F390903

General Info

Members Datasets Scaffolds Average Seq Length
292 159 584 104

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10794453|Ga0105241_107944532
Length 115
Sequence MMKAGFVYIMANRKNGTIYIGVTSDLIARVYAHREGLVEGFTKRYGCKLLVWFEAFDDIQQARQRELQMKEWKRAWKVRLIEEANLDWGDLYPGLFDPGCAGPXXXXSPGHGQLA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 0.68
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10794453 3300009174 Bacteria 871
2 JGI24740J21852_10004561 3300001979 Bacteria 5956
3 JGI24740J21852_10124989 3300001979 Bacteria 643
4 JGI24739J22299_10010039 3300001989 Bacteria 3520
5 JGI24737J22298_10009746 3300001990 Bacteria 3183
6 JGI24735J21928_10004119 3300002067 Bacteria 4911
7 JGI24738J21930_10057468 3300002075 Bacteria 797
8 Ga0070658_10271492 3300005327 Bacteria 1442
9 Ga0070658_10593856 3300005327 Bacteria 959
10 Ga0070658_11210942 3300005327 Bacteria 656
11 Ga0070676_11521978 3300005328 Bacteria 515
12 Ga0070683_100115300 3300005329 Bacteria 2536
13 Ga0070690_101140802 3300005330 Bacteria 620
14 Ga0070680_100481759 3300005336 Bacteria 1060
15 Ga0070680_101205847 3300005336 Bacteria 655
16 Ga0070682_100070382 3300005337 Bacteria 2236
17 Ga0070682_100669372 3300005337 Bacteria 828
18 Ga0070660_100491491 3300005339 Bacteria 1020
19 Ga0070660_101435026 3300005339 Bacteria 586
20 Ga0070661_100071088 3300005344 Bacteria 2560
21 Ga0070661_100099095 3300005344 Bacteria 2165
22 Ga0070661_100392809 3300005344 Bacteria 1095
23 Ga0070661_100458155 3300005344 Bacteria 1015
24 Ga0070661_101105112 3300005344 Bacteria 661
25 Ga0070692_10024639 3300005345 Bacteria 2959
26 Ga0070692_11293841 3300005345 Bacteria 523
27 Ga0070668_100411442 3300005347 Bacteria 1156
28 Ga0070669_100284266 3300005353 Bacteria 1326
29 Ga0070669_100736040 3300005353 Bacteria 835
30 Ga0070671_100122947 3300005355 Bacteria 2184
31 Ga0070673_100072017 3300005364 Bacteria 2778
32 Ga0070673_102226386 3300005364 Bacteria 521
33 Ga0070659_100080153 3300005366 Bacteria 2606
34 Ga0070659_100252613 3300005366 Bacteria 1461
35 Ga0070659_100326815 3300005366 Bacteria 1283
36 Ga0070659_100615346 3300005366 Bacteria 934
37 Ga0070659_101710649 3300005366 Bacteria 563
38 Ga0070667_100026039 3300005367 Bacteria 4863
39 Ga0070667_100190166 3300005367 Bacteria 1818
40 Ga0070667_100377939 3300005367 Bacteria 1286
41 Ga0070667_100855428 3300005367 Bacteria 845
42 Ga0070711_101380476 3300005439 Bacteria 613
43 Ga0070663_100003975 3300005455 Bacteria 8626
44 Ga0070663_100176564 3300005455 Bacteria 1654
45 Ga0070663_100184708 3300005455 Bacteria 1620
46 Ga0070663_101374465 3300005455 Bacteria 625
47 Ga0070662_100037837 3300005457 Bacteria 3423
48 Ga0070681_10035926 3300005458 Bacteria 4977
49 Ga0070681_10317844 3300005458 Bacteria 1466
50 Ga0070681_10543442 3300005458 Bacteria 1075
