F390936

General Info

Members Datasets Scaffolds Average Seq Length
292 220 584 592

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10021159|Ga0163163_100211594
Length 627
Sequence LNVNGTGGRCHFADSIVARADGPPRSKAVKVMVVDIAIVGAGGAGLRAAIAAAEADPALNIVLVSKVYPMRSHTVAAEGGSAGVTQRHDSLEHHFNDTVTGGEWLCDQDVVDYFVAHCTEEMVRLEHWGCPWSRLADGHVNVRAFGGMKIERTWFAADKTGFHILHTLFQTSIKYPAITRLDEHFCTALVVDDGRCYGVVAIDISSGEFTFVAAKAVVIATGGAGRVFLQNTNGGIVTGDGMAMVYRHGVALRDMEFVQYHPTCMPGSGLLFTEACRGEGGILTNKDGYRYLQDYGLGPPDPWPRNKAMELGPRDRLSQAFWHEERKGRTIATRNGAAVNLDLRHLGAKKLRERLPQICELAESFLGIDPAERPVPVRPAVHYTMGGILVNRETASTLTGLYAVGECSSIGIHGANRLGSNSLAELGVFGKVAGEAAARCARSLPPGPMATLKKQADDVRRRAVDLIRNEAGGERLAVLRDAMAQSMETGCGIYRLDAQMKQTCHTLAELKNRYRRLRLDDTSRAWNTEWLAAIELGYQLDVAQAMAHSAFARKESRGAHSRLDGFEQRDDANFLKHTLAVYRADGPPAISYMPVNITRSAPGKRAYGAEGEHLEGYRKEQTQGTNP

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
209 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
210 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
216 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
217 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
218 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
219 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
220 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0
Rhizoplane 5.48
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10021159 3300014325 Bacteria 6136
2 Ga0065715_10110308 3300005293 Bacteria 2599
3 Ga0070676_10041461 3300005328 Bacteria 2670
4 Ga0070690_100026833 3300005330 Bacteria 3556
5 Ga0070690_100027602 3300005330 Bacteria 3509
6 Ga0068869_100040928 3300005334 Bacteria 3315
7 Ga0068868_100017290 3300005338 Bacteria 5369
8 Ga0070660_100028084 3300005339 Bacteria 4207
9 Ga0070687_100025768 3300005343 Bacteria 2825
10 Ga0070668_100009541 3300005347 Bacteria 7202
11 Ga0070669_100080964 3300005353 Bacteria 2418
12 Ga0070671_100012882 3300005355 Bacteria 6741
13 Ga0070671_100018499 3300005355 Bacteria 5660
14 Ga0070671_100076938 3300005355 Bacteria 2788
15 Ga0070673_100005848 3300005364 Bacteria 7930
16 Ga0070673_100013152 3300005364 Bacteria 5712
17 Ga0070688_100001719 3300005365 Bacteria 10924
18 Ga0070659_100009610 3300005366 Bacteria 7109
19 Ga0070714_100072896 3300005435 Bacteria 2974
20 Ga0070713_100000028 3300005436 Bacteria 93227
21 Ga0070710_10023008 3300005437 Bacteria 3269
22 Ga0070711_100027125 3300005439 Bacteria 3758
23 Ga0070708_100000095 3300005445 Bacteria 58224
24 Ga0070663_100059013 3300005455 Bacteria 2757
25 Ga0070678_100002350 3300005456 Bacteria 10334
26 Ga0070662_100000028 3300005457 Bacteria 83508
27 Ga0068867_100000501 3300005459 Bacteria 26078
28 Ga0068867_100023259 3300005459 Bacteria 4436
29 Ga0068867_100067493 3300005459 Bacteria 2667
30 Ga0070685_10007520 3300005466 Bacteria 5577
31 Ga0070685_10062956 3300005466 Bacteria 2176
32 Ga0070707_100089387 3300005468 Bacteria 2981
33 Ga0070698_100015099 3300005471 Bacteria 8165
34 Ga0070679_100034668 3300005530 Bacteria 5002
