F390904

General Info

Members Datasets Scaffolds Average Seq Length
292 192 584 136

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10816666|Ga0105242_108166662
Length 149
Sequence LNKSLKHLTVEAVKAIHHEVLAAHGGAAGIRDETLLESAVAAPQASMMGQPLISDPIEIAAAYLFYICKNHAFVDGNKRTALAACLVFLEENGFLADRKLAINEWEQFVLDVAASQLDRAATTGRLRKVLKPRARSVLRGKLLKKSRRS

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 4.79
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 32.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10816666 3300009176 Unclassified 924
2 SwRhRL2b_contig_3798451 2162886007 Bacteria 1690
3 rootH2_10015336 3300003320 Bacteria 12431
4 Ga0065704_10019336 3300005289 Bacteria 1696
5 Ga0065704_10340210 3300005289 Unclassified 824
6 Ga0065712_10013116 3300005290 Bacteria 2094
7 Ga0065715_10116715 3300005293 Unclassified 2354
8 Ga0065707_10017409 3300005295 Bacteria 1487
9 Ga0070676_10003022 3300005328 Bacteria 8696
10 Ga0070676_10058236 3300005328 Bacteria 2289
11 Ga0070676_10188992 3300005328 Unclassified 1343
12 Ga0070683_100081356 3300005329 Bacteria 3032
13 Ga0070690_100146773 3300005330 Bacteria 1606
14 Ga0070666_10104287 3300005335 Bacteria 1957
15 Ga0070680_100133678 3300005336 Bacteria 2077
16 Ga0070660_100191075 3300005339 Bacteria 1658
17 Ga0070660_100391086 3300005339 Bacteria 1149
18 Ga0070661_100281218 3300005344 Bacteria 1291
19 Ga0070668_100112856 3300005347 Bacteria 2165
20 Ga0070668_100516735 3300005347 Unclassified 1036
21 Ga0070668_100942404 3300005347 Unclassified 773
22 Ga0070669_100063090 3300005353 Bacteria 2726
23 Ga0070675_100012839 3300005354 Bacteria 6573
24 Ga0070675_100427562 3300005354 Bacteria 1185
25 Ga0070671_100223247 3300005355 Bacteria 1598
26 Ga0070671_100452325 3300005355 Bacteria 1102
27 Ga0070674_100154592 3300005356 Bacteria 1734
28 Ga0070673_100198867 3300005364 Bacteria 1725
29 Ga0070673_102110359 3300005364 Bacteria 535
30 Ga0070667_100046131 3300005367 Bacteria 3665
31 Ga0070667_100945338 3300005367 Unclassified 803
32 Ga0070714_100756526 3300005435 Bacteria 939
33 Ga0070713_100144894 3300005436 Bacteria 2107
34 Ga0070713_101603730 3300005436 Unclassified 632
35 Ga0070710_10124359 3300005437 Bacteria 1565
36 Ga0070710_10736441 3300005437 Bacteria 699
37 Ga0070711_100107780 3300005439 Bacteria 2039
38 Ga0070711_100219322 3300005439 Bacteria 1477
39 Ga0070711_100725234 3300005439 Bacteria 838
40 Ga0070705_100092402 3300005440 Bacteria 1889
41 Ga0070708_100127191 3300005445 Bacteria 2356
42 Ga0070708_100266700 3300005445 Bacteria 1610
43 Ga0070708_100431421 3300005445 Unclassified 1243
44 Ga0070708_100585965 3300005445 Unclassified 1051
45 Ga0070708_100816976 3300005445 Unclassified 876
46 Ga0070708_101855699 3300005445 Unclassified 559
47 Ga0070678_100114639 3300005456 Bacteria 2114
48 Ga0070678_101354609 3300005456 Unclassified 663
49 Ga0070662_100084738 3300005457 Unclassified 2368
50 Ga0070681_10260736 3300005458 Unclassified 1645
51 Ga0070681_10451222 3300005458 Unclassified 1198
52 Ga0070685_10133098 3300005466 Bacteria 1557
53 Ga0070706_100298109 3300005467 Unclassified 1504
54 Ga0070706_101114198 3300005467 Unclassified 726
55 Ga0070707_101420169 3300005468 Unclassified 661
56 Ga0070698_100040336 3300005471 Bacteria 4798
57 Ga0070698_100518191 3300005471 Bacteria 1131
