F390891

General Info

Members Datasets Scaffolds Average Seq Length
292 184 584 270

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10046284|Ga0114129_100462843
Length 282
Sequence MAMLQSLAFLRWPVVLAVVALFVLLQLRRAGTFAWTLACFGGIYAFVRFGFATPIPSSVVQLYMGITLLSLAAYVSSSATRREEFLAPLSALVNQPKLRPLLVATLVLLPVLAASSAFLGSREKLEAPAFGRTVHPAPPDTIQFGEKTIEIAKGHNPLRTLESTEPERYRAHVENGRKTYYQNCHFCHGDALAGDGMYAHGLNPIPTNFTDPGTIAQLQESFLFWRIAKGGPGLPAEGGPWDSAMPAWERFLKEEEIWEVILFLYDHTGRRPRAAGESVDAP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
116 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 3.42
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10046284 3300009147 Bacteria 6114
2 Ga0065712_10000492 3300005290 Bacteria 34346
3 Ga0065712_10004027 3300005290 Bacteria 3968
4 Ga0065712_10214542 3300005290 Bacteria 1061
5 Ga0065715_10015936 3300005293 Bacteria 3352
6 Ga0065715_10138301 3300005293 Bacteria 1894
7 Ga0065715_10138411 3300005293 Bacteria 1892
8 Ga0065715_10147336 3300005293 Bacteria 1772
9 Ga0065707_10023591 3300005295 Bacteria 1296
10 Ga0065707_10092620 3300005295 Bacteria 3743
11 Ga0065707_10120450 3300005295 Bacteria 2134
12 Ga0065707_10347776 3300005295 Unclassified 923
13 Ga0070690_100020013 3300005330 Bacteria 4072
14 Ga0070677_10001472 3300005333 Bacteria 7447
15 Ga0068869_100002961 3300005334 Bacteria 10312
16 Ga0068869_100216534 3300005334 Bacteria 1516
17 Ga0070666_10042307 3300005335 Bacteria 3048
18 Ga0070680_100086802 3300005336 Bacteria 2587
19 Ga0070689_100005047 3300005340 Bacteria 8972
20 Ga0070691_10011900 3300005341 Bacteria 3982
21 Ga0070668_100285846 3300005347 Bacteria 1379
22 Ga0070668_100455071 3300005347 Bacteria 1101
23 Ga0070669_100004127 3300005353 Bacteria 10539
24 Ga0070675_100005671 3300005354 Bacteria 9561
25 Ga0070675_100092909 3300005354 Bacteria 2530
26 Ga0070675_100140227 3300005354 Bacteria 2066
27 Ga0070675_100223844 3300005354 Bacteria 1639
28 Ga0070671_100088277 3300005355 Bacteria 2595
29 Ga0070674_100096398 3300005356 Bacteria 2146
30 Ga0070674_100334612 3300005356 Bacteria 1218
31 Ga0070673_100004325 3300005364 Bacteria 8972
32 Ga0070688_100003438 3300005365 Bacteria 8143
33 Ga0070688_100168910 3300005365 Bacteria 1508
34 Ga0070659_100246726 3300005366 Bacteria 1479
35 Ga0070667_100307152 3300005367 Bacteria 1429
36 Ga0070701_10012328 3300005438 Bacteria 3852
37 Ga0070705_100000666 3300005440 Bacteria 19690
38 Ga0070705_100301945 3300005440 Bacteria 1148
39 Ga0070700_100360462 3300005441 Bacteria 1081
40 Ga0070700_100555488 3300005441 Bacteria 893
41 Ga0070694_100002136 3300005444 Bacteria 11719
42 Ga0070694_100006761 3300005444 Bacteria 6965
43 Ga0070662_100003587 3300005457 Bacteria 9679
44 Ga0068867_100108415 3300005459 Bacteria 2130
45 Ga0070685_10008323 3300005466 Bacteria 5324
46 Ga0070707_100067346 3300005468 Bacteria 3444
47 Ga0070707_100343457 3300005468 Bacteria 1450
48 Ga0070698_100011650 3300005471 Bacteria 9329
49 Ga0070698_100035067 3300005471 Bacteria 5188
50 Ga0070684_100407731 3300005535 Bacteria 1254
51 Ga0070697_100031913 3300005536 Bacteria 4238
52 Ga0070695_100000121 3300005545 Bacteria 34920