35 Ga0068853_100004389 3300005539 Bacteria 10921
36 Ga0070672_100004378 3300005543 Bacteria 9247
37 Ga0070672_100053559 3300005543 Bacteria 3155
38 Ga0070695_100030574 3300005545 Bacteria 3354
39 Ga0070693_100002721 3300005547 Bacteria 8130
40 Ga0070665_100035877 3300005548 Bacteria 4989
41 Ga0068855_100007386 3300005563 Bacteria 13303
42 Ga0068855_100015533 3300005563 Bacteria 9166
43 Ga0070664_100006748 3300005564 Bacteria 9255
44 Ga0070664_100089790 3300005564 Bacteria 2659
45 Ga0068856_100004393 3300005614 Bacteria 14050
46 Ga0068856_100068638 3300005614 Bacteria 3505
47 Ga0068859_100000518 3300005617 Bacteria 38274
48 Ga0068866_10004313 3300005718 Bacteria 5839
49 Ga0068866_10006129 3300005718 Bacteria 5002
50 Ga0068861_100024138 3300005719 Bacteria 4394
51 Ga0068870_10023381 3300005840 Bacteria 3047
52 Ga0068863_100004210 3300005841 Bacteria 14209
53 Ga0068863_100051756 3300005841 Bacteria 3891
54 Ga0068858_100007654 3300005842 Bacteria 10434
55 Ga0068858_100109404 3300005842 Bacteria 2580
56 Ga0068860_100017155 3300005843 Bacteria 7058
57 Ga0068860_100051416 3300005843 Bacteria 3921
58 Ga0097621_100033186 3300006237 Bacteria 4109
59 Ga0068871_100022815 3300006358 Bacteria 4831
60 Ga0075428_100001908 3300006844 Bacteria 22367
61 Ga0075428_100059236 3300006844 Bacteria 4193
62 Ga0075430_100118389 3300006846 Bacteria 2208
63 Ga0075434_100030885 3300006871 Bacteria 5279
64 Ga0075429_100028246 3300006880 Bacteria 4871
65 Ga0068865_100012581 3300006881 Bacteria 5331
66 Ga0097620_100000518 3300006931 Bacteria 38274
67 Ga0075435_100051008 3300007076 Bacteria 3331
68 Ga0111539_10018988 3300009094 Bacteria 8499
69 Ga0111539_10029850 3300009094 Bacteria 6634
70 Ga0105243_10051211 3300009148 Bacteria 3265
71 Ga0105243_10056514 3300009148 Bacteria 3122
72 Ga0105241_10015571 3300009174 Bacteria 5573
73 Ga0105242_10038116 3300009176 Bacteria 3863
74 Ga0105248_10095345 3300009177 Bacteria 3350
75 Ga0105238_10011219 3300009551 Bacteria 9016
76 Ga0105238_10128244 3300009551 Bacteria 2515
77 Ga0157371_10000210 3300013102 Bacteria 84791
78 Ga0157369_10069186 3300013105 Bacteria 3793
79 Ga0157374_10055838 3300013296 Bacteria 3687
80 Ga0157374_10076146 3300013296 Bacteria 3172
81 Ga0157378_10005086 3300013297 Bacteria 11555
82 Ga0157378_10005529 3300013297 Bacteria 11066
83 Ga0163162_10003443 3300013306 Bacteria 15110
84 Ga0157372_10003657 3300013307 Bacteria 16524
85 Ga0157372_10015272 3300013307 Bacteria 8225
86 Ga0157375_10055640 3300013308 Bacteria 3902
87 Ga0163163_10055601 3300014325 Bacteria 3912
88 Ga0157380_10078584 3300014326 Bacteria 2692
89 Ga0157379_10090075 3300014968 Bacteria 2752
90 Ga0213872_10014392 3300021361 Bacteria 3691
91 Ga0213872_10024620 3300021361 Bacteria 2769
92 Ga0213871_10004743 3300021441 Bacteria 2747
93 Ga0209677_100592 3300025253 Bacteria 19729
94 Ga0209051_1022341 3300025303 Bacteria 2665
95 Ga0207682_10003443 3300025893 Bacteria 6875
96 Ga0207642_10023312 3300025899 Bacteria 2470
97 Ga0207680_10009918 3300025903 Bacteria 4744