58 Ga0070698_101265305 3300005471 Bacteria 688
59 Ga0070699_100327680 3300005518 Bacteria 1377
60 Ga0070699_100426035 3300005518 Bacteria 1201
61 Ga0070699_100481295 3300005518 Unclassified 1127
62 Ga0070679_100167574 3300005530 Bacteria 2170
63 Ga0070684_100204363 3300005535 Bacteria 1800
64 Ga0070697_100025602 3300005536 Bacteria 4706
65 Ga0070697_100150599 3300005536 Unclassified 1960
66 Ga0070697_101148338 3300005536 Unclassified 692
67 Ga0070672_100076211 3300005543 Bacteria 2679
68 Ga0070672_100699789 3300005543 Bacteria 887
69 Ga0070696_100086577 3300005546 Bacteria 2225
70 Ga0070665_100059888 3300005548 Bacteria 3817
71 Ga0070665_100356470 3300005548 Unclassified 1468
72 Ga0070704_100836562 3300005549 Unclassified 824
73 Ga0068855_100843677 3300005563 Bacteria 971
74 Ga0068857_100935286 3300005577 Unclassified 832
75 Ga0068856_100678878 3300005614 Unclassified 1051
76 Ga0070702_100102118 3300005615 Bacteria 1761
77 Ga0081539_10025407 3300005985 Bacteria 3816
78 Ga0070717_10020231 3300006028 Bacteria 5231
79 Ga0070717_10073990 3300006028 Bacteria 2848
80 Ga0070717_11906476 3300006028 Unclassified 536
81 Ga0070715_10062773 3300006163 Unclassified 1636
82 Ga0070715_10762143 3300006163 Bacteria 584
83 Ga0070716_100044829 3300006173 Bacteria 2479
84 Ga0070716_100094744 3300006173 Bacteria 1816
85 Ga0070716_100162576 3300006173 Bacteria 1448
86 Ga0070712_100014343 3300006175 Bacteria 5087
87 Ga0070712_100348913 3300006175 Unclassified 1211
88 Ga0070712_100368735 3300006175 Unclassified 1179
89 Ga0070712_100478537 3300006175 Bacteria 1041
90 Ga0097621_100549573 3300006237 Bacteria 1051
91 Ga0068871_100750318 3300006358 Bacteria 897
92 Ga0075428_100029915 3300006844 Bacteria 6024
93 Ga0068865_100060543 3300006881 Bacteria 2651
94 Ga0075435_100481611 3300007076 Unclassified 1072
95 Ga0099794_10064022 3300007265 Bacteria 1791
96 Ga0099794_10221032 3300007265 Bacteria 973
97 Ga0099794_10265548 3300007265 Bacteria 886
98 Ga0099795_10428998 3300007788 Bacteria 605
99 Ga0105240_11021429 3300009093 Unclassified 883
100 Ga0111539_10222696 3300009094 Bacteria 2197
101 Ga0105245_10622314 3300009098 Bacteria 1108
102 Ga0105245_11312287 3300009098 Unclassified 773
103 Ga0105242_10525344 3300009176 Unclassified 1130
104 Ga0105248_10387141 3300009177 Unclassified 1574
105 Ga0105237_11323388 3300009545 Bacteria 727
106 Ga0105249_10079554 3300009553 Bacteria 3043
107 Ga0105249_10879179 3300009553 Unclassified 963
108 Ga0105239_12072741 3300010375 Unclassified 661
109 Ga0105246_10306012 3300011119 Unclassified 1285
110 Ga0157371_10319713 3300013102 Bacteria 1126
111 Ga0157370_10222768 3300013104 Bacteria 1747
112 Ga0157369_10119103 3300013105 Unclassified 2802
113 Ga0157374_10008800 3300013296 Bacteria 8640
114 Ga0157374_10875146 3300013296 Bacteria 916
115 Ga0157378_10161379 3300013297 Bacteria 2096
116 Ga0157378_10332464 3300013297 Unclassified 1479
117 Ga0157378_10695111 3300013297 Unclassified 1036
118 Ga0163162_10008747 3300013306 Bacteria 9850
119 Ga0163162_10066447 3300013306 Unclassified 3655
120 Ga0163162_10738889 3300013306 Unclassified 1104
121 Ga0163162_10743844 3300013306 Bacteria 1100
122 Ga0157375_10049377 3300013308 Bacteria 4122
123 Ga0157375_10398517 3300013308 Bacteria 1543