51 Ga0068867_100070447 3300005459 Bacteria 2614
52 Ga0070679_100446293 3300005530 Bacteria 1238
53 Ga0070679_101168866 3300005530 Bacteria 714
54 Ga0070684_100226073 3300005535 Bacteria 1708
55 Ga0068853_100124437 3300005539 Bacteria 2303
56 Ga0068853_101807070 3300005539 Bacteria 592
57 Ga0070696_100322119 3300005546 Bacteria 1190
58 Ga0070693_100282251 3300005547 Bacteria 1112
59 Ga0070693_101553330 3300005547 Bacteria 519
60 Ga0068855_100065071 3300005563 Bacteria 4250
61 Ga0068855_100149992 3300005563 Bacteria 2651
62 Ga0068855_100670092 3300005563 Bacteria 1112
63 Ga0068855_101269483 3300005563 Bacteria 763
64 Ga0070664_100046093 3300005564 Bacteria 3682
65 Ga0070664_100725770 3300005564 Bacteria 927
66 Ga0070664_100921850 3300005564 Bacteria 819
67 Ga0068857_100055324 3300005577 Bacteria 3521
68 Ga0068857_100085382 3300005577 Bacteria 2821
69 Ga0068854_100011358 3300005578 Bacteria 5794
70 Ga0068854_100295136 3300005578 Bacteria 1309
71 Ga0068854_100358617 3300005578 Bacteria 1195
72 Ga0068856_100234514 3300005614 Bacteria 1850
73 Ga0068852_100133431 3300005616 Bacteria 2289
74 Ga0068852_100208812 3300005616 Bacteria 1851
75 Ga0068852_100286406 3300005616 Bacteria 1590
76 Ga0068852_100952404 3300005616 Bacteria 876
77 Ga0068870_10321077 3300005840 Bacteria 984
78 Ga0068863_100499528 3300005841 Bacteria 1198
79 Ga0068858_100313365 3300005842 Bacteria 1499
80 Ga0068860_100009476 3300005843 Bacteria 9670
81 Ga0068860_100112371 3300005843 Bacteria 2605
82 Ga0068862_100454150 3300005844 Bacteria 1208
83 Ga0068862_100617698 3300005844 Bacteria 1042
84 Ga0075369_10410410 3300006186 Bacteria 639
85 Ga0097621_100048846 3300006237 Bacteria 3435
86 Ga0097621_102134205 3300006237 Bacteria 536
87 Ga0068871_100048013 3300006358 Bacteria 3444
88 Ga0075433_11034374 3300006852 Bacteria 715
89 Ga0068865_100070461 3300006881 Bacteria 2477
90 Ga0105240_10051957 3300009093 Bacteria 5155
91 Ga0105241_10114282 3300009174 Bacteria 2165
92 Ga0105241_10216675 3300009174 Bacteria 1607
93 Ga0105241_11975901 3300009174 Bacteria 573
94 Ga0105248_10052918 3300009177 Bacteria 4556
95 Ga0105248_11179774 3300009177 Bacteria 866
96 Ga0105237_10754740 3300009545 Bacteria 979
97 Ga0105238_11565649 3300009551 Bacteria 689
98 Ga0105246_10416355 3300011119 Bacteria 1120
99 Ga0157373_10069736 3300013100 Bacteria 2485
100 Ga0157373_10132111 3300013100 Bacteria 1755
101 Ga0157373_10137899 3300013100 Bacteria 1715
102 Ga0157373_10261429 3300013100 Bacteria 1225
103 Ga0157373_11200932 3300013100 Bacteria 572
104 Ga0157371_10121836 3300013102 Bacteria 1854
105 Ga0157371_10173410 3300013102 Bacteria 1542
106 Ga0157371_10302997 3300013102 Bacteria 1157
107 Ga0157371_10559544 3300013102 Bacteria 848
108 Ga0157371_10654481 3300013102 Bacteria 784
109 Ga0157370_10306374 3300013104 Bacteria 1466
110 Ga0157370_11044392 3300013104 Bacteria 739