98 Ga0207643_10030230 3300025908 Bacteria 3013
99 Ga0207684_10035581 3300025910 Bacteria 4228
100 Ga0207693_10000236 3300025915 Bacteria 50870
101 Ga0207663_10033365 3300025916 Bacteria 3066
102 Ga0207657_10000682 3300025919 Bacteria 36172
103 Ga0207657_10038747 3300025919 Bacteria 4239
104 Ga0207681_10071806 3300025923 Bacteria 2416
105 Ga0207681_10083245 3300025923 Bacteria 2264
106 Ga0207681_10085386 3300025923 Bacteria 2240
107 Ga0207694_10023295 3300025924 Bacteria 4701
108 Ga0207650_10013558 3300025925 Bacteria 5647
109 Ga0207659_10035202 3300025926 Bacteria 3459
110 Ga0207687_10035626 3300025927 Bacteria 3386
111 Ga0207700_10058697 3300025928 Bacteria 2908
112 Ga0207644_10012751 3300025931 Bacteria 5589
113 Ga0207644_10014884 3300025931 Bacteria 5214
114 Ga0207644_10026663 3300025931 Bacteria 3985
115 Ga0207690_10002006 3300025932 Bacteria 12465
116 Ga0207706_10000114 3300025933 Bacteria 86582
117 Ga0207706_10015435 3300025933 Bacteria 6900
118 Ga0207706_10047172 3300025933 Bacteria 3813
119 Ga0207686_10004032 3300025934 Bacteria 7879
120 Ga0207669_10027161 3300025937 Bacteria 3128
121 Ga0207704_10010256 3300025938 Bacteria 4561
122 Ga0207711_10036014 3300025941 Bacteria 4197
123 Ga0207689_10016148 3300025942 Bacteria 6322
124 Ga0207689_10046871 3300025942 Bacteria 3571
125 Ga0207679_10005560 3300025945 Bacteria 7898
126 Ga0207679_10102581 3300025945 Bacteria 2240
127 Ga0207667_10007115 3300025949 Bacteria 13503
128 Ga0207667_10105808 3300025949 Bacteria 2903
129 Ga0207651_10003811 3300025960 Bacteria 7473
130 Ga0207658_10040554 3300025986 Bacteria 3366
131 Ga0207677_10009171 3300026023 Bacteria 5556
132 Ga0207703_10029840 3300026035 Bacteria 4305
133 Ga0207703_10047271 3300026035 Bacteria 3469
134 Ga0207639_10033928 3300026041 Bacteria 3769
135 Ga0207708_10010719 3300026075 Bacteria 6813
136 Ga0207702_10007941 3300026078 Bacteria 8991
137 Ga0207702_10030145 3300026078 Bacteria 4519
138 Ga0207641_10037697 3300026088 Bacteria 4038
139 Ga0207648_10004276 3300026089 Bacteria 14725
140 Ga0207648_10035587 3300026089 Bacteria 4387
141 Ga0207676_10009534 3300026095 Bacteria 6910
142 Ga0207676_10019786 3300026095 Bacteria 4916
143 Ga0207676_10060025 3300026095 Bacteria 3006
144 Ga0207675_100038536 3300026118 Bacteria 4460
145 Ga0207683_10001186 3300026121 Bacteria 23608
146 Ga0207683_10017677 3300026121 Bacteria 6080
147 Ga0207428_10011721 3300027907 Bacteria 7731
148 Ga0268264_10023544 3300028381 Bacteria 5021
149 Ga0265330_10013464 3300031235 Bacteria 3811
150 Ga0265339_10051514 3300031249 Bacteria 2246
151 Ga0307508_10000001 3300031616 Bacteria 553635
152 Ga0265314_10055496 3300031711 Bacteria 2734
153 Ga0265314_10065564 3300031711 Bacteria 2452
154 Ga0307416_100017129 3300032002 Bacteria 5058
155 Ga0373945_0002421 3300035116 Bacteria 5853
156 Ga0373954_0000084 3300035118 Bacteria 33354
157 Ga0373956_0006845 3300035119 Bacteria 4576
158 Ga0373956_0030962 3300035119 Bacteria 2341
159 Ga0373946_0011781 3300035171 Bacteria 3269