124 Ga0157375_11758084 3300013308 Unclassified 735
125 Ga0157380_12712760 3300014326 Archaea 562
126 Ga0157377_10815763 3300014745 Unclassified 689
127 Ga0157376_10098152 3300014969 Bacteria 2553
128 Ga0157376_10124012 3300014969 Bacteria 2294
129 Ga0157376_10427383 3300014969 Bacteria 1287
130 Ga0207666_1013862 3300025271 Unclassified 1135
131 Ga0207666_1024554 3300025271 Bacteria 900
132 Ga0207697_10001642 3300025315 Bacteria 12098
133 Ga0207697_10218708 3300025315 Bacteria 840
134 Ga0207692_10231168 3300025898 Bacteria 1100
135 Ga0207688_10003036 3300025901 Bacteria 9149
136 Ga0207680_10113677 3300025903 Unclassified 1760
137 Ga0207685_10116374 3300025905 Bacteria 1167
138 Ga0207685_10139419 3300025905 Bacteria 1086
139 Ga0207645_10013212 3300025907 Bacteria 5571
140 Ga0207645_10597127 3300025907 Unclassified 749
141 Ga0207705_10630368 3300025909 Unclassified 834
142 Ga0207684_10007961 3300025910 Bacteria 9473
143 Ga0207684_10221387 3300025910 Bacteria 1633
144 Ga0207654_10975660 3300025911 Unclassified 616
145 Ga0207707_10251144 3300025912 Unclassified 1536
146 Ga0207707_10508417 3300025912 Bacteria 1027
147 Ga0207693_10016208 3300025915 Bacteria 5958
148 Ga0207693_10189339 3300025915 Bacteria 1619
149 Ga0207693_10268453 3300025915 Bacteria 1337
150 Ga0207693_10339150 3300025915 Bacteria 1176
151 Ga0207663_10179665 3300025916 Bacteria 1510
152 Ga0207649_10179354 3300025920 Unclassified 1481
153 Ga0207646_10016824 3300025922 Bacteria 6858
154 Ga0207681_10078740 3300025923 Bacteria 2320
155 Ga0207681_10721582 3300025923 Bacteria 830
156 Ga0207687_10570756 3300025927 Unclassified 951
157 Ga0207700_10811653 3300025928 Unclassified 837
158 Ga0207664_10795229 3300025929 Bacteria 851
159 Ga0207664_11109990 3300025929 Bacteria 707
160 Ga0207644_10016090 3300025931 Bacteria 5030
161 Ga0207644_10189445 3300025931 Bacteria 1617
162 Ga0207706_10186842 3300025933 Bacteria 1820
163 Ga0207706_10526600 3300025933 Bacteria 1019
164 Ga0207686_10334989 3300025934 Unclassified 1135
165 Ga0207669_10141114 3300025937 Bacteria 1672
166 Ga0207704_10010599 3300025938 Unclassified 4503
167 Ga0207665_10034939 3300025939 Bacteria 3336
168 Ga0207665_10114072 3300025939 Bacteria 1902
169 Ga0207665_10360471 3300025939 Bacteria 1099
170 Ga0207691_10034224 3300025940 Bacteria 4726
171 Ga0207691_10413249 3300025940 Bacteria 1150
172 Ga0207711_10311243 3300025941 Unclassified 1454
173 Ga0207661_10183158 3300025944 Bacteria 1831
174 Ga0207712_10580151 3300025961 Unclassified 968
175 Ga0207668_10006918 3300025972 Bacteria 6730
176 Ga0207668_10164452 3300025972 Unclassified 1733
177 Ga0207668_10766674 3300025972 Unclassified 852
178 Ga0207658_10076917 3300025986 Bacteria 2544
179 Ga0207658_10548754 3300025986 Unclassified 1034
180 Ga0207702_10377604 3300026078 Bacteria 1362
181 Ga0207675_100367039 3300026118 Bacteria 1413
182 Ga0207683_10126697 3300026121 Bacteria 2295
183 Ga0209984_1043941 3300027424 Bacteria 647
184 Ga0209588_1078021 3300027671 Bacteria 1070
185 Ga0207428_10172205 3300027907 Unclassified 1639
186 Ga0268266_10677037 3300028379 Unclassified 993
187 Ga0265319_1009397 3300028563 Bacteria 4170
188 Ga0265319_1148817 3300028563 Bacteria 725
189 Ga0265323_10000053 3300028653 Bacteria 62400
190 Ga0265323_10032737 3300028653 Bacteria 1927