53 Ga0070695_100097527 3300005545 Bacteria 1974
54 Ga0070696_100003962 3300005546 Bacteria 9879
55 Ga0070696_100127154 3300005546 Bacteria 1850
56 Ga0070665_100076255 3300005548 Bacteria 3360
57 Ga0070665_100123548 3300005548 Bacteria 2590
58 Ga0070704_100085380 3300005549 Bacteria 2336
59 Ga0070704_100106046 3300005549 Bacteria 2129
60 Ga0070704_100125776 3300005549 Bacteria 1978
61 Ga0070664_100235252 3300005564 Bacteria 1643
62 Ga0068857_100232847 3300005577 Bacteria 1685
63 Ga0068854_100360037 3300005578 Bacteria 1193
64 Ga0068854_100400212 3300005578 Bacteria 1136
65 Ga0068852_100155951 3300005616 Bacteria 2127
66 Ga0068859_100003362 3300005617 Bacteria 16269
67 Ga0068864_100001699 3300005618 Bacteria 18094
68 Ga0068861_100540960 3300005719 Bacteria 1060
69 Ga0068870_10045356 3300005840 Bacteria 2301
70 Ga0068858_100030163 3300005842 Bacteria 5036
71 Ga0068860_100029824 3300005843 Bacteria 5247
72 Ga0068862_100002403 3300005844 Bacteria 16650
73 Ga0068862_100060495 3300005844 Bacteria 3254
74 Ga0075432_10020320 3300006058 Bacteria 2271
75 Ga0075367_10096548 3300006178 Bacteria 1802
76 Ga0097621_100167334 3300006237 Bacteria 1893
77 Ga0075428_100038748 3300006844 Bacteria 5245
78 Ga0075428_100153718 3300006844 Bacteria 2500
79 Ga0075428_100198801 3300006844 Bacteria 2168
80 Ga0075428_100395901 3300006844 Bacteria 1480
81 Ga0075430_100044288 3300006846 Bacteria 3764
82 Ga0075431_100227411 3300006847 Bacteria 1902
83 Ga0075433_10101198 3300006852 Bacteria 2552
84 Ga0075434_100045054 3300006871 Bacteria 4376
85 Ga0075434_100060525 3300006871 Bacteria 3766
86 Ga0075429_100042026 3300006880 Bacteria 3979
87 Ga0075429_100114962 3300006880 Unclassified 2352
88 Ga0068865_100068324 3300006881 Bacteria 2512
89 Ga0068865_100333601 3300006881 Archaea 1224
90 Ga0097620_100003362 3300006931 Bacteria 16269
91 Ga0111539_10008883 3300009094 Bacteria 12725
92 Ga0111539_10023077 3300009094 Bacteria 7641
93 Ga0111539_10027755 3300009094 Bacteria 6915
94 Ga0111539_10039713 3300009094 Bacteria 5671
95 Ga0105245_10094950 3300009098 Bacteria 2750
96 Ga0114129_10000390 3300009147 Bacteria 51153
97 Ga0114129_10005112 3300009147 Bacteria 18461
98 Ga0114129_10044054 3300009147 Bacteria 6278
99 Ga0114129_10130051 3300009147 Bacteria 3459
100 Ga0114129_10267567 3300009147 Bacteria 2288
101 Ga0114129_10268569 3300009147 Bacteria 2283
102 Ga0114129_10409984 3300009147 Bacteria 1785
103 Ga0114129_10464203 3300009147 Unclassified 1659
104 Ga0105243_10526648 3300009148 Bacteria 1125
105 Ga0105248_10024521 3300009177 Bacteria 6706
106 Ga0105249_10027426 3300009553 Bacteria 5138
107 Ga0105249_10184168 3300009553 Bacteria 2034
108 Ga0105239_10040372 3300010375 Bacteria 5113
109 Ga0157374_10584475 3300013296 Bacteria 1126
110 Ga0163162_10006208 3300013306 Bacteria 11576
111 Ga0163162_10046529 3300013306 Bacteria 4349
112 Ga0157375_10008615 3300013308 Bacteria 8930
113 Ga0163163_10449490 3300014325 Bacteria 1349
114 Ga0157380_10001558 3300014326 Bacteria 15076
115 Ga0157380_10024526 3300014326 Bacteria 4565
116 Ga0157380_10058430 3300014326 Bacteria 3074