160 Ga0373924_0001985 3300035410 Bacteria 6802
161 Ga0373924_0006555 3300035410 Bacteria 4175
162 Ga0373931_0012254 3300035691 Bacteria 4152
163 Ga0373927_0004884 3300035695 Bacteria 9317
164 Ga0373927_0015400 3300035695 Bacteria 5054
165 Ga0373933_0000105 3300035724 Bacteria 53488
166 Ga0373937_0033827 3300036401 Bacteria 4646
167 Ga0316584_0066631 3300036712 Bacteria 2698
168 Ga0373925_0006010 3300037068 Bacteria 8989
169 Ga0373925_0143860 3300037068 Bacteria 1868
170 Ga0395905_0003515 3300037471 Bacteria 16709
171 Ga0395905_0004424 3300037471 Bacteria 14604
172 Ga0395905_0182293 3300037471 Bacteria 1971
173 Ga0436360_0085165 3300039438 Bacteria 8407
174 Ga0436360_1300535 3300039438 Bacteria 4394
175 Ga0436361_0582192 3300039447 Bacteria 3845
176 Ga0436361_0772948 3300039447 Bacteria 4377
177 Ga0436361_0774340 3300039447 Bacteria 12095
178 Ga0439453_0005576 3300041408 Bacteria 1923
179 Ga0439451_014808 3300042009 Bacteria 1573
180 Ga0451577_0011083 3300042876 Bacteria 8559
181 Ga0453684_0011706 3300044712 Bacteria 14632
182 Ga0451576_0001640 3300045051 Bacteria 37361
183 Ga0451576_0055766 3300045051 Bacteria 4133
184 Ga0451576_0187661 3300045051 Bacteria 2159
185 Ga0495603_0011578 3300046455 Bacteria 5336
186 Ga0495629_0007109 3300046459 Bacteria 8246
187 Ga0495629_0022813 3300046459 Bacteria 4459
188 Ga0495641_0021622 3300046461 Bacteria 3233
189 Ga0495653_0001471 3300046463 Bacteria 18364
190 Ga0495580_0033906 3300046472 Bacteria 3676
191 Ga0495582_0007016 3300046473 Bacteria 6264
192 Ga0495639_0003106 3300046475 Bacteria 7223
193 Ga0495639_0019564 3300046475 Bacteria 2956
194 Ga0495662_0012884 3300046476 Bacteria 4073
195 Ga0495664_0008825 3300046477 Bacteria 5632
196 Ga0495594_0017763 3300046499 Bacteria 3761
197 Ga0495630_0045388 3300046517 Bacteria 3283
198 Ga0495640_0014307 3300046533 Bacteria 6009
199 Ga0495621_0011663 3300046539 Bacteria 2725
200 Ga0495645_0102657 3300046543 Bacteria 2032
201 Ga0495667_0010024 3300046559 Bacteria 6417
202 Ga0495656_0021257 3300046615 Bacteria 2525
203 Ga0495634_0007388 3300046642 Bacteria 8268
204 Ga0495635_0000636 3300046663 Bacteria 22538
205 Ga0495657_0065950 3300046675 Bacteria 2380
206 Ga0495599_0003673 3300046678 Bacteria 8997
207 Ga0495623_0017213 3300046679 Bacteria 4668
208 Ga0495647_0008734 3300046681 Bacteria 3411
209 Ga0495613_0023517 3300046689 Bacteria 4591
210 Ga0495604_0003160 3300047317 Bacteria 13167
211 Ga0495674_0006653 3300047319 Bacteria 11076
212 Ga0495674_0047882 3300047319 Bacteria 3787
213 Ga0495676_0028187 3300047321 Bacteria 4801
214 Ga0495680_0001883 3300047322 Bacteria 22052
215 Ga0495684_0000666 3300047471 Bacteria 27678
216 Ga0495593_0005206 3300047673 Bacteria 7686
217 Ga0495593_0022196 3300047673 Bacteria 3541
218 Ga0495602_0042888 3300048088 Bacteria 4117
219 Ga0496102_0005699 3300048905 Bacteria 10576
220 Ga0496104_0021636 3300048907 Bacteria 5905
221 Ga0496105_0001039 3300048908 Bacteria 19207
222 Ga0496106_0012385 3300048909 Bacteria 6297
