F390861

General Info

Members Datasets Scaffolds Average Seq Length
292 159 584 114

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10074557|Ga0075433_100745574
Length 125
Sequence VPWRESTFVYSVAVKVAKPAWRFAERVVEGRDDAGAAERIVIWIDRRPGALWTVGRTVNPHLGTIRLDDGLWQGYELEDALEAANAALEDDCVVSEDDGFDGRIRPFRREELLEPLERLFFGHAP

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
85 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
86 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
87 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 12.67
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 14.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10074557 3300006852 Bacteria 2986
2 Ga0070674_101514642 3300005356 Unclassified 603
3 Ga0070709_10018046 3300005434 Bacteria 4056
4 Ga0070709_10113962 3300005434 Bacteria 1821
5 Ga0070714_100078550 3300005435 Bacteria 2868
6 Ga0070714_100679189 3300005435 Bacteria 993
7 Ga0070714_101080488 3300005435 Bacteria 782
8 Ga0070713_100006050 3300005436 Bacteria 8338
9 Ga0070713_100011873 3300005436 Bacteria 6367
10 Ga0070713_100346268 3300005436 Bacteria 1378
11 Ga0070710_10161493 3300005437 Bacteria 1390
12 Ga0070710_10193277 3300005437 Unclassified 1281
13 Ga0070711_100067398 3300005439 Bacteria 2511
14 Ga0070711_100075281 3300005439 Bacteria 2390
15 Ga0070700_100910686 3300005441 Unclassified 717
16 Ga0070708_100034872 3300005445 Bacteria 4381
17 Ga0070706_100549663 3300005467 Bacteria 1074
18 Ga0070706_100842626 3300005467 Bacteria 848
19 Ga0070707_100388704 3300005468 Bacteria 1355
20 Ga0070707_100696373 3300005468 Unclassified 979
21 Ga0070698_100069215 3300005471 Bacteria 3544
22 Ga0070698_100553691 3300005471 Bacteria 1090
23 Ga0070698_100655466 3300005471 Archaea 991
24 Ga0070697_100280099 3300005536 Bacteria 1430
25 Ga0070697_100392358 3300005536 Bacteria 1204
26 Ga0070697_100885648 3300005536 Bacteria 792
27 Ga0070696_100347381 3300005546 Bacteria 1148
28 Ga0070704_100692625 3300005549 Bacteria 903
29 Ga0068856_100148260 3300005614 Bacteria 2354
30 Ga0068859_101017962 3300005617 Unclassified 910
31 Ga0081455_10072857 3300005937 Bacteria 2842
32 Ga0081455_10107900 3300005937 Bacteria 2219
33 Ga0081455_10165353 3300005937 Bacteria 1691
34 Ga0081538_10208946 3300005981 Unclassified 790
35 Ga0070717_10044082 3300006028 Bacteria 3642
36 Ga0070717_10849816 3300006028 Bacteria 830
37 Ga0075365_10003303 3300006038 Bacteria 8275
38 Ga0075363_100122307 3300006048 Bacteria 1454
39 Ga0070716_100009059 3300006173 Bacteria 4954
40 Ga0070716_100318411 3300006173 Bacteria 1089
41 Ga0070716_100595848 3300006173 Bacteria 831
42 Ga0070712_100021648 3300006175 Bacteria 4226
43 Ga0070712_100176668 3300006175 Unclassified 1661
44 Ga0070712_100313955 3300006175 Unclassified 1273
45 Ga0070712_100481378 3300006175 Bacteria 1038
46 Ga0068871_101024927 3300006358 Unclassified 769
47 Ga0075430_100511132 3300006846 Bacteria 991
