F390933

General Info

Members Datasets Scaffolds Average Seq Length
292 182 584 100

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11250447|Ga0157372_112504472
Length 110
Sequence VVKVLRQNLNLMKRTEQRIQLLHPQGKHAPSISTDTYYLFEKAIIEILQQKEPLAFYDLIEEIKKYFKKNKIKFEGAVDWFGISVKNHLEARGIIETYTEKGKKLNKLKK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
161 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
162 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
182 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 1.37
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 26.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_11250447 3300013307 Bacteria 857
2 JGI24740J21852_10031450 3300001979 Unclassified 1711
3 JGI24738J21930_10024486 3300002075 Bacteria 1241
4 rootL2_10209014 3300003322 Bacteria 1774
5 rootH1_10045113 3300003323 Bacteria 1250
6 Ga0065704_10107840 3300005289 Bacteria 2045
7 Ga0065704_10123653 3300005289 Bacteria 1730
8 Ga0065712_10183507 3300005290 Bacteria 1181
9 Ga0065712_10250036 3300005290 Bacteria 962
10 Ga0065707_10547546 3300005295 Bacteria 703
11 Ga0070676_10459202 3300005328 Unclassified 897
12 Ga0070683_100115908 3300005329 Bacteria 2529
13 Ga0070690_101231693 3300005330 Bacteria 598
14 Ga0070670_100025115 3300005331 Bacteria 5127
15 Ga0070670_100136494 3300005331 Bacteria 2120
16 Ga0070670_100345088 3300005331 Bacteria 1307
17 Ga0070670_100762598 3300005331 Unclassified 872
18 Ga0070670_100948858 3300005331 Bacteria 781
19 Ga0070677_10420701 3300005333 Unclassified 708
20 Ga0068869_100140501 3300005334 Bacteria 1864
21 Ga0068869_100146548 3300005334 Bacteria 1827
22 Ga0068869_100209917 3300005334 Bacteria 1539
23 Ga0070666_10054006 3300005335 Bacteria 2710
24 Ga0070666_10187430 3300005335 Unclassified 1453
25 Ga0070680_100160200 3300005336 Unclassified 1891
26 Ga0070680_100368971 3300005336 Bacteria 1221
27 Ga0070682_100081452 3300005337 Unclassified 2096
28 Ga0070682_100723681 3300005337 Bacteria 800
29 Ga0068868_100034534 3300005338 Bacteria 3904
30 Ga0068868_100082182 3300005338 Bacteria 2583
31 Ga0068868_100755121 3300005338 Bacteria 874
32 Ga0070660_100127613 3300005339 Bacteria 2033
33 Ga0070661_100010053 3300005344 Bacteria 6567
34 Ga0070668_100182593 3300005347 Unclassified 1714
35 Ga0070668_100531149 3300005347 Bacteria 1022
36 Ga0070669_100001473 3300005353 Bacteria 17021
37 Ga0070669_101033023 3300005353 Bacteria 706
38 Ga0070675_100167432 3300005354 Bacteria 1893
39 Ga0070675_100507053 3300005354 Unclassified 1088
40 Ga0070671_101656482 3300005355 Bacteria 567
41 Ga0070674_100024103 3300005356 Unclassified 3947
42 Ga0070674_101259851 3300005356 Unclassified 658
43 Ga0070673_100007401 3300005364 Bacteria 7236
44 Ga0070673_100106127 3300005364 Bacteria 2322
45 Ga0070688_100336155 3300005365 Bacteria 1101
46 Ga0070688_101115637 3300005365 Bacteria 631
47 Ga0070659_100022983 3300005366 Bacteria 4767