223 Ga0496107_0112969 3300048910 Bacteria 1998
224 Ga0496108_0005993 3300048911 Bacteria 9846
225 Ga0496108_0052039 3300048911 Bacteria 3431
226 Ga0496109_0003480 3300048912 Bacteria 13148
227 Ga0496109_0026052 3300048912 Bacteria 5211
228 Ga0496110_0009513 3300048913 Bacteria 7866
229 Ga0496111_0001725 3300048914 Bacteria 12795
230 Ga0496112_0012922 3300048915 Bacteria 7691
231 Ga0496112_0241701 3300048915 Bacteria 1758
232 Ga0496113_0000537 3300048916 Bacteria 18713
233 Ga0496113_0006511 3300048916 Bacteria 7412
234 Ga0496115_0038223 3300048918 Bacteria 3807
235 Ga0496118_0017748 3300048921 Bacteria 6459
236 Ga0496119_0067380 3300048922 Bacteria 2111
237 Ga0496121_0023248 3300048924 Bacteria 5977
238 Ga0501032_0033679 3300049569 Bacteria 3509
239 Ga0501033_0000693 3300049570 Bacteria 31157
240 Ga0501036_0014957 3300049572 Bacteria 6473
241 Ga0501040_0000047 3300049576 Bacteria 55739
242 Ga0501041_0000619 3300049577 Bacteria 18562
243 Ga0501042_0000431 3300049578 Bacteria 21324
244 Ga0501042_0029564 3300049578 Bacteria 3865
245 Ga0501046_0001055 3300049580 Bacteria 26972
246 Ga0501047_0059822 3300049581 Bacteria 3678
247 Ga0501068_0015037 3300049584 Bacteria 4437
248 Ga0501071_0012022 3300049587 Bacteria 5851
249 Ga0501071_0063502 3300049587 Bacteria 2678
250 Ga0501072_0001155 3300049588 Bacteria 19638
251 Ga0501074_0038422 3300049590 Bacteria 3469
252 Ga0501075_0000506 3300049591 Bacteria 23460
253 Ga0501075_0007285 3300049591 Bacteria 7671
254 Ga0501076_0000100 3300049592 Bacteria 46870
255 Ga0501077_0000852 3300049593 Bacteria 18412
256 Ga0501077_0021545 3300049593 Bacteria 4079
257 Ga0501077_0061609 3300049593 Bacteria 2381
258 Ga0501080_0104027 3300049742 Bacteria 2633
259 Ga0501035_0074155 3300049822 Bacteria 3011
260 Ga0501044_0065055 3300049823 Bacteria 3719
261 nmdc:mga09592_568_c1 3300050508 Bacteria 28030
262 nmdc:mga09592_8419_c1 3300050508 Bacteria 8385
263 nmdc:mga0qj67_54479_c1 3300050509 Bacteria 3167
264 nmdc:mga08y16_6916_c1 3300050511 Bacteria 11894
265 nmdc:mga08y16_77267_c1 3300050511 Bacteria 3471
266 nmdc:mga0n895_19762_c1 3300050512 Bacteria 6267
267 nmdc:mga0n895_95529_c1 3300050512 Bacteria 2977
268 nmdc:mga08x19_24429_c1 3300050514 Bacteria 3756
269 Ga0495612_0007518 3300053078 Bacteria 4453
270 Ga0495619_0004437 3300053085 Bacteria 8950
271 Ga0495619_0049631 3300053085 Bacteria 2768
272 Ga0500566_0000313 3300053094 Bacteria 26190
273 Ga0500640_008092 3300053095 Bacteria 4136
274 Ga0500572_000129 3300053111 Bacteria 25501
275 Ga0500608_002838 3300053122 Bacteria 6401
276 Ga0500559_0000440 3300053136 Bacteria 29510
277 Ga0500559_0002043 3300053136 Bacteria 10798
278 Ga0500603_000246 3300053150 Bacteria 14245
279 Ga0500603_003832 3300053150 Bacteria 3219
280 Ga0500630_000052 3300053159 Bacteria 34496
281 Ga0500639_000123 3300053163 Bacteria 37026
282 Ga0500636_0009215 3300053177 Bacteria 5736
283 Ga0501084_0073310 3300054114 Bacteria 2867
284 Ga0501082_0003521 3300060353 Bacteria 13678