111 Ga0157370_11204218 3300013104 Bacteria 683
112 Ga0157369_10044322 3300013105 Bacteria 4843
113 Ga0157369_10304338 3300013105 Bacteria 1658
114 Ga0163162_10695244 3300013306 Bacteria 1139
115 Ga0163162_12766841 3300013306 Bacteria 565
116 Ga0157372_10121202 3300013307 Bacteria 3004
117 Ga0157372_10361648 3300013307 Bacteria 1691
118 Ga0157372_11704826 3300013307 Bacteria 725
119 Ga0157375_10339582 3300013308 Bacteria 1667
120 Ga0163163_10619112 3300014325 Bacteria 1146
121 Ga0157380_10303907 3300014326 Bacteria 1471
122 Ga0157379_10067266 3300014968 Bacteria 3203
123 Ga0197907_10947932 3300020069 Bacteria 1181
124 Ga0197907_10982993 3300020069 Bacteria 1236
125 Ga0206356_10895469 3300020070 Bacteria 675
126 Ga0224712_10013412 3300022467 Bacteria 2608
127 Ga0207697_10055222 3300025315 Bacteria 1646
128 Ga0207656_10034669 3300025321 Bacteria 2108
129 Ga0207688_10429584 3300025901 Bacteria 822
130 Ga0207647_10618766 3300025904 Bacteria 596
131 Ga0207647_10659952 3300025904 Bacteria 573
132 Ga0207647_10719078 3300025904 Bacteria 543
133 Ga0207645_10042152 3300025907 Bacteria 2921
134 Ga0207705_10030729 3300025909 Bacteria 3833
135 Ga0207705_10078071 3300025909 Bacteria 2409
136 Ga0207705_10172300 3300025909 Bacteria 1630
137 Ga0207705_10371272 3300025909 Bacteria 1104
138 Ga0207705_10731832 3300025909 Bacteria 769
139 Ga0207705_11127898 3300025909 Bacteria 603
140 Ga0207654_10131973 3300025911 Bacteria 1582
141 Ga0207654_11050679 3300025911 Bacteria 593
142 Ga0207707_10047546 3300025912 Bacteria 3736
143 Ga0207707_10683024 3300025912 Bacteria 863
144 Ga0207707_11548080 3300025912 Bacteria 524
145 Ga0207695_10118102 3300025913 Bacteria 2624
146 Ga0207671_10265098 3300025914 Bacteria 1352
147 Ga0207663_10154441 3300025916 Bacteria 1613
148 Ga0207660_10020370 3300025917 Bacteria 4449
149 Ga0207660_10101123 3300025917 Bacteria 2153
150 Ga0207657_10020271 3300025919 Bacteria 6288
151 Ga0207657_10053962 3300025919 Bacteria 3479
152 Ga0207657_10070181 3300025919 Bacteria 2970
153 Ga0207657_10735543 3300025919 Bacteria 765
154 Ga0207649_10016143 3300025920 Bacteria 4206
155 Ga0207649_10152678 3300025920 Bacteria 1592
156 Ga0207649_10168438 3300025920 Bacteria 1524
157 Ga0207649_10734870 3300025920 Bacteria 767
158 Ga0207652_10010133 3300025921 Bacteria 7594
159 Ga0207652_10212373 3300025921 Bacteria 1743
160 Ga0207652_11216498 3300025921 Bacteria 655
161 Ga0207652_11525655 3300025921 Bacteria 572
162 Ga0207681_10007428 3300025923 Bacteria 6712
163 Ga0207681_10559216 3300025923 Bacteria 942
164 Ga0207694_10820716 3300025924 Bacteria 786
165 Ga0207700_10073377 3300025928 Bacteria 2642
166 Ga0207690_10003283 3300025932 Bacteria 9682
167 Ga0207690_10056854 3300025932 Bacteria 2641
168 Ga0207690_10552475 3300025932 Bacteria 936