48 Ga0075433_10002146 3300006852 Bacteria 14942
49 Ga0075433_10012506 3300006852 Bacteria 6862
50 Ga0075434_100007436 3300006871 Bacteria 10135
51 Ga0075434_100025685 3300006871 Bacteria 5764
52 Ga0075434_102156469 3300006871 Bacteria 561
53 Ga0075429_100267110 3300006880 Bacteria 1498
54 Ga0097620_101017738 3300006931 Unclassified 910
55 Ga0075435_100006788 3300007076 Bacteria 8123
56 Ga0075435_100056784 3300007076 Bacteria 3165
57 Ga0111539_10210893 3300009094 Bacteria 2263
58 Ga0111539_10266481 3300009094 Bacteria 1994
59 Ga0111539_11145586 3300009094 Bacteria 904
60 Ga0105245_10029864 3300009098 Bacteria 4820
61 Ga0105245_10663143 3300009098 Unclassified 1074
62 Ga0114129_10003097 3300009147 Bacteria 23330
63 Ga0114129_10591099 3300009147 Bacteria 1439
64 Ga0105241_10240527 3300009174 Bacteria 1530
65 Ga0105249_11935464 3300009553 Bacteria 662
66 Ga0157373_11178756 3300013100 Unclassified 577
67 Ga0157374_10217130 3300013296 Bacteria 1876
68 Ga0157375_13553220 3300013308 Unclassified 519
69 Ga0157376_10190357 3300014969 Bacteria 1881
70 Ga0207692_10077657 3300025898 Bacteria 1767
71 Ga0207699_10147738 3300025906 Bacteria 1552
72 Ga0207699_10173771 3300025906 Bacteria 1443
73 Ga0207645_10123217 3300025907 Bacteria 1684
74 Ga0207684_10311331 3300025910 Bacteria 1357
75 Ga0207693_10033945 3300025915 Bacteria 4025
76 Ga0207693_10038420 3300025915 Bacteria 3771
77 Ga0207693_10108442 3300025915 Bacteria 2178
78 Ga0207693_10323368 3300025915 Bacteria 1207
79 Ga0207663_10121181 3300025916 Bacteria 1791
80 Ga0207663_10847446 3300025916 Bacteria 729
81 Ga0207646_10299168 3300025922 Bacteria 1454
82 Ga0207646_10432452 3300025922 Bacteria 1188
83 Ga0207687_11157748 3300025927 Bacteria 664
84 Ga0207700_10000001 3300025928 Bacteria 1122509
85 Ga0207700_10040597 3300025928 Bacteria 3398
86 Ga0207664_10015589 3300025929 Bacteria 5523
87 Ga0207664_10133284 3300025929 Bacteria 2094
88 Ga0207664_10211626 3300025929 Bacteria 1678
89 Ga0207664_10382483 3300025929 Bacteria 1250
90 Ga0207644_10253236 3300025931 Bacteria 1405
91 Ga0207665_10001446 3300025939 Bacteria 15979
92 Ga0207665_10374467 3300025939 Bacteria 1079
93 Ga0207665_10528529 3300025939 Unclassified 914
94 Ga0207708_10837441 3300026075 Bacteria 793
95 Ga0207702_10114004 3300026078 Bacteria 2408
96 Ga0207428_10215495 3300027907 Bacteria 1441
97 Ga0265327_10034341 3300031251 Bacteria 2815
98 Ga0265316_10046610 3300031344 Bacteria 3433
99 Ga0307408_100225726 3300031548 Bacteria 1531
100 Ga0265313_10014003 3300031595 Bacteria 4775
101 Ga0265314_10021866 3300031711 Bacteria 4906
102 Ga0265314_10205652 3300031711 Unclassified 1160
103 Ga0307405_10054074 3300031731 Bacteria 2504
104 Ga0307405_10068899 3300031731 Bacteria 2266
105 Ga0307406_10073325 3300031901 Bacteria 2250
106 Ga0307406_10269323 3300031901 Bacteria 1293
107 Ga0307407_10488945 3300031903 Bacteria 900
108 Ga0307407_11264765 3300031903 Bacteria 578
109 Ga0307412_10033623 3300031911 Bacteria 3261