285 Ga0501082_0049156 3300060353 Bacteria 3636
286 Ga0530510_0001307 3300061734 Bacteria 16640
287 2547372963 2547132103 Bacteria 5115736
288 2691331067 2690315857 Bacteria 4396207
289 2843694027 2843690924 Bacteria 5169057
290 2846035828 2846033681 Bacteria 4377894
291 2846040374 2846037992 Bacteria 4526407
292 2919534625 2919534386 Bacteria 4577686
293 Ga0163163_10021159
294 Ga0065715_10110308
295 Ga0070676_10041461
296 Ga0070690_100026833
297 Ga0070690_100027602
298 Ga0068869_100040928
299 Ga0068868_100017290
300 Ga0070660_100028084
301 Ga0070687_100025768
302 Ga0070668_100009541
303 Ga0070669_100080964
304 Ga0070671_100012882
305 Ga0070671_100018499
306 Ga0070671_100076938
307 Ga0070673_100005848
308 Ga0070673_100013152
309 Ga0070688_100001719
310 Ga0070659_100009610
311 Ga0070714_100072896
312 Ga0070713_100000028
313 Ga0070710_10023008
314 Ga0070711_100027125
315 Ga0070708_100000095
316 Ga0070663_100059013
317 Ga0070678_100002350
318 Ga0070662_100000028
319 Ga0068867_100000501
320 Ga0068867_100023259
321 Ga0068867_100067493
322 Ga0070685_10007520
323 Ga0070685_10062956
324 Ga0070707_100089387
325 Ga0070698_100015099
326 Ga0070679_100034668
327 Ga0068853_100004389
328 Ga0070672_100004378
329 Ga0070672_100053559
330 Ga0070695_100030574
331 Ga0070693_100002721
332 Ga0070665_100035877
333 Ga0068855_100007386
334 Ga0068855_100015533
335 Ga0070664_100006748
336 Ga0070664_100089790
337 Ga0068856_100004393
338 Ga0068856_100068638
339 Ga0068859_100000518
340 Ga0068866_10004313
341 Ga0068866_10006129
342 Ga0068861_100024138
343 Ga0068870_10023381
344 Ga0068863_100004210
345 Ga0068863_100051756
346 Ga0068858_100007654
347 Ga0068858_100109404
348 Ga0068860_100017155
349 Ga0068860_100051416
350 Ga0097621_100033186
351 Ga0068871_100022815
352 Ga0075428_100001908
353 Ga0075428_100059236
354 Ga0075430_100118389
355 Ga0075434_100030885
356 Ga0075429_100028246
357 Ga0068865_100012581
358 Ga0097620_100000518
359 Ga0075435_100051008
360 Ga0111539_10018988
361 Ga0111539_10029850
362 Ga0105243_10051211
363 Ga0105243_10056514
364 Ga0105241_10015571
365 Ga0105242_10038116
366 Ga0105248_10095345
367 Ga0105238_10011219
368 Ga0105238_10128244
369 Ga0157371_10000210
370 Ga0157369_10069186
371 Ga0157374_10055838
372 Ga0157374_10076146
373 Ga0157378_10005086
374 Ga0157378_10005529
375 Ga0163162_10003443
376 Ga0157372_10003657
377 Ga0157372_10015272
378 Ga0157375_10055640
379 Ga0163163_10055601
380 Ga0157380_10078584
381 Ga0157379_10090075
382 Ga0213872_10014392
383 Ga0213872_10024620
384 Ga0213871_10004743
385 Ga0209677_100592
386 Ga0209051_1022341
387 Ga0207682_10003443
388 Ga0207642_10023312
389 Ga0207680_10009918
390 Ga0207643_10030230
391 Ga0207684_10035581
392 Ga0207693_10000236
393 Ga0207663_10033365
394 Ga0207657_10000682
395 Ga0207657_10038747
396 Ga0207681_10071806
397 Ga0207681_10083245
398 Ga0207681_10085386
399 Ga0207694_10023295
400 Ga0207650_10013558
401 Ga0207659_10035202
402 Ga0207687_10035626
403 Ga0207700_10058697
404 Ga0207644_10012751
405 Ga0207644_10014884