48 Ga0070667_100113458 3300005367 Unclassified 2352
49 Ga0070667_100209728 3300005367 Bacteria 1731
50 Ga0070667_100943063 3300005367 Unclassified 804
51 Ga0070701_10112453 3300005438 Bacteria 1523
52 Ga0070700_100338705 3300005441 Bacteria 1111
53 Ga0070700_100983161 3300005441 Unclassified 692
54 Ga0070663_101371459 3300005455 Bacteria 625
55 Ga0070678_100020171 3300005456 Bacteria 4368
56 Ga0070662_100007944 3300005457 Bacteria 6901
57 Ga0070662_100087469 3300005457 Bacteria 2333
58 Ga0070681_10623488 3300005458 Unclassified 993
59 Ga0070681_11558289 3300005458 Bacteria 586
60 Ga0068867_100058533 3300005459 Bacteria 2856
61 Ga0068867_100078498 3300005459 Unclassified 2483
62 Ga0068867_100180118 3300005459 Unclassified 1680
63 Ga0070698_100020508 3300005471 Bacteria 6928
64 Ga0070699_100443610 3300005518 Bacteria 1176
65 Ga0070679_100269244 3300005530 Bacteria 1658
66 Ga0070679_101472165 3300005530 Bacteria 628
67 Ga0070684_100272183 3300005535 Unclassified 1550
68 Ga0068853_100031732 3300005539 Bacteria 4469
69 Ga0068853_100052880 3300005539 Bacteria 3497
70 Ga0070672_100035360 3300005543 Bacteria 3798
71 Ga0070672_100119060 3300005543 Bacteria 2159
72 Ga0070672_100300619 3300005543 Bacteria 1360
73 Ga0070693_100373892 3300005547 Bacteria 981
74 Ga0070665_100786629 3300005548 Unclassified 964
75 Ga0068855_100095948 3300005563 Bacteria 3417
76 Ga0070664_100074410 3300005564 Bacteria 2915
77 Ga0070664_100807725 3300005564 Unclassified 877
78 Ga0068857_100015919 3300005577 Bacteria 6584
79 Ga0068857_101801501 3300005577 Unclassified 599
80 Ga0068854_100013510 3300005578 Bacteria 5361
81 Ga0068854_100597421 3300005578 Bacteria 942
82 Ga0068856_100203021 3300005614 Unclassified 1997
83 Ga0070702_100136423 3300005615 Bacteria 1557
84 Ga0070702_101223597 3300005615 Bacteria 606
85 Ga0068852_100054169 3300005616 Bacteria 3457
86 Ga0068852_100326191 3300005616 Bacteria 1492
87 Ga0068852_100349707 3300005616 Bacteria 1443
88 Ga0068859_100010423 3300005617 Bacteria 9350
89 Ga0068859_100308569 3300005617 Bacteria 1676
90 Ga0068859_100494521 3300005617 Unclassified 1318
91 Ga0068859_101725551 3300005617 Bacteria 692
92 Ga0068859_101878163 3300005617 Bacteria 661
93 Ga0068864_100314255 3300005618 Bacteria 1470
94 Ga0068861_100550532 3300005719 Bacteria 1051
95 Ga0068851_10107102 3300005834 Bacteria 1489
96 Ga0068870_10003856 3300005840 Bacteria 6393
97 Ga0068863_101156852 3300005841 Unclassified 779
98 Ga0068863_102438676 3300005841 Unclassified 532
99 Ga0068858_100382648 3300005842 Bacteria 1350
100 Ga0068858_101972966 3300005842 Bacteria 577
101 Ga0068860_100023712 3300005843 Bacteria 5931
102 Ga0068860_102013818 3300005843 Bacteria 599
103 Ga0068862_100854410 3300005844 Bacteria 892
104 Ga0070715_10596531 3300006163 Bacteria 647
105 Ga0070716_101572033 3300006173 Unclassified 539
106 Ga0075366_10064311 3300006195 Bacteria 2182