110 Ga0307409_100453258 3300031995 Bacteria 1238
111 Ga0307409_100782669 3300031995 Bacteria 960
112 Ga0307416_100073671 3300032002 Bacteria 2848
113 Ga0307416_100143004 3300032002 Bacteria 2178
114 Ga0307416_100736023 3300032002 Unclassified 1078
115 Ga0307416_101109119 3300032002 Bacteria 896
116 Ga0307414_10143990 3300032004 Bacteria 1870
117 Ga0307415_100013798 3300032126 Bacteria 4728
118 Ga0307415_100047698 3300032126 Bacteria 2884
119 Ga0307415_100446584 3300032126 Bacteria 1117
120 Ga0307415_100875172 3300032126 Bacteria 826
121 Ga0373926_0113787 3300035083 Bacteria 1018
122 Ga0373944_0380916 3300035089 Bacteria 541
123 Ga0373953_0554423 3300035117 Unclassified 511
124 Ga0373943_0012453 3300035170 Bacteria 3830
125 Ga0373946_0046842 3300035171 Bacteria 1794
126 Ga0373924_0165160 3300035410 Unclassified 972
127 Ga0373927_0030667 3300035695 Bacteria 3508
128 Ga0373947_0074358 3300035725 Bacteria 2090
129 Ga0395899_0058026 3300037312 Bacteria 2856
130 Ga0395899_0118394 3300037312 Bacteria 1899
131 Ga0395900_0019299 3300037418 Bacteria 6953
132 Ga0395900_0024189 3300037418 Bacteria 6219
133 Ga0395900_0026834 3300037418 Bacteria 5894
134 Ga0395900_0028554 3300037418 Bacteria 5716
135 Ga0395900_0091658 3300037418 Bacteria 3123
136 Ga0395900_0802019 3300037418 Bacteria 869
137 Ga0395900_1615568 3300037418 Bacteria 559
138 Ga0395898_0009044 3300037466 Bacteria 10488
139 Ga0395898_0077228 3300037466 Bacteria 3215
140 Ga0395898_0162918 3300037466 Bacteria 2133
141 Ga0395898_0239807 3300037466 Unclassified 1729
142 Ga0395898_0285652 3300037466 Bacteria 1574
143 Ga0395898_0416645 3300037466 Bacteria 1280
144 Ga0395898_0579966 3300037466 Bacteria 1064
145 Ga0395898_0669501 3300037466 Bacteria 980
146 Ga0395898_0741315 3300037466 Unclassified 924
147 Ga0395898_1053471 3300037466 Bacteria 748
148 Ga0395898_1761268 3300037466 Bacteria 541
149 Ga0395905_0083187 3300037471 Bacteria 2999
150 Ga0395905_0084354 3300037471 Bacteria 2976
151 Ga0395905_0092976 3300037471 Bacteria 2828
152 Ga0395905_0096850 3300037471 Unclassified 2770
153 Ga0395905_0348457 3300037471 Bacteria 1373
154 Ga0395905_0348993 3300037471 Bacteria 1371
155 Ga0395905_0407598 3300037471 Bacteria 1255
156 Ga0395905_1679474 3300037471 Bacteria 540
157 Ga0395901_0002203 3300038443 Bacteria 19874
158 Ga0395901_0019186 3300038443 Bacteria 6991
159 Ga0395901_0020160 3300038443 Bacteria 6823
160 Ga0395901_0045322 3300038443 Bacteria 4563
161 Ga0395901_0063812 3300038443 Bacteria 3834
162 Ga0395901_0066127 3300038443 Bacteria 3766
163 Ga0395901_0179475 3300038443 Bacteria 2221
164 Ga0395901_0207552 3300038443 Bacteria 2051
165 Ga0395901_0488987 3300038443 Unclassified 1254
166 Ga0395901_0692874 3300038443 Archaea 1017
167 Ga0395901_0918234 3300038443 Bacteria 856
168 Ga0395901_1467901 3300038443 Bacteria 639
169 Ga0395901_1504114 3300038443 Bacteria 629
170 Ga0451833_0211712 3300041491 Unclassified 755