406 Ga0207644_10026663
407 Ga0207690_10002006
408 Ga0207706_10000114
409 Ga0207706_10015435
410 Ga0207706_10047172
411 Ga0207686_10004032
412 Ga0207669_10027161
413 Ga0207704_10010256
414 Ga0207711_10036014
415 Ga0207689_10016148
416 Ga0207689_10046871
417 Ga0207679_10005560
418 Ga0207679_10102581
419 Ga0207667_10007115
420 Ga0207667_10105808
421 Ga0207651_10003811
422 Ga0207658_10040554
423 Ga0207677_10009171
424 Ga0207703_10029840
425 Ga0207703_10047271
426 Ga0207639_10033928
427 Ga0207708_10010719
428 Ga0207702_10007941
429 Ga0207702_10030145
430 Ga0207641_10037697
431 Ga0207648_10004276
432 Ga0207648_10035587
433 Ga0207676_10009534
434 Ga0207676_10019786
435 Ga0207676_10060025
436 Ga0207675_100038536
437 Ga0207683_10001186
438 Ga0207683_10017677
439 Ga0207428_10011721
440 Ga0268264_10023544
441 Ga0265330_10013464
442 Ga0265339_10051514
443 Ga0307508_10000001
444 Ga0265314_10055496
445 Ga0265314_10065564
446 Ga0307416_100017129
447 Ga0373945_0002421
448 Ga0373954_0000084
449 Ga0373956_0006845
450 Ga0373956_0030962
451 Ga0373946_0011781
452 Ga0373924_0001985
453 Ga0373924_0006555
454 Ga0373931_0012254
455 Ga0373927_0004884
456 Ga0373927_0015400
457 Ga0373933_0000105
458 Ga0373937_0033827
459 Ga0316584_0066631
460 Ga0373925_0006010
461 Ga0373925_0143860
462 Ga0395905_0003515
463 Ga0395905_0004424
464 Ga0395905_0182293
465 Ga0436360_0085165
466 Ga0436360_1300535
467 Ga0436361_0582192
468 Ga0436361_0772948
469 Ga0436361_0774340
470 Ga0439453_0005576
471 Ga0439451_014808
472 Ga0451577_0011083
473 Ga0453684_0011706
474 Ga0451576_0001640
475 Ga0451576_0055766
476 Ga0451576_0187661
477 Ga0495603_0011578
478 Ga0495629_0007109
479 Ga0495629_0022813
480 Ga0495641_0021622
481 Ga0495653_0001471
482 Ga0495580_0033906
483 Ga0495582_0007016
484 Ga0495639_0003106
485 Ga0495639_0019564
486 Ga0495662_0012884
487 Ga0495664_0008825
488 Ga0495594_0017763
489 Ga0495630_0045388
490 Ga0495640_0014307
491 Ga0495621_0011663
492 Ga0495645_0102657
493 Ga0495667_0010024
494 Ga0495656_0021257
495 Ga0495634_0007388
496 Ga0495635_0000636
497 Ga0495657_0065950
498 Ga0495599_0003673
499 Ga0495623_0017213
500 Ga0495647_0008734
501 Ga0495613_0023517
502 Ga0495604_0003160
503 Ga0495674_0006653
504 Ga0495674_0047882
505 Ga0495676_0028187
506 Ga0495680_0001883
507 Ga0495684_0000666
508 Ga0495593_0005206
509 Ga0495593_0022196
510 Ga0495602_0042888
511 Ga0496102_0005699
512 Ga0496104_0021636
513 Ga0496105_0001039
514 Ga0496106_0012385
515 Ga0496107_0112969
516 Ga0496108_0005993
517 Ga0496108_0052039
518 Ga0496109_0003480
519 Ga0496109_0026052
520 Ga0496110_0009513
521 Ga0496111_0001725
522 Ga0496112_0012922
523 Ga0496112_0241701
524 Ga0496113_0000537
525 Ga0496113_0006511
526 Ga0496115_0038223
527 Ga0496118_0017748
528 Ga0496119_0067380
529 Ga0496121_0023248
530 Ga0501032_0033679
531 Ga0501033_0000693
532 Ga0501036_0014957
533 Ga0501040_0000047
534 Ga0501041_0000619
535 Ga0501042_0000431
536 Ga0501042_0029564
537 Ga0501046_0001055
538 Ga0501047_0059822