191 Ga0265323_10056042 3300028653 Unclassified 1383
192 Ga0265323_10085539 3300028653 Bacteria 1060
193 Ga0265322_10000396 3300028654 Bacteria 18028
194 Ga0265322_10147732 3300028654 Bacteria 672
195 Ga0265336_10190028 3300028666 Bacteria 610
196 Ga0265338_10867020 3300028800 Bacteria 616
197 Ga0265338_10965022 3300028800 Bacteria 578
198 Ga0265330_10324799 3300031235 Unclassified 649
199 Ga0265328_10005157 3300031239 Bacteria 5619
200 Ga0265320_10000687 3300031240 Bacteria 25766
201 Ga0265339_10307706 3300031249 Unclassified 754
202 Ga0265331_10004520 3300031250 Bacteria 8677
203 Ga0265316_10008194 3300031344 Bacteria 9726
204 Ga0265316_10396908 3300031344 Bacteria 994
205 Ga0265316_10750646 3300031344 Unclassified 686
206 Ga0265314_10013449 3300031711 Bacteria 6609
207 Ga0307412_10000040 3300031911 Bacteria 182923
208 Ga0373944_0244786 3300035089 Bacteria 660
209 Ga0373945_0115687 3300035116 Bacteria 1062
210 Ga0373953_0237428 3300035117 Bacteria 791
211 Ga0373957_0230129 3300035120 Bacteria 777
212 Ga0373943_0508367 3300035170 Unclassified 705
213 Ga0373946_0213969 3300035171 Bacteria 928
214 Ga0373955_0199982 3300035172 Bacteria 1189
215 Ga0373931_0403221 3300035691 Bacteria 866
216 Ga0373931_0995413 3300035691 Unclassified 567
217 Ga0373931_1028797 3300035691 Bacteria 558
218 Ga0373935_0126068 3300035692 Bacteria 1716
219 Ga0373927_0089133 3300035695 Unclassified 2003
220 Ga0373947_0150359 3300035725 Bacteria 1499
221 Ga0373937_0068015 3300036401 Bacteria 3283
222 Ga0373925_0116175 3300037068 Bacteria 2072
223 Ga0373925_1045531 3300037068 Bacteria 672
224 Ga0395900_0058152 3300037418 Unclassified 3980
225 Ga0395898_0146490 3300037466 Unclassified 2260
226 Ga0395905_0157843 3300037471 Unclassified 2133
227 Ga0395901_0038345 3300038443 Unclassified 4956
228 Ga0451576_0033021 3300045051 Bacteria 5502
229 Ga0495592_0006076 3300046454 Bacteria 8972
230 Ga0495592_0370615 3300046454 Unclassified 914
231 Ga0495664_0047452 3300046477 Bacteria 2549
232 Ga0495664_0192186 3300046477 Unclassified 1237
233 Ga0495584_0197069 3300046491 Bacteria 1024
234 Ga0495608_0670633 3300046511 Bacteria 619
235 Ga0495618_0001177 3300046514 Bacteria 17733
236 Ga0495618_0084015 3300046514 Bacteria 2034
237 Ga0495618_0388962 3300046514 Bacteria 855
238 Ga0495628_0000611 3300046516 Bacteria 32763
239 Ga0495628_0002083 3300046516 Bacteria 18146
240 Ga0495630_0009381 3300046517 Bacteria 7034
241 Ga0495630_0333727 3300046517 Bacteria 1160
242 Ga0495652_0003567 3300046529 Bacteria 15277
243 Ga0495652_0036060 3300046529 Unclassified 4302
244 Ga0495652_0265875 3300046529 Unclassified 1263
245 Ga0495640_0036850 3300046533 Unclassified 3453
246 Ga0495640_0141127 3300046533 Bacteria 1553
247 Ga0495586_0000317 3300046535 Bacteria 30578
248 Ga0495645_0002002 3300046543 Bacteria 13866
249 Ga0495645_0023020 3300046543 Unclassified 4509
250 Ga0495633_0244652 3300046558 Bacteria 819
251 Ga0495667_0191610 3300046559 Unclassified 1310
252 Ga0495634_0502101 3300046642 Bacteria 711
253 Ga0495634_0544352 3300046642 Unclassified 677
254 Ga0495659_0011664 3300046664 Bacteria 2833
255 Ga0495657_0223838 3300046675 Unclassified 1140
256 Ga0495599_0027873 3300046678 Bacteria 3538
257 Ga0495623_0007263 3300046679 Bacteria 7193