171 Ga0451853_1262583 3300041512 Unclassified 596
172 Ga0439448_0087691 3300042005 Unclassified 1049
173 Ga0439455_0044386 3300042012 Bacteria 1147
174 Ga0450902_047576 3300042137 Bacteria 734
175 Ga0450907_004303 3300042146 Bacteria 2460
176 Ga0450909_020614 3300042185 Bacteria 983
177 Ga0466966_0077164 3300044684 Bacteria 2079
178 Ga0466961_0030837 3300044693 Bacteria 3445
179 Ga0466961_0539083 3300044693 Unclassified 703
180 Ga0466963_0043211 3300044694 Bacteria 2962
181 Ga0466963_0141707 3300044694 Archaea 1665
182 Ga0466964_0157321 3300044706 Bacteria 1059
183 Ga0466964_0208634 3300044706 Bacteria 942
184 Ga0466971_0165068 3300044719 Bacteria 1037
185 Ga0466970_0171257 3300044765 Bacteria 1203
186 Ga0466957_0178721 3300044842 Bacteria 1385
187 Ga0466960_0243288 3300044901 Bacteria 997
188 Ga0466959_0157069 3300045049 Bacteria 1600
189 Ga0466959_0349637 3300045049 Bacteria 1008
190 Ga0451576_0865134 3300045051 Bacteria 949
191 Ga0466958_0012821 3300045836 Bacteria 4757
192 Ga0466958_0055894 3300045836 Bacteria 2396
193 Ga0466958_0500694 3300045836 Bacteria 788
194 Ga0466958_1065393 3300045836 Unclassified 528
195 Ga0466967_0027755 3300045976 Bacteria 4713
196 Ga0466967_0040640 3300045976 Bacteria 4005
197 Ga0466967_0070542 3300045976 Bacteria 3126
198 Ga0466967_0259142 3300045976 Bacteria 1664
199 Ga0466967_0586689 3300045976 Bacteria 1099
200 Ga0466967_0618753 3300045976 Bacteria 1070
201 Ga0466967_2389229 3300045976 Bacteria 524
202 Ga0495592_0142073 3300046454 Bacteria 1669
203 Ga0495603_0120646 3300046455 Bacteria 1528
204 Ga0495653_0530316 3300046463 Unclassified 731
205 Ga0495582_0144036 3300046473 Bacteria 1351
206 Ga0495664_0033132 3300046477 Bacteria 3036
207 Ga0495630_0312743 3300046517 Bacteria 1201
208 Ga0495652_0246487 3300046529 Unclassified 1326
209 Ga0495640_0635071 3300046533 Bacteria 643
210 Ga0495645_0218809 3300046543 Bacteria 1282
211 Ga0495667_0394354 3300046559 Bacteria 872
212 Ga0495588_0186107 3300046674 Bacteria 1097
213 Ga0495599_0050053 3300046678 Bacteria 2619
214 Ga0495599_0097124 3300046678 Bacteria 1837
215 Ga0495646_0070534 3300046680 Bacteria 2058
216 Ga0495647_0429076 3300046681 Bacteria 610
217 Ga0495658_0389910 3300046683 Bacteria 887
218 Ga0495624_0151602 3300046690 Bacteria 1418
219 Ga0495674_0050415 3300047319 Bacteria 3673
220 Ga0495680_0079204 3300047322 Bacteria 2485
221 Ga0495593_0363519 3300047673 Bacteria 723
222 Ga0495602_0553151 3300048088 Bacteria 797
223 Ga0496100_0007242 3300048903 Bacteria 6102
224 Ga0496100_1276510 3300048903 Bacteria 579
225 Ga0496101_0000942 3300048904 Bacteria 17171
226 Ga0496102_0022352 3300048905 Bacteria 5604
227 Ga0496102_1764180 3300048905 Unclassified 536
228 Ga0496103_0334089 3300048906 Bacteria 974
229 Ga0496104_0004641 3300048907 Bacteria 11956
230 Ga0496104_0017079 3300048907 Bacteria 6604
231 Ga0496104_0026674 3300048907 Bacteria 5338
232 Ga0496104_0142262 3300048907 Bacteria 2304