117 Ga0157377_10030974 3300014745 Bacteria 2903
118 Ga0157377_10365375 3300014745 Bacteria 973
119 Ga0157379_10213308 3300014968 Bacteria 1748
120 Ga0157379_10541889 3300014968 Bacteria 1082
121 Ga0157376_10072853 3300014969 Bacteria 2924
122 Ga0207697_10000903 3300025315 Bacteria 16780
123 Ga0207697_10001470 3300025315 Bacteria 12872
124 Ga0207653_10046940 3300025885 Bacteria 1429
125 Ga0207682_10005768 3300025893 Bacteria 5022
126 Ga0207688_10019931 3300025901 Bacteria 3658
127 Ga0207688_10143851 3300025901 Bacteria 1405
128 Ga0207680_10153900 3300025903 Bacteria 1535
129 Ga0207645_10007729 3300025907 Bacteria 7569
130 Ga0207643_10010149 3300025908 Bacteria 5063
131 Ga0207660_10103832 3300025917 Bacteria 2127
132 Ga0207659_10004352 3300025926 Bacteria 8557
133 Ga0207659_10094821 3300025926 Unclassified 2237
134 Ga0207659_10150632 3300025926 Bacteria 1816
135 Ga0207644_10025467 3300025931 Bacteria 4069
136 Ga0207706_10001881 3300025933 Bacteria 20583
137 Ga0207669_10244345 3300025937 Bacteria 1332
138 Ga0207704_10032154 3300025938 Bacteria 2966
139 Ga0207704_10069646 3300025938 Bacteria 2224
140 Ga0207691_10049452 3300025940 Bacteria 3852
141 Ga0207711_10054525 3300025941 Bacteria 3431
142 Ga0207689_10031407 3300025942 Bacteria 4422
143 Ga0207689_10220097 3300025942 Bacteria 1569
144 Ga0207651_10044614 3300025960 Bacteria 2968
145 Ga0207668_10363566 3300025972 Bacteria 1213
146 Ga0207640_10347991 3300025981 Bacteria 1190
147 Ga0207640_10393907 3300025981 Bacteria 1126
148 Ga0207658_10497590 3300025986 Unclassified 1085
149 Ga0207703_10046977 3300026035 Bacteria 3479
150 Ga0207708_10102030 3300026075 Bacteria 2221
151 Ga0207708_10299057 3300026075 Unclassified 1308
152 Ga0207648_10072892 3300026089 Bacteria 2993
153 Ga0207676_10003137 3300026095 Bacteria 11798
154 Ga0207675_100293311 3300026118 Bacteria 1582
155 Ga0207683_10079992 3300026121 Bacteria 2898
156 Ga0207683_10233348 3300026121 Bacteria 1678
157 Ga0207428_10001652 3300027907 Bacteria 23192
158 Ga0207428_10003676 3300027907 Bacteria 14762
159 Ga0207428_10011762 3300027907 Bacteria 7719
160 Ga0207428_10038715 3300027907 Bacteria 3875
161 Ga0268266_10186441 3300028379 Bacteria 1892
162 Ga0268265_10113241 3300028380 Bacteria 2219
163 Ga0268264_10028019 3300028381 Bacteria 4607
164 Ga0307408_100362260 3300031548 Unclassified 1234
165 Ga0307408_100404969 3300031548 Bacteria 1172
166 Ga0307413_10104422 3300031824 Bacteria 1881
167 Ga0307413_10192702 3300031824 Bacteria 1465
168 Ga0307410_10036196 3300031852 Bacteria 3212
169 Ga0307407_10053298 3300031903 Bacteria 2327
170 Ga0307412_10267903 3300031911 Bacteria 1335
171 Ga0307412_10513336 3300031911 Unclassified 1000
172 Ga0307409_100074791 3300031995 Bacteria 2708
173 Ga0307416_100191371 3300032002 Bacteria 1930
174 Ga0307416_100339254 3300032002 Unclassified 1515
175 Ga0307411_10037636 3300032005 Bacteria 3044
176 Ga0307411_10190296 3300032005 Bacteria 1566
177 Ga0307415_100040244 3300032126 Bacteria 3095
178 Ga0307415_100180149 3300032126 Unclassified 1657
179 Ga0373940_0060654 3300035088 Bacteria 1081
180 Ga0373939_0005105 3300035114 Unclassified 3121