107 Ga0075366_10248756 3300006195 Bacteria 1084
108 Ga0097621_100054469 3300006237 Bacteria 3263
109 Ga0097621_100158480 3300006237 Unclassified 1944
110 Ga0097621_101246827 3300006237 Unclassified 701
111 Ga0097621_101284853 3300006237 Bacteria 691
112 Ga0068871_100017855 3300006358 Bacteria 5379
113 Ga0068871_100277659 3300006358 Bacteria 1465
114 Ga0075428_100106825 3300006844 Bacteria 3051
115 Ga0075430_100094527 3300006846 Bacteria 2499
116 Ga0075431_101262509 3300006847 Unclassified 700
117 Ga0075429_100001234 3300006880 Bacteria 20728
118 Ga0068865_100061191 3300006881 Bacteria 2638
119 Ga0068865_100385842 3300006881 Bacteria 1144
120 Ga0097620_100010423 3300006931 Bacteria 9350
121 Ga0097620_100308566 3300006931 Bacteria 1676
122 Ga0097620_100494490 3300006931 Unclassified 1318
123 Ga0097620_101725598 3300006931 Bacteria 692
124 Ga0097620_101878830 3300006931 Bacteria 661
125 Ga0075435_101076969 3300007076 Bacteria 702
126 Ga0111539_10087579 3300009094 Bacteria 3658
127 Ga0111539_10727980 3300009094 Unclassified 1155
128 Ga0105245_11009697 3300009098 Bacteria 877
129 Ga0105247_10002367 3300009101 Bacteria 12851
130 Ga0105247_10205111 3300009101 Unclassified 1327
131 Ga0105243_11427647 3300009148 Bacteria 713
132 Ga0105241_10022809 3300009174 Bacteria 4639
133 Ga0105241_10700346 3300009174 Bacteria 925
134 Ga0105242_10037765 3300009176 Bacteria 3881
135 Ga0105242_11013510 3300009176 Bacteria 839
136 Ga0105248_13282081 3300009177 Unclassified 514
137 Ga0105249_10198338 3300009553 Bacteria 1963
138 Ga0105249_10612657 3300009553 Bacteria 1144
139 Ga0105249_11609230 3300009553 Bacteria 722
140 Ga0105249_13440583 3300009553 Bacteria 509
141 Ga0105246_10009802 3300011119 Bacteria 5907
142 Ga0105246_10032747 3300011119 Bacteria 3450
143 Ga0105246_10070991 3300011119 Bacteria 2451
144 Ga0157373_10012850 3300013100 Bacteria 6149
145 Ga0157373_10809926 3300013100 Bacteria 691
146 Ga0157371_10101750 3300013102 Bacteria 2038
147 Ga0157371_11119210 3300013102 Bacteria 604
148 Ga0157370_10027723 3300013104 Bacteria 5584
149 Ga0157369_10004821 3300013105 Bacteria 15839
150 Ga0157374_10013666 3300013296 Bacteria 7091
151 Ga0157374_10059982 3300013296 Bacteria 3559
152 Ga0157378_10045784 3300013297 Bacteria 3888
153 Ga0157378_10177949 3300013297 Bacteria 1999
154 Ga0157378_10203942 3300013297 Bacteria 1872
155 Ga0157378_10208066 3300013297 Bacteria 1854
156 Ga0157378_10929997 3300013297 Bacteria 901
157 Ga0163162_10391268 3300013306 Bacteria 1523
158 Ga0163162_10447880 3300013306 Unclassified 1423
159 Ga0163162_12806014 3300013306 Unclassified 561
160 Ga0163162_13409975 3300013306 Bacteria 507
161 Ga0157372_10393141 3300013307 Unclassified 1616
162 Ga0157375_10390173 3300013308 Bacteria 1559
163 Ga0163163_12876032 3300014325 Bacteria 537
164 Ga0157380_10054904 3300014326 Unclassified 3162
165 Ga0157380_10250927 3300014326 Bacteria 1601