233 Ga0496105_0002512 3300048908 Bacteria 13305
234 Ga0496105_0004138 3300048908 Bacteria 10882
235 Ga0496105_0022933 3300048908 Bacteria 5061
236 Ga0496106_0000850 3300048909 Bacteria 22149
237 Ga0496107_0004295 3300048910 Bacteria 9643
238 Ga0496108_0023583 3300048911 Bacteria 5064
239 Ga0496108_0026954 3300048911 Bacteria 4742
240 Ga0496108_0183621 3300048911 Bacteria 1812
241 Ga0496108_0761678 3300048911 Bacteria 837
242 Ga0496109_0005751 3300048912 Bacteria 10374
243 Ga0496109_1072469 3300048912 Unclassified 743
244 Ga0496110_0003287 3300048913 Bacteria 12334
245 Ga0496110_0006758 3300048913 Bacteria 9124
246 Ga0496110_0077269 3300048913 Bacteria 2961
247 Ga0496111_0009456 3300048914 Bacteria 6508
248 Ga0496111_0065505 3300048914 Bacteria 2637
249 Ga0496111_0940153 3300048914 Unclassified 621
250 Ga0496112_0001663 3300048915 Bacteria 17282
251 Ga0496112_0032371 3300048915 Bacteria 5077
252 Ga0496112_0372130 3300048915 Bacteria 1370
253 Ga0496113_0017292 3300048916 Bacteria 5002
254 Ga0496113_0069137 3300048916 Bacteria 2681
255 Ga0496114_0009801 3300048917 Bacteria 7611
256 Ga0496115_0001257 3300048918 Bacteria 18199
257 Ga0496115_0020543 3300048918 Bacteria 5095
258 Ga0496115_0317302 3300048918 Bacteria 1275
259 Ga0496115_0353644 3300048918 Unclassified 1198
260 Ga0501299_125038 3300049522 Unclassified 624
261 Ga0501036_0509706 3300049572 Bacteria 1001
262 Ga0501037_1135405 3300049573 Bacteria 505
263 Ga0501042_0361610 3300049578 Bacteria 1050
264 Ga0501048_1321928 3300049582 Bacteria 518
265 Ga0501068_0971700 3300049584 Bacteria 560
266 Ga0501076_0298775 3300049592 Unclassified 1320
267 Ga0501261_046750 3300049690 Unclassified 698
268 Ga0501081_0825207 3300049743 Unclassified 698
269 Ga0501045_0302803 3300049824 Unclassified 1190
270 nmdc:mga03n38_88806_c1 3300050490 Bacteria 1467
271 nmdc:mga0yw44_6493_c1 3300050492 Bacteria 5660
272 nmdc:mga05p37_23851_c1 3300050507 Bacteria 7430
273 nmdc:mga05p37_2932_c1 3300050507 Bacteria 19794
274 nmdc:mga09592_253997_c1 3300050508 Bacteria 1524
275 nmdc:mga0qj67_469112_c1 3300050509 Bacteria 1013
276 nmdc:mga08y16_1024175_c1 3300050511 Unclassified 804
277 nmdc:mga0n895_1164623_c1 3300050512 Bacteria 746
278 nmdc:mga0n895_39269_c1 3300050512 Bacteria 4592
279 nmdc:mga0n895_7675_c1 3300050512 Bacteria 9277
280 nmdc:mga0n895_97769_c1 3300050512 Bacteria 2941
281 nmdc:mga0rr50_13420_c1 3300050513 Bacteria 5333
282 nmdc:mga0rr50_248300_c1 3300050513 Bacteria 1477
283 nmdc:mga0a205_10503_c1 3300050515 Bacteria 8508
284 nmdc:mga0a205_22812_c1 3300050515 Bacteria 5934
285 nmdc:mga0a205_95577_c1 3300050515 Bacteria 2870
286 Ga0495601_0220765 3300053077 Bacteria 1238
287 Ga0495601_0511876 3300053077 Bacteria 774
288 Ga0495612_0040660 3300053078 Unclassified 1895
289 Ga0495619_0185591 3300053085 Bacteria 1439
290 Ga0466962_0087924 3300061719 Bacteria 1488
291 Ga0530510_0166072 3300061734 Bacteria 1634
292 Ga0530510_0302724 3300061734 Unclassified 1196