181 Ga0373941_0008978 3300035115 Unclassified 2505
182 Ga0373962_0039790 3300035242 Bacteria 1321
183 Ga0450894_002621 3300042131 Bacteria 2396
184 Ga0450896_002964 3300042133 Bacteria 2228
185 Ga0450907_011443 3300042146 Bacteria 1473
186 Ga0439460_0044904 3300042461 Bacteria 1309
187 Ga0451577_0021966 3300042876 Bacteria 5831
188 Ga0453684_0173659 3300044712 Bacteria 2537
189 Ga0451576_0027411 3300045051 Bacteria 6118
190 Ga0451576_0060973 3300045051 Bacteria 3934
191 Ga0451576_0234452 3300045051 Bacteria 1916
192 Ga0451576_0279040 3300045051 Bacteria 1747
193 Ga0495603_0022358 3300046455 Bacteria 3829
194 Ga0495629_0000241 3300046459 Bacteria 47574
195 Ga0495629_0342050 3300046459 Archaea 1021
196 Ga0495639_0213551 3300046475 Bacteria 947
197 Ga0495662_0041698 3300046476 Bacteria 2216
198 Ga0495594_0012287 3300046499 Bacteria 4461
199 Ga0495583_0099723 3300046506 Unclassified 1241
200 Ga0495618_0206808 3300046514 Bacteria 1241
201 Ga0495644_0032275 3300046523 Bacteria 1979
202 Ga0495663_0036808 3300046525 Unclassified 1474
203 Ga0495640_0012426 3300046533 Bacteria 6504
204 Ga0495598_0050837 3300046537 Bacteria 1247
205 Ga0495621_0002984 3300046539 Bacteria 4617
206 Ga0495621_0016858 3300046539 Bacteria 2352
207 Ga0495621_0084642 3300046539 Bacteria 1187
208 Ga0495656_0182210 3300046615 Unclassified 1033
209 Ga0495635_0000345 3300046663 Bacteria 29623
210 Ga0495659_0108116 3300046664 Bacteria 1083
211 Ga0495588_0032077 3300046674 Bacteria 2647
212 Ga0495658_0000016 3300046683 Bacteria 94726
213 Ga0495669_0050904 3300046684 Bacteria 1858
214 Ga0495669_0096797 3300046684 Bacteria 1368
215 Ga0495670_0028726 3300046691 Bacteria 2757
216 Ga0495600_0069110 3300046809 Bacteria 2308
217 Ga0495636_0015368 3300047318 Bacteria 3051
218 Ga0495680_0000165 3300047322 Bacteria 68296
219 Ga0495680_0001236 3300047322 Bacteria 28036
220 Ga0495677_0050623 3300047445 Unclassified 1529
221 Ga0495684_0019328 3300047471 Bacteria 5243
222 Ga0495684_0316420 3300047471 Unclassified 1117
223 Ga0495614_0000030 3300048089 Bacteria 41355
224 Ga0496104_0002341 3300048907 Bacteria 16378
225 Ga0496104_0061668 3300048907 Bacteria 3555
226 Ga0496105_0023011 3300048908 Bacteria 5052
227 Ga0496106_0063199 3300048909 Bacteria 2813
228 Ga0496106_0177811 3300048909 Unclassified 1689
229 Ga0496108_0027994 3300048911 Bacteria 4661
230 Ga0496109_0137498 3300048912 Unclassified 2284
231 Ga0496110_0005733 3300048913 Bacteria 9755
232 Ga0496112_0015035 3300048915 Bacteria 7204
233 Ga0496114_0020380 3300048917 Bacteria 5382
234 Ga0501031_0199715 3300049568 Unclassified 1305
235 Ga0501031_0210903 3300049568 Bacteria 1266
236 Ga0501036_0095984 3300049572 Bacteria 2506
237 Ga0501041_0123949 3300049577 Unclassified 1607
238 Ga0501042_0012197 3300049578 Bacteria 5816
239 Ga0501048_0163339 3300049582 Bacteria 1576
240 Ga0501048_0258091 3300049582 Bacteria 1238
241 Ga0501071_0117810 3300049587 Bacteria 1967
242 Ga0501071_0433021 3300049587 Unclassified 1006
243 Ga0501072_0026911 3300049588 Bacteria 4488
244 Ga0501072_0135248 3300049588 Bacteria 1965
245 Ga0501072_0276809 3300049588 Bacteria 1335