169 Ga0207690_10701588 3300025932 Bacteria 832
170 Ga0207690_11418726 3300025932 Bacteria 581
171 Ga0207706_10053024 3300025933 Bacteria 3580
172 Ga0207706_10069767 3300025933 Bacteria 3091
173 Ga0207706_10420935 3300025933 Bacteria 1157
174 Ga0207704_10296796 3300025938 Bacteria 1236
175 Ga0207704_10437254 3300025938 Bacteria 1041
176 Ga0207711_10003949 3300025941 Bacteria 12750
177 Ga0207711_11757090 3300025941 Bacteria 563
178 Ga0207661_10746837 3300025944 Bacteria 900
179 Ga0207679_10012138 3300025945 Bacteria 5608
180 Ga0207679_10232921 3300025945 Bacteria 1556
181 Ga0207667_10056946 3300025949 Bacteria 4104
182 Ga0207667_10138174 3300025949 Bacteria 2509
183 Ga0207667_10187129 3300025949 Bacteria 2125
184 Ga0207667_10218162 3300025949 Bacteria 1954
185 Ga0207651_10145284 3300025960 Bacteria 1838
186 Ga0207651_11325685 3300025960 Bacteria 647
187 Ga0207651_11885926 3300025960 Bacteria 537
188 Ga0207668_10491182 3300025972 Bacteria 1054
189 Ga0207640_10016805 3300025981 Bacteria 4266
190 Ga0207640_10030683 3300025981 Bacteria 3313
191 Ga0207640_10343684 3300025981 Bacteria 1196
192 Ga0207640_10731597 3300025981 Bacteria 851
193 Ga0207640_10784312 3300025981 Bacteria 824
194 Ga0207640_11345953 3300025981 Bacteria 638
195 Ga0207658_10039261 3300025986 Bacteria 3415
196 Ga0207658_10388099 3300025986 Bacteria 1224
197 Ga0207703_10826212 3300026035 Bacteria 885
198 Ga0207639_10161176 3300026041 Bacteria 1890
199 Ga0207639_10332486 3300026041 Bacteria 1352
200 Ga0207639_10755845 3300026041 Bacteria 904
201 Ga0207639_12022593 3300026041 Bacteria 537
202 Ga0207678_10012031 3300026067 Bacteria 7599
203 Ga0207678_10017805 3300026067 Bacteria 6238
204 Ga0207678_11497403 3300026067 Bacteria 596
205 Ga0207702_10497379 3300026078 Bacteria 1188
206 Ga0207702_10996296 3300026078 Bacteria 831
207 Ga0207641_10458230 3300026088 Bacteria 1233
208 Ga0207648_10088696 3300026089 Bacteria 2701
209 Ga0207674_10023851 3300026116 Bacteria 6544
210 Ga0207674_10068238 3300026116 Bacteria 3579
211 Ga0207698_10018944 3300026142 Bacteria 4701
212 Ga0207698_10199162 3300026142 Bacteria 1792
213 Ga0207698_11125700 3300026142 Bacteria 798
214 Ga0207698_12184769 3300026142 Bacteria 566
215 Ga0207698_12200425 3300026142 Bacteria 564
216 Ga0209984_1075244 3300027424 Unclassified 506
217 Ga0210000_1017992 3300027462 Bacteria 1072
218 Ga0209995_1007850 3300027471 Bacteria 1720
219 Ga0209968_1091108 3300027526 Unclassified 552
220 Ga0210002_1000777 3300027617 Bacteria 4330
221 Ga0209983_1051096 3300027665 Bacteria 905
222 Ga0209971_1057392 3300027682 Bacteria 942
223 Ga0209998_10057455 3300027717 Unclassified 911
224 Ga0209974_10007367 3300027876 Bacteria 3791
225 Ga0268265_10185245 3300028380 Bacteria 1792
226 Ga0268265_11121815 3300028380 Bacteria 781
227 Ga0268264_10018767 3300028381 Bacteria 5654