293 Ga0075433_10074557
294 Ga0070674_101514642
295 Ga0070709_10018046
296 Ga0070709_10113962
297 Ga0070714_100078550
298 Ga0070714_100679189
299 Ga0070714_101080488
300 Ga0070713_100006050
301 Ga0070713_100011873
302 Ga0070713_100346268
303 Ga0070710_10161493
304 Ga0070710_10193277
305 Ga0070711_100067398
306 Ga0070711_100075281
307 Ga0070700_100910686
308 Ga0070708_100034872
309 Ga0070706_100549663
310 Ga0070706_100842626
311 Ga0070707_100388704
312 Ga0070707_100696373
313 Ga0070698_100069215
314 Ga0070698_100553691
315 Ga0070698_100655466
316 Ga0070697_100280099
317 Ga0070697_100392358
318 Ga0070697_100885648
319 Ga0070696_100347381
320 Ga0070704_100692625
321 Ga0068856_100148260
322 Ga0068859_101017962
323 Ga0081455_10072857
324 Ga0081455_10107900
325 Ga0081455_10165353
326 Ga0081538_10208946
327 Ga0070717_10044082
328 Ga0070717_10849816
329 Ga0075365_10003303
330 Ga0075363_100122307
331 Ga0070716_100009059
332 Ga0070716_100318411
333 Ga0070716_100595848
334 Ga0070712_100021648
335 Ga0070712_100176668
336 Ga0070712_100313955
337 Ga0070712_100481378
338 Ga0068871_101024927
339 Ga0075430_100511132
340 Ga0075433_10002146
341 Ga0075433_10012506
342 Ga0075434_100007436
343 Ga0075434_100025685
344 Ga0075434_102156469
345 Ga0075429_100267110
346 Ga0097620_101017738
347 Ga0075435_100006788
348 Ga0075435_100056784
349 Ga0111539_10210893
350 Ga0111539_10266481
351 Ga0111539_11145586
352 Ga0105245_10029864
353 Ga0105245_10663143
354 Ga0114129_10003097
355 Ga0114129_10591099
356 Ga0105241_10240527
357 Ga0105249_11935464
358 Ga0157373_11178756
359 Ga0157374_10217130
360 Ga0157375_13553220
361 Ga0157376_10190357
362 Ga0207692_10077657
363 Ga0207699_10147738
364 Ga0207699_10173771
365 Ga0207645_10123217
366 Ga0207684_10311331
367 Ga0207693_10033945
368 Ga0207693_10038420
369 Ga0207693_10108442
370 Ga0207693_10323368
371 Ga0207663_10121181
372 Ga0207663_10847446
373 Ga0207646_10299168
374 Ga0207646_10432452
375 Ga0207687_11157748
376 Ga0207700_10000001
377 Ga0207700_10040597
378 Ga0207664_10015589
379 Ga0207664_10133284
380 Ga0207664_10211626
381 Ga0207664_10382483
382 Ga0207644_10253236
383 Ga0207665_10001446
384 Ga0207665_10374467
385 Ga0207665_10528529
386 Ga0207708_10837441
387 Ga0207702_10114004
388 Ga0207428_10215495
389 Ga0265327_10034341
390 Ga0265316_10046610
391 Ga0307408_100225726
392 Ga0265313_10014003
393 Ga0265314_10021866
394 Ga0265314_10205652
395 Ga0307405_10054074
396 Ga0307405_10068899
397 Ga0307406_10073325
398 Ga0307406_10269323
399 Ga0307407_10488945
400 Ga0307407_11264765
401 Ga0307412_10033623
402 Ga0307409_100453258
403 Ga0307409_100782669
404 Ga0307416_100073671
405 Ga0307416_100143004
406 Ga0307416_100736023
407 Ga0307416_101109119
408 Ga0307414_10143990
409 Ga0307415_100013798
410 Ga0307415_100047698
411 Ga0307415_100446584
412 Ga0307415_100875172
413 Ga0373926_0113787
414 Ga0373944_0380916
415 Ga0373953_0554423
416 Ga0373943_0012453
417 Ga0373946_0046842