246 Ga0501074_0218122 3300049590 Unclassified 1359
247 Ga0501074_0376240 3300049590 Bacteria 1008
248 Ga0501075_0026958 3300049591 Bacteria 4233
249 Ga0501075_0041311 3300049591 Bacteria 3456
250 Ga0501075_0063777 3300049591 Bacteria 2778
251 Ga0501076_0007052 3300049592 Bacteria 8164
252 Ga0501076_0092223 3300049592 Bacteria 2437
253 Ga0501076_0092376 3300049592 Bacteria 2435
254 Ga0501076_0098280 3300049592 Bacteria 2358
255 Ga0501077_0006147 3300049593 Bacteria 7333
256 Ga0501079_0127722 3300049741 Bacteria 1978
257 Ga0501079_0208790 3300049741 Unclassified 1525
258 Ga0501079_0219195 3300049741 Unclassified 1486
259 Ga0501080_0083316 3300049742 Bacteria 2971
260 Ga0501080_0254005 3300049742 Bacteria 1603
261 Ga0501081_0020085 3300049743 Bacteria 4453
262 Ga0501083_0124088 3300049744 Bacteria 1693
263 Ga0501035_0396933 3300049822 Bacteria 1148
264 Ga0501045_0041805 3300049824 Bacteria 3336
265 nmdc:mga05p37_14075_c1 3300050507 Bacteria 9600
266 nmdc:mga05p37_18119_c1 3300050507 Bacteria 8507
267 nmdc:mga05p37_1946_c1 3300050507 Bacteria 24075
268 nmdc:mga05p37_333290_c1 3300050507 Bacteria 1791
269 nmdc:mga05p37_365_c1 3300050507 Bacteria 48774
270 nmdc:mga05p37_511394_c1 3300050507 Bacteria 1376
271 nmdc:mga05p37_53697_c1 3300050507 Bacteria 4956
272 nmdc:mga05p37_556276_c1 3300050507 Bacteria 1305
273 nmdc:mga09592_29566_c1 3300050508 Bacteria 4556
274 nmdc:mga0qj67_341035_c1 3300050509 Bacteria 1212
275 nmdc:mga06r32_179634_c1 3300050510 Bacteria 2101
276 nmdc:mga06r32_36442_c1 3300050510 Bacteria 4648
277 nmdc:mga08y16_15952_c1 3300050511 Bacteria 7898
278 nmdc:mga08y16_206047_c1 3300050511 Bacteria 2038
279 nmdc:mga08y16_2510_c1 3300050511 Bacteria 18866
280 nmdc:mga08y16_283335_c1 3300050511 Bacteria 1709
281 nmdc:mga08y16_3337_c1 3300050511 Bacteria 16626
282 nmdc:mga08y16_426810_c1 3300050511 Bacteria 1354
283 nmdc:mga08y16_57384_c1 3300050511 Bacteria 4069
284 nmdc:mga0n895_21497_c1 3300050512 Bacteria 6036
285 nmdc:mga0n895_740138_c1 3300050512 Unclassified 977
286 nmdc:mga0a205_3998_c1 3300050515 Bacteria 13189
287 Ga0495619_0007517 3300053085 Bacteria 6902
288 Ga0501084_0042741 3300054114 Bacteria 3791
289 Ga0590071_002375 3300059421 Bacteria 4741
290 Ga0590074_000528 3300059423 Bacteria 5720
291 Ga0590077_000162 3300059426 Bacteria 18830
292 Ga0501082_0061389 3300060353 Bacteria 3236
293 Ga0114129_10046284
294 Ga0065712_10000492
295 Ga0065712_10004027
296 Ga0065712_10214542
297 Ga0065715_10015936
298 Ga0065715_10138301
299 Ga0065715_10138411
300 Ga0065715_10147336
301 Ga0065707_10023591
302 Ga0065707_10092620
303 Ga0065707_10120450
304 Ga0065707_10347776
305 Ga0070690_100020013
306 Ga0070677_10001472
307 Ga0068869_100002961
308 Ga0068869_100216534
309 Ga0070666_10042307
310 Ga0070680_100086802
311 Ga0070689_100005047
312 Ga0070691_10011900
313 Ga0070668_100285846
314 Ga0070668_100455071
315 Ga0070669_100004127
316 Ga0070675_100005671
317 Ga0070675_100092909
318 Ga0070675_100140227
319 Ga0070675_100223844
320 Ga0070671_100088277
321 Ga0070674_100096398
322 Ga0070674_100334612
323 Ga0070673_100004325