166 Ga0157380_10964503 3300014326 Unclassified 883
167 Ga0157380_11263748 3300014326 Bacteria 784
168 Ga0157377_10011687 3300014745 Bacteria 4390
169 Ga0157377_10310372 3300014745 Unclassified 1044
170 Ga0157379_10753631 3300014968 Bacteria 917
171 Ga0157379_10865250 3300014968 Bacteria 856
172 Ga0157376_10160557 3300014969 Bacteria 2037
173 Ga0207697_10180467 3300025315 Unclassified 925
174 Ga0207656_10267026 3300025321 Bacteria 841
175 Ga0207682_10327061 3300025893 Unclassified 720
176 Ga0207688_10061347 3300025901 Bacteria 2119
177 Ga0207680_10141027 3300025903 Unclassified 1598
178 Ga0207680_10367024 3300025903 Bacteria 1013
179 Ga0207680_10369961 3300025903 Bacteria 1009
180 Ga0207647_10113958 3300025904 Unclassified 1598
181 Ga0207645_10002012 3300025907 Bacteria 16324
182 Ga0207643_10016325 3300025908 Bacteria 4049
183 Ga0207654_10534742 3300025911 Unclassified 831
184 Ga0207707_10529441 3300025912 Bacteria 1003
185 Ga0207660_10557432 3300025917 Bacteria 932
186 Ga0207660_11638740 3300025917 Bacteria 518
187 Ga0207662_10128452 3300025918 Bacteria 1596
188 Ga0207657_10004077 3300025919 Bacteria 15507
189 Ga0207649_10481561 3300025920 Bacteria 941
190 Ga0207652_10270366 3300025921 Unclassified 1533
191 Ga0207681_10614659 3300025923 Unclassified 899
192 Ga0207650_10051201 3300025925 Unclassified 3056
193 Ga0207650_10479965 3300025925 Unclassified 1037
194 Ga0207650_10592360 3300025925 Unclassified 932
195 Ga0207659_10826037 3300025926 Bacteria 796
196 Ga0207687_10813410 3300025927 Bacteria 797
197 Ga0207644_11495854 3300025931 Bacteria 567
198 Ga0207690_10839639 3300025932 Bacteria 760
199 Ga0207706_10013978 3300025933 Bacteria 7279
200 Ga0207706_10170318 3300025933 Bacteria 1913
201 Ga0207686_10024730 3300025934 Bacteria 3484
202 Ga0207686_10063682 3300025934 Bacteria 2346
203 Ga0207686_10458258 3300025934 Unclassified 982
204 Ga0207709_11203501 3300025935 Unclassified 624
205 Ga0207709_11684416 3300025935 Bacteria 527
206 Ga0207669_10205415 3300025937 Unclassified 1433
207 Ga0207704_10014273 3300025938 Bacteria 4007
208 Ga0207691_10005909 3300025940 Bacteria 11820
209 Ga0207689_10008559 3300025942 Bacteria 8918
210 Ga0207689_10019481 3300025942 Bacteria 5718
211 Ga0207689_10086741 3300025942 Bacteria 2572
212 Ga0207661_10051850 3300025944 Bacteria 3275
213 Ga0207679_10457086 3300025945 Bacteria 1133
214 Ga0207651_10002720 3300025960 Bacteria 8480
215 Ga0207651_10760308 3300025960 Bacteria 857
216 Ga0207712_10438040 3300025961 Unclassified 1106
217 Ga0207668_11068444 3300025972 Unclassified 723
218 Ga0207658_10091174 3300025986 Bacteria 2364
219 Ga0207658_10109629 3300025986 Bacteria 2180
220 Ga0207658_10560747 3300025986 Bacteria 1023
221 Ga0207677_10032430 3300026023 Unclassified 3358
222 Ga0207677_10295958 3300026023 Bacteria 1335
223 Ga0207703_10090621 3300026035 Bacteria 2570
224 Ga0207703_11203767 3300026035 Bacteria 728