258 Ga0495646_0002511 3300046680 Bacteria 11269
259 Ga0495669_0033346 3300046684 Bacteria 2266
260 Ga0495669_0117776 3300046684 Bacteria 1243
261 Ga0495624_0348869 3300046690 Unclassified 890
262 Ga0495674_0008056 3300047319 Bacteria 10058
263 Ga0495674_0038452 3300047319 Bacteria 4294
264 Ga0495675_0010256 3300047444 Bacteria 5850
265 Ga0495684_0656600 3300047471 Bacteria 701
266 Ga0495602_0012541 3300048088 Bacteria 8700
267 Ga0496100_0161954 3300048903 Bacteria 1604
268 Ga0496101_0000912 3300048904 Bacteria 17417
269 Ga0496102_0052097 3300048905 Bacteria 3728
270 Ga0496103_0629186 3300048906 Bacteria 683
271 Ga0496105_0208055 3300048908 Bacteria 1596
272 Ga0496105_0936101 3300048908 Unclassified 651
273 Ga0496106_0000773 3300048909 Bacteria 23147
274 Ga0496107_0000783 3300048910 Bacteria 18378
275 Ga0496107_0917060 3300048910 Unclassified 638
276 Ga0496112_0090685 3300048915 Bacteria 3025
277 Ga0496112_0379872 3300048915 Unclassified 1354
278 Ga0496113_0198893 3300048916 Unclassified 1593
279 Ga0496114_0337611 3300048917 Unclassified 1332
280 Ga0496115_0030564 3300048918 Bacteria 4238
281 Ga0501032_0008359 3300049569 Bacteria 7543
282 Ga0501042_0644691 3300049578 Unclassified 770
283 Ga0501070_0817634 3300049586 Unclassified 731
284 Ga0501071_0761487 3300049587 Unclassified 746
285 nmdc:mga08y16_184909_c1 3300050511 Bacteria 2163
286 nmdc:mga0rr50_1082995_c1 3300050513 Unclassified 682
287 Ga0495601_0001555 3300053077 Bacteria 12682
288 Ga0495612_0065785 3300053078 Unclassified 1506
289 Ga0495655_0097951 3300053083 Bacteria 864
290 Ga0495619_0159065 3300053085 Bacteria 1560
291 Ga0495619_0484902 3300053085 Unclassified 851
292 Ga0500643_106828 3300053087 Bacteria 758
293 Ga0105242_10816666
294 SwRhRL2b_contig_3798451
295 rootH2_10015336
296 Ga0065704_10019336
297 Ga0065704_10340210
298 Ga0065712_10013116
299 Ga0065715_10116715
300 Ga0065707_10017409
301 Ga0070676_10003022
302 Ga0070676_10058236
303 Ga0070676_10188992
304 Ga0070683_100081356
305 Ga0070690_100146773
306 Ga0070666_10104287
307 Ga0070680_100133678
308 Ga0070660_100191075
309 Ga0070660_100391086
310 Ga0070661_100281218
311 Ga0070668_100112856
312 Ga0070668_100516735
313 Ga0070668_100942404
314 Ga0070669_100063090
315 Ga0070675_100012839
316 Ga0070675_100427562
317 Ga0070671_100223247
318 Ga0070671_100452325
319 Ga0070674_100154592
320 Ga0070673_100198867
321 Ga0070673_102110359
322 Ga0070667_100046131
323 Ga0070667_100945338
324 Ga0070714_100756526
325 Ga0070713_100144894
326 Ga0070713_101603730
327 Ga0070710_10124359
328 Ga0070710_10736441
329 Ga0070711_100107780
330 Ga0070711_100219322
331 Ga0070711_100725234
332 Ga0070705_100092402
333 Ga0070708_100127191
334 Ga0070708_100266700
335 Ga0070708_100431421
336 Ga0070708_100585965
337 Ga0070708_100816976
338 Ga0070708_101855699
339 Ga0070678_100114639
340 Ga0070678_101354609
341 Ga0070662_100084738
342 Ga0070681_10260736
343 Ga0070681_10451222
344 Ga0070685_10133098
345 Ga0070706_100298109
346 Ga0070706_101114198
347 Ga0070707_101420169
348 Ga0070698_100040336
349 Ga0070698_100518191
350 Ga0070698_101265305
351 Ga0070699_100327680
352 Ga0070699_100426035
353 Ga0070699_100481295
354 Ga0070679_100167574
355 Ga0070684_100204363
356 Ga0070697_100025602
357 Ga0070697_100150599