324 Ga0070688_100003438
325 Ga0070688_100168910
326 Ga0070659_100246726
327 Ga0070667_100307152
328 Ga0070701_10012328
329 Ga0070705_100000666
330 Ga0070705_100301945
331 Ga0070700_100360462
332 Ga0070700_100555488
333 Ga0070694_100002136
334 Ga0070694_100006761
335 Ga0070662_100003587
336 Ga0068867_100108415
337 Ga0070685_10008323
338 Ga0070707_100067346
339 Ga0070707_100343457
340 Ga0070698_100011650
341 Ga0070698_100035067
342 Ga0070684_100407731
343 Ga0070697_100031913
344 Ga0070695_100000121
345 Ga0070695_100097527
346 Ga0070696_100003962
347 Ga0070696_100127154
348 Ga0070665_100076255
349 Ga0070665_100123548
350 Ga0070704_100085380
351 Ga0070704_100106046
352 Ga0070704_100125776
353 Ga0070664_100235252
354 Ga0068857_100232847
355 Ga0068854_100360037
356 Ga0068854_100400212
357 Ga0068852_100155951
358 Ga0068859_100003362
359 Ga0068864_100001699
360 Ga0068861_100540960
361 Ga0068870_10045356
362 Ga0068858_100030163
363 Ga0068860_100029824
364 Ga0068862_100002403
365 Ga0068862_100060495
366 Ga0075432_10020320
367 Ga0075367_10096548
368 Ga0097621_100167334
369 Ga0075428_100038748
370 Ga0075428_100153718
371 Ga0075428_100198801
372 Ga0075428_100395901
373 Ga0075430_100044288
374 Ga0075431_100227411
375 Ga0075433_10101198
376 Ga0075434_100045054
377 Ga0075434_100060525
378 Ga0075429_100042026
379 Ga0075429_100114962
380 Ga0068865_100068324
381 Ga0068865_100333601
382 Ga0097620_100003362
383 Ga0111539_10008883
384 Ga0111539_10023077
385 Ga0111539_10027755
386 Ga0111539_10039713
387 Ga0105245_10094950
388 Ga0114129_10000390
389 Ga0114129_10005112
390 Ga0114129_10044054
391 Ga0114129_10130051
392 Ga0114129_10267567
393 Ga0114129_10268569
394 Ga0114129_10409984
395 Ga0114129_10464203
396 Ga0105243_10526648
397 Ga0105248_10024521
398 Ga0105249_10027426
399 Ga0105249_10184168
400 Ga0105239_10040372
401 Ga0157374_10584475
402 Ga0163162_10006208
403 Ga0163162_10046529
404 Ga0157375_10008615
405 Ga0163163_10449490
406 Ga0157380_10001558
407 Ga0157380_10024526
408 Ga0157380_10058430
409 Ga0157377_10030974
410 Ga0157377_10365375
411 Ga0157379_10213308
412 Ga0157379_10541889
413 Ga0157376_10072853
414 Ga0207697_10000903
415 Ga0207697_10001470
416 Ga0207653_10046940
417 Ga0207682_10005768
418 Ga0207688_10019931
419 Ga0207688_10143851
420 Ga0207680_10153900
421 Ga0207645_10007729
422 Ga0207643_10010149
423 Ga0207660_10103832
424 Ga0207659_10004352
425 Ga0207659_10094821
426 Ga0207659_10150632
427 Ga0207644_10025467
428 Ga0207706_10001881
429 Ga0207669_10244345
430 Ga0207704_10032154
431 Ga0207704_10069646
432 Ga0207691_10049452
433 Ga0207711_10054525
434 Ga0207689_10031407
435 Ga0207689_10220097
436 Ga0207651_10044614
437 Ga0207668_10363566
438 Ga0207640_10347991
439 Ga0207640_10393907
440 Ga0207658_10497590
441 Ga0207703_10046977
442 Ga0207708_10102030
443 Ga0207708_10299057
444 Ga0207648_10072892
445 Ga0207676_10003137
446 Ga0207675_100293311
447 Ga0207683_10079992
448 Ga0207683_10233348
449 Ga0207428_10001652
450 Ga0207428_10003676
451 Ga0207428_10011762
452 Ga0207428_10038715
453 Ga0268266_10186441
454 Ga0268265_10113241
455 Ga0268264_10028019
456 Ga0307408_100362260