225 Ga0207639_10033311 3300026041 Bacteria 3800
226 Ga0207639_10238997 3300026041 Unclassified 1578
227 Ga0207678_10715003 3300026067 Unclassified 882
228 Ga0207708_10935194 3300026075 Bacteria 751
229 Ga0207702_10039532 3300026078 Bacteria 3953
230 Ga0207641_11396565 3300026088 Unclassified 701
231 Ga0207648_10008941 3300026089 Bacteria 9637
232 Ga0207648_10078841 3300026089 Bacteria 2873
233 Ga0207648_10230345 3300026089 Unclassified 1648
234 Ga0207648_11558408 3300026089 Bacteria 621
235 Ga0207676_10021329 3300026095 Bacteria 4752
236 Ga0207676_11425766 3300026095 Unclassified 689
237 Ga0207676_12123654 3300026095 Bacteria 560
238 Ga0207674_10092864 3300026116 Bacteria 3007
239 Ga0207674_10189483 3300026116 Bacteria 2007
240 Ga0207683_10002037 3300026121 Bacteria 17876
241 Ga0207698_10080563 3300026142 Unclassified 2623
242 Ga0209995_1021519 3300027471 Unclassified 1069
243 Ga0268266_10042303 3300028379 Bacteria 3891
244 Ga0268265_10422658 3300028380 Unclassified 1238
245 Ga0268265_12437427 3300028380 Bacteria 529
246 Ga0268264_10041394 3300028381 Bacteria 3811
247 Ga0268264_10111754 3300028381 Bacteria 2394
248 Ga0307513_10998111 3300031456 Unclassified 547
249 Ga0307412_10930559 3300031911 Bacteria 764
250 Ga0307414_10775256 3300032004 Bacteria 873
251 Ga0307414_10972504 3300032004 Unclassified 781
252 Ga0436365_0032315 3300039437 Bacteria 806
253 Ga0436365_0687914 3300039437 Bacteria 2231
254 Ga0439461_0075036 3300041410 Unclassified 789
255 Ga0439466_0146989 3300041411 Unclassified 722
256 Ga0451798_0833453 3300041458 Unclassified 968
257 Ga0451804_1114226 3300041463 Bacteria 519
258 Ga0451807_0387045 3300041486 Unclassified 865
259 Ga0451833_0556207 3300041491 Bacteria 545
260 Ga0439431_0012562 3300041997 Unclassified 1947
261 Ga0439433_0055869 3300041999 Unclassified 936
262 Ga0439442_011336 3300042002 Unclassified 1814
263 Ga0439445_0052018 3300042004 Unclassified 1107
264 Ga0439449_0055002 3300042007 Unclassified 1470
265 Ga0450897_000286 3300042128 Bacteria 2640
266 Ga0450898_049534 3300042134 Unclassified 810
267 Ga0450899_004985 3300042135 Bacteria 1424
268 Ga0439446_0092487 3300042156 Unclassified 948
269 Ga0439434_0108673 3300042435 Unclassified 897
270 Ga0439435_0075105 3300042436 Bacteria 1006
271 Ga0439444_0005321 3300042437 Bacteria 1905
272 Ga0439459_0078548 3300042438 Bacteria 775
273 Ga0453683_1225746 3300044673 Bacteria 503
274 Ga0466967_0028334 3300045976 Bacteria 4675
275 Ga0466967_0772007 3300045976 Bacteria 954
276 Ga0495638_0063734 3300046460 Bacteria 2272
277 Ga0495650_0038087 3300046471 Bacteria 2086
278 Ga0495598_0264852 3300046537 Bacteria 641
279 Ga0495621_0052694 3300046539 Bacteria 1459
280 Ga0495625_0656070 3300046660 Bacteria 624
281 Ga0495672_0034039 3300047320 Bacteria 3152
282 Ga0495672_0061098 3300047320 Bacteria 2173
283 Ga0495672_0280774 3300047320 Bacteria 796
284 Ga0496106_0747297 3300048909 Bacteria 778