228 Ga0268264_10691253 3300028381 Bacteria 1013
229 Ga0268264_11462536 3300028381 Bacteria 694
230 Ga0307405_10436589 3300031731 Bacteria 1034
231 Ga0307405_11289429 3300031731 Bacteria 635
232 Ga0307413_10406578 3300031824 Bacteria 1068
233 Ga0307413_10511465 3300031824 Bacteria 966
234 Ga0307413_10808750 3300031824 Bacteria 788
235 Ga0307410_10001652 3300031852 Bacteria 10265
236 Ga0307410_10115891 3300031852 Bacteria 1946
237 Ga0307410_11154520 3300031852 Bacteria 673
238 Ga0307409_100601485 3300031995 Unclassified 1087
239 Ga0307409_100780060 3300031995 Bacteria 962
240 Ga0307409_100898272 3300031995 Bacteria 899
241 Ga0307409_101129291 3300031995 Bacteria 805
242 Ga0307416_100476814 3300032002 Bacteria 1307
243 Ga0307414_10895431 3300032004 Bacteria 813
244 Ga0307411_10075281 3300032005 Bacteria 2304
245 Ga0307415_100070403 3300032126 Bacteria 2456
246 Ga0307415_100127798 3300032126 Bacteria 1918
247 Ga0395899_0130556 3300037312 Bacteria 1794
248 Ga0395900_0241880 3300037418 Bacteria 1810
249 Ga0395905_0045251 3300037471 Bacteria 4128
250 Ga0395905_0773075 3300037471 Bacteria 863
251 Ga0395905_0835333 3300037471 Bacteria 824
252 Ga0395901_1151124 3300038443 Bacteria 744
253 Ga0395901_1916932 3300038443 Bacteria 540
254 Ga0439445_0019231 3300042004 Bacteria 1701
255 Ga0439450_090475 3300042008 Bacteria 768
256 Ga0439458_0001234 3300042157 Bacteria 6468
257 Ga0439464_0006897 3300042439 Bacteria 2964
258 Ga0466972_0304033 3300044658 Bacteria 745
259 Ga0466972_0338571 3300044658 Bacteria 703
260 Ga0466966_0280415 3300044684 Bacteria 1002
261 Ga0466966_0746673 3300044684 Bacteria 590
262 Ga0466961_0065652 3300044693 Bacteria 2306
263 Ga0466963_0073287 3300044694 Bacteria 2308
264 Ga0466964_0069435 3300044706 Bacteria 1486
265 Ga0466971_0172434 3300044719 Bacteria 1015
266 Ga0466968_0073265 3300044735 Bacteria 1494
267 Ga0466957_0075856 3300044842 Bacteria 2087
268 Ga0466957_0182061 3300044842 Bacteria 1373
269 Ga0466959_0027963 3300045049 Bacteria 4181
270 Ga0466958_0055617 3300045836 Bacteria 2401
271 Ga0466958_0438684 3300045836 Bacteria 845
272 Ga0466967_0698419 3300045976 Bacteria 1005
273 Ga0466967_0973567 3300045976 Bacteria 844
274 Ga0495620_0230273 3300046515 Bacteria 708
275 Ga0495663_0127051 3300046525 Bacteria 857
276 Ga0495598_0027070 3300046537 Bacteria 1578
277 Ga0495621_0002923 3300046539 Bacteria 4656
278 Ga0495633_0008467 3300046558 Bacteria 5784
279 Ga0495661_0361338 3300046665 Unclassified 713
280 Ga0495669_0036709 3300046684 Bacteria 2167
281 Ga0495670_0005648 3300046691 Bacteria 6132
282 Ga0496106_0553580 3300048909 Bacteria 923
283 Ga0496110_0315689 3300048913 Bacteria 1423
284 Ga0496121_0063170 3300048924 Bacteria 3028
285 Ga0501034_0049064 3300049571 Bacteria 4260
286 Ga0501046_0320396 3300049580 Bacteria 1130
287 Ga0501073_0039326 3300049589 Bacteria 3351