539 Ga0501068_0015037
540 Ga0501071_0012022
541 Ga0501071_0063502
542 Ga0501072_0001155
543 Ga0501074_0038422
544 Ga0501075_0000506
545 Ga0501075_0007285
546 Ga0501076_0000100
547 Ga0501077_0000852
548 Ga0501077_0021545
549 Ga0501077_0061609
550 Ga0501080_0104027
551 Ga0501035_0074155
552 Ga0501044_0065055
553 nmdc:mga09592_568_c1
554 nmdc:mga09592_8419_c1
555 nmdc:mga0qj67_54479_c1
556 nmdc:mga08y16_6916_c1
557 nmdc:mga08y16_77267_c1
558 nmdc:mga0n895_19762_c1
559 nmdc:mga0n895_95529_c1
560 nmdc:mga08x19_24429_c1
561 Ga0495612_0007518
562 Ga0495619_0004437
563 Ga0495619_0049631
564 Ga0500566_0000313
565 Ga0500640_008092
566 Ga0500572_000129
567 Ga0500608_002838
568 Ga0500559_0000440
569 Ga0500559_0002043
570 Ga0500603_000246
571 Ga0500603_003832
572 Ga0500630_000052
573 Ga0500639_000123
574 Ga0500636_0009215
575 Ga0501084_0073310
576 Ga0501082_0003521
577 Ga0501082_0049156
578 Ga0530510_0001307
579 2547372963
580 2691331067
581 2843694027
582 2846035828
583 2846040374
584 2919534625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

35

423

0.97

PF02910

Succ_DH_flav_C

Fumarate reductase flavoprotein C-term

480

607

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6awf-assembly2.cif.gz_E escherichia coli quinol:fumarate reductase crystallized without dicarboxylate 0.9488 14 588
6awf-assembly2.cif.gz_E escherichia coli quinol:fumarate reductase crystallized without dicarboxylate 0.9469 14 588
3dzb-assembly1.cif.gz_B crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9425 20 51
3cir-assembly1.cif.gz_A e. coli quinol fumarate reductase frda t234a mutation 0.9419 14 588
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9411 20 51
ID Description Score Start End Superfamily
af_Q0E3X3_17_318_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.981 20 52 3.50.50.100
1e7pA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9646 435 547 1.20.58.100
af_P00363_423_542_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9643 435 553 1.20.58.100
af_Q5A1E8_478_589_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9602 445 547 1.20.58.100
af_O53370_435_542_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9602 446 549 1.20.58.100
ID Description Score Start End GO Terms
AF-A0A7S9E1J2-F1-model_v4 Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein 0.9667 455 561 GO:0000104
GO:0005886
GO:0006113
GO:0009055
GO:0009061
GO:0050660
AF-A0A7Y2UMI2-F1-model_v4 Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein 0.9515 449 580 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A2N2A581-F1-model_v4 Fumarate reductase (Quinol) flavoprotein subunit 0.9479 406 594 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A3B8HLU9-F1-model_v4 Succinate dehydrogenase/fumarate reductase flavoprotein subunit 0.9456 464 592 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A3C7WEM0-F1-model_v4 Succinate dehydrogenase/fumarate reductase flavoprotein subunit 0.9429 454 602 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660

Map