358 Ga0070697_101148338
359 Ga0070672_100076211
360 Ga0070672_100699789
361 Ga0070696_100086577
362 Ga0070665_100059888
363 Ga0070665_100356470
364 Ga0070704_100836562
365 Ga0068855_100843677
366 Ga0068857_100935286
367 Ga0068856_100678878
368 Ga0070702_100102118
369 Ga0081539_10025407
370 Ga0070717_10020231
371 Ga0070717_10073990
372 Ga0070717_11906476
373 Ga0070715_10062773
374 Ga0070715_10762143
375 Ga0070716_100044829
376 Ga0070716_100094744
377 Ga0070716_100162576
378 Ga0070712_100014343
379 Ga0070712_100348913
380 Ga0070712_100368735
381 Ga0070712_100478537
382 Ga0097621_100549573
383 Ga0068871_100750318
384 Ga0075428_100029915
385 Ga0068865_100060543
386 Ga0075435_100481611
387 Ga0099794_10064022
388 Ga0099794_10221032
389 Ga0099794_10265548
390 Ga0099795_10428998
391 Ga0105240_11021429
392 Ga0111539_10222696
393 Ga0105245_10622314
394 Ga0105245_11312287
395 Ga0105242_10525344
396 Ga0105248_10387141
397 Ga0105237_11323388
398 Ga0105249_10079554
399 Ga0105249_10879179
400 Ga0105239_12072741
401 Ga0105246_10306012
402 Ga0157371_10319713
403 Ga0157370_10222768
404 Ga0157369_10119103
405 Ga0157374_10008800
406 Ga0157374_10875146
407 Ga0157378_10161379
408 Ga0157378_10332464
409 Ga0157378_10695111
410 Ga0163162_10008747
411 Ga0163162_10066447
412 Ga0163162_10738889
413 Ga0163162_10743844
414 Ga0157375_10049377
415 Ga0157375_10398517
416 Ga0157375_11758084
417 Ga0157380_12712760
418 Ga0157377_10815763
419 Ga0157376_10098152
420 Ga0157376_10124012
421 Ga0157376_10427383
422 Ga0207666_1013862
423 Ga0207666_1024554
424 Ga0207697_10001642
425 Ga0207697_10218708
426 Ga0207692_10231168
427 Ga0207688_10003036
428 Ga0207680_10113677
429 Ga0207685_10116374
430 Ga0207685_10139419
431 Ga0207645_10013212
432 Ga0207645_10597127
433 Ga0207705_10630368
434 Ga0207684_10007961
435 Ga0207684_10221387
436 Ga0207654_10975660
437 Ga0207707_10251144
438 Ga0207707_10508417
439 Ga0207693_10016208
440 Ga0207693_10189339
441 Ga0207693_10268453
442 Ga0207693_10339150
443 Ga0207663_10179665
444 Ga0207649_10179354
445 Ga0207646_10016824
446 Ga0207681_10078740
447 Ga0207681_10721582
448 Ga0207687_10570756
449 Ga0207700_10811653
450 Ga0207664_10795229
451 Ga0207664_11109990
452 Ga0207644_10016090
453 Ga0207644_10189445
454 Ga0207706_10186842
455 Ga0207706_10526600
456 Ga0207686_10334989
457 Ga0207669_10141114
458 Ga0207704_10010599
459 Ga0207665_10034939
460 Ga0207665_10114072
461 Ga0207665_10360471
462 Ga0207691_10034224
463 Ga0207691_10413249
464 Ga0207711_10311243
465 Ga0207661_10183158
466 Ga0207712_10580151
467 Ga0207668_10006918
468 Ga0207668_10164452
469 Ga0207668_10766674
470 Ga0207658_10076917
471 Ga0207658_10548754
472 Ga0207702_10377604
473 Ga0207675_100367039
474 Ga0207683_10126697
475 Ga0209984_1043941
476 Ga0209588_1078021
477 Ga0207428_10172205
478 Ga0268266_10677037
479 Ga0265319_1009397
480 Ga0265319_1148817
481 Ga0265323_10000053
482 Ga0265323_10032737
483 Ga0265323_10056042
484 Ga0265323_10085539
485 Ga0265322_10000396
486 Ga0265322_10147732
487 Ga0265336_10190028
488 Ga0265338_10867020
489 Ga0265338_10965022
490 Ga0265330_10324799
491 Ga0265328_10005157
492 Ga0265320_10000687
493 Ga0265339_10307706
494 Ga0265331_10004520
495 Ga0265316_10008194
496 Ga0265316_10396908
497 Ga0265316_10750646
498 Ga0265314_10013449