288 Ga0501079_0161583 3300049741 Bacteria 1747
289 Ga0501083_0545226 3300049744 Bacteria 755
290 nmdc:mga0a205_321875_c1 3300050515 Bacteria 1417
291 Ga0587115_029169 3300059626 Bacteria 812
292 Ga0466962_0084821 3300061719 Bacteria 1516
293 Ga0105241_10794453
294 JGI24740J21852_10004561
295 JGI24740J21852_10124989
296 JGI24739J22299_10010039
297 JGI24737J22298_10009746
298 JGI24735J21928_10004119
299 JGI24738J21930_10057468
300 Ga0070658_10271492
301 Ga0070658_10593856
302 Ga0070658_11210942
303 Ga0070676_11521978
304 Ga0070683_100115300
305 Ga0070690_101140802
306 Ga0070680_100481759
307 Ga0070680_101205847
308 Ga0070682_100070382
309 Ga0070682_100669372
310 Ga0070660_100491491
311 Ga0070660_101435026
312 Ga0070661_100071088
313 Ga0070661_100099095
314 Ga0070661_100392809
315 Ga0070661_100458155
316 Ga0070661_101105112
317 Ga0070692_10024639
318 Ga0070692_11293841
319 Ga0070668_100411442
320 Ga0070669_100284266
321 Ga0070669_100736040
322 Ga0070671_100122947
323 Ga0070673_100072017
324 Ga0070673_102226386
325 Ga0070659_100080153
326 Ga0070659_100252613
327 Ga0070659_100326815
328 Ga0070659_100615346
329 Ga0070659_101710649
330 Ga0070667_100026039
331 Ga0070667_100190166
332 Ga0070667_100377939
333 Ga0070667_100855428
334 Ga0070711_101380476
335 Ga0070663_100003975
336 Ga0070663_100176564
337 Ga0070663_100184708
338 Ga0070663_101374465
339 Ga0070662_100037837
340 Ga0070681_10035926
341 Ga0070681_10317844
342 Ga0070681_10543442
343 Ga0068867_100070447
344 Ga0070679_100446293
345 Ga0070679_101168866
346 Ga0070684_100226073
347 Ga0068853_100124437
348 Ga0068853_101807070
349 Ga0070696_100322119
350 Ga0070693_100282251
351 Ga0070693_101553330
352 Ga0068855_100065071
353 Ga0068855_100149992
354 Ga0068855_100670092
355 Ga0068855_101269483
356 Ga0070664_100046093
357 Ga0070664_100725770
358 Ga0070664_100921850
359 Ga0068857_100055324
360 Ga0068857_100085382
361 Ga0068854_100011358
362 Ga0068854_100295136
363 Ga0068854_100358617
364 Ga0068856_100234514
365 Ga0068852_100133431
366 Ga0068852_100208812
367 Ga0068852_100286406
368 Ga0068852_100952404
369 Ga0068870_10321077
370 Ga0068863_100499528
371 Ga0068858_100313365
372 Ga0068860_100009476
373 Ga0068860_100112371
374 Ga0068862_100454150
375 Ga0068862_100617698
376 Ga0075369_10410410
377 Ga0097621_100048846
378 Ga0097621_102134205
379 Ga0068871_100048013
380 Ga0075433_11034374
381 Ga0068865_100070461
382 Ga0105240_10051957
383 Ga0105241_10114282
384 Ga0105241_10216675
385 Ga0105241_11975901
386 Ga0105248_10052918
387 Ga0105248_11179774
388 Ga0105237_10754740
389 Ga0105238_11565649
390 Ga0105246_10416355
391 Ga0157373_10069736
392 Ga0157373_10132111
393 Ga0157373_10137899
394 Ga0157373_10261429
395 Ga0157373_11200932
396 Ga0157371_10121836
397 Ga0157371_10173410
398 Ga0157371_10302997
399 Ga0157371_10559544