457 Ga0307408_100404969
458 Ga0307413_10104422
459 Ga0307413_10192702
460 Ga0307410_10036196
461 Ga0307407_10053298
462 Ga0307412_10267903
463 Ga0307412_10513336
464 Ga0307409_100074791
465 Ga0307416_100191371
466 Ga0307416_100339254
467 Ga0307411_10037636
468 Ga0307411_10190296
469 Ga0307415_100040244
470 Ga0307415_100180149
471 Ga0373940_0060654
472 Ga0373939_0005105
473 Ga0373941_0008978
474 Ga0373962_0039790
475 Ga0450894_002621
476 Ga0450896_002964
477 Ga0450907_011443
478 Ga0439460_0044904
479 Ga0451577_0021966
480 Ga0453684_0173659
481 Ga0451576_0027411
482 Ga0451576_0060973
483 Ga0451576_0234452
484 Ga0451576_0279040
485 Ga0495603_0022358
486 Ga0495629_0000241
487 Ga0495629_0342050
488 Ga0495639_0213551
489 Ga0495662_0041698
490 Ga0495594_0012287
491 Ga0495583_0099723
492 Ga0495618_0206808
493 Ga0495644_0032275
494 Ga0495663_0036808
495 Ga0495640_0012426
496 Ga0495598_0050837
497 Ga0495621_0002984
498 Ga0495621_0016858
499 Ga0495621_0084642
500 Ga0495656_0182210
501 Ga0495635_0000345
502 Ga0495659_0108116
503 Ga0495588_0032077
504 Ga0495658_0000016
505 Ga0495669_0050904
506 Ga0495669_0096797
507 Ga0495670_0028726
508 Ga0495600_0069110
509 Ga0495636_0015368
510 Ga0495680_0000165
511 Ga0495680_0001236
512 Ga0495677_0050623
513 Ga0495684_0019328
514 Ga0495684_0316420
515 Ga0495614_0000030
516 Ga0496104_0002341
517 Ga0496104_0061668
518 Ga0496105_0023011
519 Ga0496106_0063199
520 Ga0496106_0177811
521 Ga0496108_0027994
522 Ga0496109_0137498
523 Ga0496110_0005733
524 Ga0496112_0015035
525 Ga0496114_0020380
526 Ga0501031_0199715
527 Ga0501031_0210903
528 Ga0501036_0095984
529 Ga0501041_0123949
530 Ga0501042_0012197
531 Ga0501048_0163339
532 Ga0501048_0258091
533 Ga0501071_0117810
534 Ga0501071_0433021
535 Ga0501072_0026911
536 Ga0501072_0135248
537 Ga0501072_0276809
538 Ga0501074_0218122
539 Ga0501074_0376240
540 Ga0501075_0026958
541 Ga0501075_0041311
542 Ga0501075_0063777
543 Ga0501076_0007052
544 Ga0501076_0092223
545 Ga0501076_0092376
546 Ga0501076_0098280
547 Ga0501077_0006147
548 Ga0501079_0127722
549 Ga0501079_0208790
550 Ga0501079_0219195
551 Ga0501080_0083316
552 Ga0501080_0254005
553 Ga0501081_0020085
554 Ga0501083_0124088
555 Ga0501035_0396933
556 Ga0501045_0041805
557 nmdc:mga05p37_14075_c1
558 nmdc:mga05p37_18119_c1
559 nmdc:mga05p37_1946_c1
560 nmdc:mga05p37_333290_c1
561 nmdc:mga05p37_365_c1
562 nmdc:mga05p37_511394_c1
563 nmdc:mga05p37_53697_c1
564 nmdc:mga05p37_556276_c1
565 nmdc:mga09592_29566_c1
566 nmdc:mga0qj67_341035_c1
567 nmdc:mga06r32_179634_c1
568 nmdc:mga06r32_36442_c1
569 nmdc:mga08y16_15952_c1
570 nmdc:mga08y16_206047_c1
571 nmdc:mga08y16_2510_c1
572 nmdc:mga08y16_283335_c1
573 nmdc:mga08y16_3337_c1
574 nmdc:mga08y16_426810_c1
575 nmdc:mga08y16_57384_c1
576 nmdc:mga0n895_21497_c1
577 nmdc:mga0n895_740138_c1
578 nmdc:mga0a205_3998_c1
579 Ga0495619_0007517
580 Ga0501084_0042741
581 Ga0590071_002375
582 Ga0590074_000528
583 Ga0590077_000162
584 Ga0501082_0061389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

173

267

0.81

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

171

264

0.68

Map