499 Ga0307412_10000040
500 Ga0373944_0244786
501 Ga0373945_0115687
502 Ga0373953_0237428
503 Ga0373957_0230129
504 Ga0373943_0508367
505 Ga0373946_0213969
506 Ga0373955_0199982
507 Ga0373931_0403221
508 Ga0373931_0995413
509 Ga0373931_1028797
510 Ga0373935_0126068
511 Ga0373927_0089133
512 Ga0373947_0150359
513 Ga0373937_0068015
514 Ga0373925_0116175
515 Ga0373925_1045531
516 Ga0395900_0058152
517 Ga0395898_0146490
518 Ga0395905_0157843
519 Ga0395901_0038345
520 Ga0451576_0033021
521 Ga0495592_0006076
522 Ga0495592_0370615
523 Ga0495664_0047452
524 Ga0495664_0192186
525 Ga0495584_0197069
526 Ga0495608_0670633
527 Ga0495618_0001177
528 Ga0495618_0084015
529 Ga0495618_0388962
530 Ga0495628_0000611
531 Ga0495628_0002083
532 Ga0495630_0009381
533 Ga0495630_0333727
534 Ga0495652_0003567
535 Ga0495652_0036060
536 Ga0495652_0265875
537 Ga0495640_0036850
538 Ga0495640_0141127
539 Ga0495586_0000317
540 Ga0495645_0002002
541 Ga0495645_0023020
542 Ga0495633_0244652
543 Ga0495667_0191610
544 Ga0495634_0502101
545 Ga0495634_0544352
546 Ga0495659_0011664
547 Ga0495657_0223838
548 Ga0495599_0027873
549 Ga0495623_0007263
550 Ga0495646_0002511
551 Ga0495669_0033346
552 Ga0495669_0117776
553 Ga0495624_0348869
554 Ga0495674_0008056
555 Ga0495674_0038452
556 Ga0495675_0010256
557 Ga0495684_0656600
558 Ga0495602_0012541
559 Ga0496100_0161954
560 Ga0496101_0000912
561 Ga0496102_0052097
562 Ga0496103_0629186
563 Ga0496105_0208055
564 Ga0496105_0936101
565 Ga0496106_0000773
566 Ga0496107_0000783
567 Ga0496107_0917060
568 Ga0496112_0090685
569 Ga0496112_0379872
570 Ga0496113_0198893
571 Ga0496114_0337611
572 Ga0496115_0030564
573 Ga0501032_0008359
574 Ga0501042_0644691
575 Ga0501070_0817634
576 Ga0501071_0761487
577 nmdc:mga08y16_184909_c1
578 nmdc:mga0rr50_1082995_c1
579 Ga0495601_0001555
580 Ga0495612_0065785
581 Ga0495655_0097951
582 Ga0495619_0159065
583 Ga0495619_0484902
584 Ga0500643_106828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02661

Fic

Fic/DOC family

7

89

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.8717 6 129
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.8633 6 128
3k33-assembly1.cif.gz_A-2 crystal structure of the phd-doc complex 0.8612 6 129
3kh2-assembly2.cif.gz_C crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386 0.8535 6 130
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.8452 6 129
ID Description Score Start End Superfamily
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.8634 6 128 1.20.120.1870
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.8312 6 128 1.20.120.1870
5jj6B02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7632 7 135 1.10.3290.10
5jj6B02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7243 7 135 1.10.3290.10
af_Q2FXX4_67_323_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7011 2 135 1.10.3290.10
ID Description Score Start End GO Terms
AF-A0A2V5RSX5-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9977 8 134 GO:0016301
AF-A0A1Q8BKT3-F1-model_v4 Fido domain-containing protein 0.996 1 133 GO:0016301
AF-A0A2V5ZU25-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9933 1 131 GO:0016301
AF-A0A2A2QYQ6-F1-model_v4 Fido domain-containing protein 0.9889 2 130 GO:0016301
AF-A0A1V6JLM2-F1-model_v4 deleted 0.9864 1 130

Map