285 nmdc:mga0k408_178751_c1 3300050493 Bacteria 1265
286 nmdc:mga0k408_51247_c1 3300050493 Bacteria 2391
287 nmdc:mga0k408_8538_c1 3300050493 Bacteria 5502
288 nmdc:mga09592_18052_c1 3300050508 Bacteria 5784
289 nmdc:mga0qj67_87016_c1 3300050509 Bacteria 2507
290 nmdc:mga08y16_200110_c1 3300050511 Unclassified 2070
291 Ga0500588_0003080 3300053146 Bacteria 3479
292 Ga0500611_000060 3300053727 Bacteria 47744
293 Ga0157372_11250447
294 JGI24740J21852_10031450
295 JGI24738J21930_10024486
296 rootL2_10209014
297 rootH1_10045113
298 Ga0065704_10107840
299 Ga0065704_10123653
300 Ga0065712_10183507
301 Ga0065712_10250036
302 Ga0065707_10547546
303 Ga0070676_10459202
304 Ga0070683_100115908
305 Ga0070690_101231693
306 Ga0070670_100025115
307 Ga0070670_100136494
308 Ga0070670_100345088
309 Ga0070670_100762598
310 Ga0070670_100948858
311 Ga0070677_10420701
312 Ga0068869_100140501
313 Ga0068869_100146548
314 Ga0068869_100209917
315 Ga0070666_10054006
316 Ga0070666_10187430
317 Ga0070680_100160200
318 Ga0070680_100368971
319 Ga0070682_100081452
320 Ga0070682_100723681
321 Ga0068868_100034534
322 Ga0068868_100082182
323 Ga0068868_100755121
324 Ga0070660_100127613
325 Ga0070661_100010053
326 Ga0070668_100182593
327 Ga0070668_100531149
328 Ga0070669_100001473
329 Ga0070669_101033023
330 Ga0070675_100167432
331 Ga0070675_100507053
332 Ga0070671_101656482
333 Ga0070674_100024103
334 Ga0070674_101259851
335 Ga0070673_100007401
336 Ga0070673_100106127
337 Ga0070688_100336155
338 Ga0070688_101115637
339 Ga0070659_100022983
340 Ga0070667_100113458
341 Ga0070667_100209728
342 Ga0070667_100943063
343 Ga0070701_10112453
344 Ga0070700_100338705
345 Ga0070700_100983161
346 Ga0070663_101371459
347 Ga0070678_100020171
348 Ga0070662_100007944
349 Ga0070662_100087469
350 Ga0070681_10623488
351 Ga0070681_11558289
352 Ga0068867_100058533
353 Ga0068867_100078498
354 Ga0068867_100180118
355 Ga0070698_100020508
356 Ga0070699_100443610
357 Ga0070679_100269244
358 Ga0070679_101472165
359 Ga0070684_100272183
360 Ga0068853_100031732
361 Ga0068853_100052880
362 Ga0070672_100035360
363 Ga0070672_100119060
364 Ga0070672_100300619
365 Ga0070693_100373892
366 Ga0070665_100786629
367 Ga0068855_100095948
368 Ga0070664_100074410
369 Ga0070664_100807725
370 Ga0068857_100015919
371 Ga0068857_101801501
372 Ga0068854_100013510
373 Ga0068854_100597421
374 Ga0068856_100203021
375 Ga0070702_100136423
376 Ga0070702_101223597
377 Ga0068852_100054169
378 Ga0068852_100326191
379 Ga0068852_100349707
380 Ga0068859_100010423
381 Ga0068859_100308569
382 Ga0068859_100494521
383 Ga0068859_101725551
384 Ga0068859_101878163
385 Ga0068864_100314255
386 Ga0068861_100550532
387 Ga0068851_10107102
388 Ga0068870_10003856
389 Ga0068863_101156852
390 Ga0068863_102438676
391 Ga0068858_100382648
392 Ga0068858_101972966
393 Ga0068860_100023712
394 Ga0068860_102013818
395 Ga0068862_100854410
396 Ga0070715_10596531