400 Ga0157371_10654481
401 Ga0157370_10306374
402 Ga0157370_11044392
403 Ga0157370_11204218
404 Ga0157369_10044322
405 Ga0157369_10304338
406 Ga0163162_10695244
407 Ga0163162_12766841
408 Ga0157372_10121202
409 Ga0157372_10361648
410 Ga0157372_11704826
411 Ga0157375_10339582
412 Ga0163163_10619112
413 Ga0157380_10303907
414 Ga0157379_10067266
415 Ga0197907_10947932
416 Ga0197907_10982993
417 Ga0206356_10895469
418 Ga0224712_10013412
419 Ga0207697_10055222
420 Ga0207656_10034669
421 Ga0207688_10429584
422 Ga0207647_10618766
423 Ga0207647_10659952
424 Ga0207647_10719078
425 Ga0207645_10042152
426 Ga0207705_10030729
427 Ga0207705_10078071
428 Ga0207705_10172300
429 Ga0207705_10371272
430 Ga0207705_10731832
431 Ga0207705_11127898
432 Ga0207654_10131973
433 Ga0207654_11050679
434 Ga0207707_10047546
435 Ga0207707_10683024
436 Ga0207707_11548080
437 Ga0207695_10118102
438 Ga0207671_10265098
439 Ga0207663_10154441
440 Ga0207660_10020370
441 Ga0207660_10101123
442 Ga0207657_10020271
443 Ga0207657_10053962
444 Ga0207657_10070181
445 Ga0207657_10735543
446 Ga0207649_10016143
447 Ga0207649_10152678
448 Ga0207649_10168438
449 Ga0207649_10734870
450 Ga0207652_10010133
451 Ga0207652_10212373
452 Ga0207652_11216498
453 Ga0207652_11525655
454 Ga0207681_10007428
455 Ga0207681_10559216
456 Ga0207694_10820716
457 Ga0207700_10073377
458 Ga0207690_10003283
459 Ga0207690_10056854
460 Ga0207690_10552475
461 Ga0207690_10701588
462 Ga0207690_11418726
463 Ga0207706_10053024
464 Ga0207706_10069767
465 Ga0207706_10420935
466 Ga0207704_10296796
467 Ga0207704_10437254
468 Ga0207711_10003949
469 Ga0207711_11757090
470 Ga0207661_10746837
471 Ga0207679_10012138
472 Ga0207679_10232921
473 Ga0207667_10056946
474 Ga0207667_10138174
475 Ga0207667_10187129
476 Ga0207667_10218162
477 Ga0207651_10145284
478 Ga0207651_11325685
479 Ga0207651_11885926
480 Ga0207668_10491182
481 Ga0207640_10016805
482 Ga0207640_10030683
483 Ga0207640_10343684
484 Ga0207640_10731597
485 Ga0207640_10784312
486 Ga0207640_11345953
487 Ga0207658_10039261
488 Ga0207658_10388099
489 Ga0207703_10826212
490 Ga0207639_10161176
491 Ga0207639_10332486
492 Ga0207639_10755845
493 Ga0207639_12022593
494 Ga0207678_10012031
495 Ga0207678_10017805
496 Ga0207678_11497403
497 Ga0207702_10497379
498 Ga0207702_10996296
499 Ga0207641_10458230
500 Ga0207648_10088696
501 Ga0207674_10023851
502 Ga0207674_10068238
503 Ga0207698_10018944
504 Ga0207698_10199162
505 Ga0207698_11125700
506 Ga0207698_12184769
507 Ga0207698_12200425
508 Ga0209984_1075244
509 Ga0210000_1017992
510 Ga0209995_1007850
511 Ga0209968_1091108
512 Ga0210002_1000777
513 Ga0209983_1051096
514 Ga0209971_1057392
515 Ga0209998_10057455
516 Ga0209974_10007367
517 Ga0268265_10185245
518 Ga0268265_11121815
519 Ga0268264_10018767
520 Ga0268264_10691253
521 Ga0268264_11462536
522 Ga0307405_10436589
