173312 185
220 3300031731 Ga0307405_10545469 Ga0307405_105454692 185
221 3300031824 Ga0307413_10017681 Ga0307413_100176813 185
222 3300031824 Ga0307413_10135425 Ga0307413_101354252 185
223 3300031824 Ga0307413_10284334 Ga0307413_102843342 185
224 3300031852 Ga0307410_10012352 Ga0307410_100123523 185
225 3300031852 Ga0307410_10069969 Ga0307410_100699692 185
226 3300031852 Ga0307410_10217275 Ga0307410_102172752 185
227 3300031901 Ga0307406_10072237 Ga0307406_100722373 185
228 3300031901 Ga0307406_10383261 Ga0307406_103832612 185
229 3300031901 Ga0307406_10688301 Ga0307406_106883011 185
230 3300031903 Ga0307407_10047270 Ga0307407_100472703 185
231 3300031903 Ga0307407_10145412 Ga0307407_101454122 185
232 3300031903 Ga0307407_10312130 Ga0307407_103121302 185
233 3300031911 Ga0307412_10054742 Ga0307412_100547423 185
234 3300031911 Ga0307412_10096362 Ga0307412_100963623 185
235 3300031911 Ga0307412_10352806 Ga0307412_103528062 185
236 3300031995 Ga0307409_100014801 Ga0307409_1000148016 185
237 3300031995 Ga0307409_100032271 Ga0307409_1000322713 185
238 3300031995 Ga0307409_100033519 Ga0307409_1000335193 185
239 3300031995 Ga0307409_100369138 Ga0307409_1003691382 185
240 3300031995 Ga0307409_100396769 Ga0307409_1003967692 185
241 3300031995 Ga0307409_101265240 Ga0307409_1012652402 185
242 3300032002 Ga0307416_100011135 Ga0307416_1000111354 185
243 3300032002 Ga0307416_100014591 Ga0307416_1000145914 185
244 3300032002 Ga0307416_100045967 Ga0307416_1000459673 185
245 3300032002 Ga0307416_100108993 Ga0307416_1001089932 185
246 3300032002 Ga0307416_100273408 Ga0307416_1002734082 185
247 3300032002 Ga0307416_100643316 Ga0307416_1006433161 185
248 3300032004 Ga0307414_10250051 Ga0307414_102500512 185
249 3300032005 Ga0307411_10004742 Ga0307411_100047423 185
250 3300032005 Ga0307411_10007717 Ga0307411_100077175 185
251 3300032005 Ga0307411_10160218 Ga0307411_101602182 185
252 3300032126 Ga0307415_100024805 Ga0307415_1000248053 185
253 3300032126 Ga0307415_100046699 Ga0307415_1000466992 185
254 3300032126 Ga0307415_100135246 Ga0307415_1001352463 185
255 3300032126 Ga0307415_100175389 Ga0307415_1001753892 185
256 3300032126 Ga0307415_100231523 Ga0307415_1002315232 185
257 3300032126 Ga0307415_100364324 Ga0307415_1003643242 185
258 3300034819 Ga0373958_0019571 Ga0373958_0019571_258_818 185
259 3300034820 Ga0373959_0131980 Ga0373959_0131980_20_580 185
260 3300035241 Ga0373961_0242484 Ga0373961_0242484_31_591 185
261 3300046558 Ga0495633_0262131 Ga0495633_0262131_139_699 185
262 3300048904 Ga0496101_0034124 Ga0496101_0034124_2590_3177 185
263 3300048909 Ga0496106_0071610 Ga0496106_0071610_79_666 185
264 3300048911 Ga0496108_0004484 Ga0496108_0004484_921_1508 185
265 3300048912 Ga0496109_0029817 Ga0496109_0029817_3816_4403 185
266 3300048913 Ga0496110_0002484 Ga0496110_0002484_6068_6655 185
267 3300048913 Ga0496110_0832094 Ga0496110_0832094_125_682 185
268 3300048914 Ga0496111_0001425 Ga0496111_0001425_6154_6741 185
269 3300048915 Ga0496112_0076233 Ga0496112_0076233_84_671 185
270 3300048916 Ga0496113_0032288 Ga0496113_0032288_2301_2888 185
271 3300049520 Ga0501297_018861 Ga0501297_018861_264_830 185
272 3300049570 Ga0501033_0062473 Ga0501033_0062473_2096_2662 185
273 3300049571 Ga0501034_0018062 Ga0501034_0018062_606_1172 185
274 3300049572 Ga0501036_0369428 Ga0501036_0369428_50_616 185
275 3300049573 Ga0501037_0389807 Ga0501037_0389807_273_839 185
276 3300049574 Ga0501038_0039891 Ga0501038_0039891_1588_2154 185
277 3300049579 Ga0501043_0018756 Ga0501043_0018756_2025_2591 185
278 3300049581 Ga0501047_0055372 Ga0501047_0055372_405_971 185
279 3300049583 Ga0501067_0078711 Ga0501067_0078711_1121_1681 185
280 3300049660 Ga0501216_019177 Ga0501216_019177_19_585 185
281 3300049661 Ga0501217_015113 Ga0501217_015113_311_877 185
282 3300049672 Ga0501239_000995 Ga0501239_000995_199_765 185
283 3300049677 Ga0501247_005246 Ga0501247_005246_757_1323 185
284 3300049679 Ga0501249_011922 Ga0501249_011922_71_637 185
285 3300049679 Ga0501249_022107 Ga0501249_022107_228_794 185
286 3300049686 Ga0501257_007548 Ga0501257_007548_74_640 185
287 3300049763 Ga0501266_033637 Ga0501266_033637_154_720 185
288 3300049770 Ga0501273_001501 Ga0501273_001501_49_615 185
289 3300049822 Ga0501035_0065321 Ga0501035_0065321_178_744 185
290 3300049851 Ga0501212_014463 Ga0501212_014463_91_657 185
291 3300050510 nmdc:mga06r32_52489_c1 nmdc:mga06r32_52489_c1_532_1092 185
292 3300050514 nmdc:mga08x19_8215_c1 nmdc:mga08x19_8215_c1_987_1571 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

64

159

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9612 4 170
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9559 5 171
2p9j-assembly1.cif.gz_A crystal structure of aq2171 from aquifex aeolicus 0.9505 5 165
2p9j-assembly1.cif.gz_D crystal structure of aq2171 from aquifex aeolicus 0.9499 3 166
3n1u-assembly1.cif.gz_A structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila 0.9494 5 178
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9562 4 169 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9377 5 176 3.40.50.1000
3e81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9336 11 164 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9274 5 176 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9244 1 172 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A844JJ20-F1-model_v4 deleted 0.9912 93 169
AF-A0A2V7P223-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9844 2 184 GO:0008781
GO:0009103
GO:0016788
AF-A0A432PY92-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45) 0.984 89 167 GO:0008781
GO:0009103
GO:0019143
AF-A0A848XWG6-F1-model_v4 HAD hydrolase family protein 0.9788 93 182 GO:0016787
AF-A0A6C1NNY8-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9781 2 180 GO:0008781
GO:0009103
GO:0016788

Feature Viewer

pLDDT pTM Quality
95.19 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map