397 Ga0070716_101572033
398 Ga0075366_10064311
399 Ga0075366_10248756
400 Ga0097621_100054469
401 Ga0097621_100158480
402 Ga0097621_101246827
403 Ga0097621_101284853
404 Ga0068871_100017855
405 Ga0068871_100277659
406 Ga0075428_100106825
407 Ga0075430_100094527
408 Ga0075431_101262509
409 Ga0075429_100001234
410 Ga0068865_100061191
411 Ga0068865_100385842
412 Ga0097620_100010423
413 Ga0097620_100308566
414 Ga0097620_100494490
415 Ga0097620_101725598
416 Ga0097620_101878830
417 Ga0075435_101076969
418 Ga0111539_10087579
419 Ga0111539_10727980
420 Ga0105245_11009697
421 Ga0105247_10002367
422 Ga0105247_10205111
423 Ga0105243_11427647
424 Ga0105241_10022809
425 Ga0105241_10700346
426 Ga0105242_10037765
427 Ga0105242_11013510
428 Ga0105248_13282081
429 Ga0105249_10198338
430 Ga0105249_10612657
431 Ga0105249_11609230
432 Ga0105249_13440583
433 Ga0105246_10009802
434 Ga0105246_10032747
435 Ga0105246_10070991
436 Ga0157373_10012850
437 Ga0157373_10809926
438 Ga0157371_10101750
439 Ga0157371_11119210
440 Ga0157370_10027723
441 Ga0157369_10004821
442 Ga0157374_10013666
443 Ga0157374_10059982
444 Ga0157378_10045784
445 Ga0157378_10177949
446 Ga0157378_10203942
447 Ga0157378_10208066
448 Ga0157378_10929997
449 Ga0163162_10391268
450 Ga0163162_10447880
451 Ga0163162_12806014
452 Ga0163162_13409975
453 Ga0157372_10393141
454 Ga0157375_10390173
455 Ga0163163_12876032
456 Ga0157380_10054904
457 Ga0157380_10250927
458 Ga0157380_10964503
459 Ga0157380_11263748
460 Ga0157377_10011687
461 Ga0157377_10310372
462 Ga0157379_10753631
463 Ga0157379_10865250
464 Ga0157376_10160557
465 Ga0207697_10180467
466 Ga0207656_10267026
467 Ga0207682_10327061
468 Ga0207688_10061347
469 Ga0207680_10141027
470 Ga0207680_10367024
471 Ga0207680_10369961
472 Ga0207647_10113958
473 Ga0207645_10002012
474 Ga0207643_10016325
475 Ga0207654_10534742
476 Ga0207707_10529441
477 Ga0207660_10557432
478 Ga0207660_11638740
479 Ga0207662_10128452
480 Ga0207657_10004077
481 Ga0207649_10481561
482 Ga0207652_10270366
483 Ga0207681_10614659
484 Ga0207650_10051201
485 Ga0207650_10479965
486 Ga0207650_10592360
487 Ga0207659_10826037
488 Ga0207687_10813410
489 Ga0207644_11495854
490 Ga0207690_10839639
491 Ga0207706_10013978
492 Ga0207706_10170318
493 Ga0207686_10024730
494 Ga0207686_10063682
495 Ga0207686_10458258
496 Ga0207709_11203501
497 Ga0207709_11684416
498 Ga0207669_10205415
499 Ga0207704_10014273
500 Ga0207691_10005909
501 Ga0207689_10008559
502 Ga0207689_10019481
503 Ga0207689_10086741
504 Ga0207661_10051850
505 Ga0207679_10457086
506 Ga0207651_10002720
507 Ga0207651_10760308
508 Ga0207712_10438040
509 Ga0207668_11068444
510 Ga0207658_10091174
511 Ga0207658_10109629
512 Ga0207658_10560747
513 Ga0207677_10032430
514 Ga0207677_10295958
515 Ga0207703_10090621
516 Ga0207703_11203767
517 Ga0207639_10033311
518 Ga0207639_10238997
519 Ga0207678_10715003
520 Ga0207708_10935194
521 Ga0207702_10039532