523 Ga0307405_11289429
524 Ga0307413_10406578
525 Ga0307413_10511465
526 Ga0307413_10808750
527 Ga0307410_10001652
528 Ga0307410_10115891
529 Ga0307410_11154520
530 Ga0307409_100601485
531 Ga0307409_100780060
532 Ga0307409_100898272
533 Ga0307409_101129291
534 Ga0307416_100476814
535 Ga0307414_10895431
536 Ga0307411_10075281
537 Ga0307415_100070403
538 Ga0307415_100127798
539 Ga0395899_0130556
540 Ga0395900_0241880
541 Ga0395905_0045251
542 Ga0395905_0773075
543 Ga0395905_0835333
544 Ga0395901_1151124
545 Ga0395901_1916932
546 Ga0439445_0019231
547 Ga0439450_090475
548 Ga0439458_0001234
549 Ga0439464_0006897
550 Ga0466972_0304033
551 Ga0466972_0338571
552 Ga0466966_0280415
553 Ga0466966_0746673
554 Ga0466961_0065652
555 Ga0466963_0073287
556 Ga0466964_0069435
557 Ga0466971_0172434
558 Ga0466968_0073265
559 Ga0466957_0075856
560 Ga0466957_0182061
561 Ga0466959_0027963
562 Ga0466958_0055617
563 Ga0466958_0438684
564 Ga0466967_0698419
565 Ga0466967_0973567
566 Ga0495620_0230273
567 Ga0495663_0127051
568 Ga0495598_0027070
569 Ga0495621_0002923
570 Ga0495633_0008467
571 Ga0495661_0361338
572 Ga0495669_0036709
573 Ga0495670_0005648
574 Ga0496106_0553580
575 Ga0496110_0315689
576 Ga0496121_0063170
577 Ga0501034_0049064
578 Ga0501046_0320396
579 Ga0501073_0039326
580 Ga0501079_0161583
581 Ga0501083_0545226
582 nmdc:mga0a205_321875_c1
583 Ga0587115_029169
584 Ga0466962_0084821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01541

GIY-YIG

GIY-YIG catalytic domain

4

79

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6seh-assembly1.cif.gz_C recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.7589 1 70
5owo-assembly1.cif.gz_A human cytoplasmic dynein n-terminus dimerization domain at 1.8 angstrom resolution 0.723 3 26
7cq3-assembly1.cif.gz_A crystal structure of slx1-slx4 0.7198 1 74
4xm5-assembly1.cif.gz_A-2 c. glabrata slx1. 0.717 3 70
6sei-assembly1.cif.gz_C recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.7136 1 69
ID Description Score Start End Superfamily
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8954 3 83 3.40.1440.10
af_P45472_1_97_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8844 3 83 3.40.1440.10
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8654 3 83 3.40.1440.10
af_K7LJ52_1021_1130_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8127 2 34 3.40.1440.10
af_Q9P7M3_4_108_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7773 3 75 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A6B1J825-F1-model_v4 deleted 1.001 1 94
AF-A0A653JKZ1-F1-model_v4 Endonuclease 0.9991 1 96 GO:0004519
AF-A0A849VMD2-F1-model_v4 GIY-YIG nuclease family protein 0.9983 4 94
AF-A0A3B0RR63-F1-model_v4 Excinuclease ABC, C subunit-like 0.9982 1 94
AF-A0A547B975-F1-model_v4 GIY-YIG nuclease family protein 0.998 4 94

Map