522 Ga0207641_11396565
523 Ga0207648_10008941
524 Ga0207648_10078841
525 Ga0207648_10230345
526 Ga0207648_11558408
527 Ga0207676_10021329
528 Ga0207676_11425766
529 Ga0207676_12123654
530 Ga0207674_10092864
531 Ga0207674_10189483
532 Ga0207683_10002037
533 Ga0207698_10080563
534 Ga0209995_1021519
535 Ga0268266_10042303
536 Ga0268265_10422658
537 Ga0268265_12437427
538 Ga0268264_10041394
539 Ga0268264_10111754
540 Ga0307513_10998111
541 Ga0307412_10930559
542 Ga0307414_10775256
543 Ga0307414_10972504
544 Ga0436365_0032315
545 Ga0436365_0687914
546 Ga0439461_0075036
547 Ga0439466_0146989
548 Ga0451798_0833453
549 Ga0451804_1114226
550 Ga0451807_0387045
551 Ga0451833_0556207
552 Ga0439431_0012562
553 Ga0439433_0055869
554 Ga0439442_011336
555 Ga0439445_0052018
556 Ga0439449_0055002
557 Ga0450897_000286
558 Ga0450898_049534
559 Ga0450899_004985
560 Ga0439446_0092487
561 Ga0439434_0108673
562 Ga0439435_0075105
563 Ga0439444_0005321
564 Ga0439459_0078548
565 Ga0453683_1225746
566 Ga0466967_0028334
567 Ga0466967_0772007
568 Ga0495638_0063734
569 Ga0495650_0038087
570 Ga0495598_0264852
571 Ga0495621_0052694
572 Ga0495625_0656070
573 Ga0495672_0034039
574 Ga0495672_0061098
575 Ga0495672_0280774
576 Ga0496106_0747297
577 nmdc:mga0k408_178751_c1
578 nmdc:mga0k408_51247_c1
579 nmdc:mga0k408_8538_c1
580 nmdc:mga09592_18052_c1
581 nmdc:mga0qj67_87016_c1
582 nmdc:mga08y16_200110_c1
583 Ga0500588_0003080
584 Ga0500611_000060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22278

DUF6958

Family of unknown function (DUF6958)

18

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k5q-assembly1.cif.gz_D structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.9392 29 97
1tbx-assembly1.cif.gz_B crystal structure of ssv1 f-93 0.8893 29 99
6dk4-assembly1.cif.gz_A crystal structure of campylobacter jejuni peroxide stress regulator 0.8629 26 97
5k5o-assembly1.cif.gz_C structure of aspa-26mer dna complex 0.8582 32 97
1sax-assembly1.cif.gz_A three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci in complex with 25-bp ds-dna 0.8535 30 97
ID Description Score Start End Superfamily
af_B8JMY3_258_345_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.9507 67 99 2.20.70.10
1tbxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8977 29 99 1.10.10.10
af_Q9XTV3_306_393_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.8897 67 99 2.20.70.10
af_A4HX19_2124_2200_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8543 24 97 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.854 30 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V6BKY2-F1-model_v4 Uncharacterized protein 0.968 5 97
AF-A0A537KJN3-F1-model_v4 Uncharacterized protein 0.9589 1 99
AF-A0A4Q2ZW54-F1-model_v4 Uncharacterized protein 0.9545 1 97
AF-A0A3B7MIH4-F1-model_v4 Uncharacterized protein 0.9543 5 98
AF-A0A537KJN3-F1-model_v4 Uncharacterized protein 0.9496 1 99

Map