418 Ga0373924_0165160
419 Ga0373927_0030667
420 Ga0373947_0074358
421 Ga0395899_0058026
422 Ga0395899_0118394
423 Ga0395900_0019299
424 Ga0395900_0024189
425 Ga0395900_0026834
426 Ga0395900_0028554
427 Ga0395900_0091658
428 Ga0395900_0802019
429 Ga0395900_1615568
430 Ga0395898_0009044
431 Ga0395898_0077228
432 Ga0395898_0162918
433 Ga0395898_0239807
434 Ga0395898_0285652
435 Ga0395898_0416645
436 Ga0395898_0579966
437 Ga0395898_0669501
438 Ga0395898_0741315
439 Ga0395898_1053471
440 Ga0395898_1761268
441 Ga0395905_0083187
442 Ga0395905_0084354
443 Ga0395905_0092976
444 Ga0395905_0096850
445 Ga0395905_0348457
446 Ga0395905_0348993
447 Ga0395905_0407598
448 Ga0395905_1679474
449 Ga0395901_0002203
450 Ga0395901_0019186
451 Ga0395901_0020160
452 Ga0395901_0045322
453 Ga0395901_0063812
454 Ga0395901_0066127
455 Ga0395901_0179475
456 Ga0395901_0207552
457 Ga0395901_0488987
458 Ga0395901_0692874
459 Ga0395901_0918234
460 Ga0395901_1467901
461 Ga0395901_1504114
462 Ga0451833_0211712
463 Ga0451853_1262583
464 Ga0439448_0087691
465 Ga0439455_0044386
466 Ga0450902_047576
467 Ga0450907_004303
468 Ga0450909_020614
469 Ga0466966_0077164
470 Ga0466961_0030837
471 Ga0466961_0539083
472 Ga0466963_0043211
473 Ga0466963_0141707
474 Ga0466964_0157321
475 Ga0466964_0208634
476 Ga0466971_0165068
477 Ga0466970_0171257
478 Ga0466957_0178721
479 Ga0466960_0243288
480 Ga0466959_0157069
481 Ga0466959_0349637
482 Ga0451576_0865134
483 Ga0466958_0012821
484 Ga0466958_0055894
485 Ga0466958_0500694
486 Ga0466958_1065393
487 Ga0466967_0027755
488 Ga0466967_0040640
489 Ga0466967_0070542
490 Ga0466967_0259142
491 Ga0466967_0586689
492 Ga0466967_0618753
493 Ga0466967_2389229
494 Ga0495592_0142073
495 Ga0495603_0120646
496 Ga0495653_0530316
497 Ga0495582_0144036
498 Ga0495664_0033132
499 Ga0495630_0312743
500 Ga0495652_0246487
501 Ga0495640_0635071
502 Ga0495645_0218809
503 Ga0495667_0394354
504 Ga0495588_0186107
505 Ga0495599_0050053
506 Ga0495599_0097124
507 Ga0495646_0070534
508 Ga0495647_0429076
509 Ga0495658_0389910
510 Ga0495624_0151602
511 Ga0495674_0050415
512 Ga0495680_0079204
513 Ga0495593_0363519
514 Ga0495602_0553151
515 Ga0496100_0007242
516 Ga0496100_1276510
517 Ga0496101_0000942
518 Ga0496102_0022352
519 Ga0496102_1764180
520 Ga0496103_0334089
521 Ga0496104_0004641
522 Ga0496104_0017079
523 Ga0496104_0026674
524 Ga0496104_0142262
525 Ga0496105_0002512
526 Ga0496105_0004138
527 Ga0496105_0022933
528 Ga0496106_0000850
529 Ga0496107_0004295
530 Ga0496108_0023583
531 Ga0496108_0026954
532 Ga0496108_0183621
533 Ga0496108_0761678
534 Ga0496109_0005751
535 Ga0496109_1072469
536 Ga0496110_0003287
537 Ga0496110_0006758
538 Ga0496110_0077269
539 Ga0496111_0009456
540 Ga0496111_0065505
541 Ga0496111_0940153
542 Ga0496112_0001663
543 Ga0496112_0032371
544 Ga0496112_0372130
545 Ga0496113_0017292
546 Ga0496113_0069137
547 Ga0496114_0009801
548 Ga0496115_0001257
549 Ga0496115_0020543
550 Ga0496115_0317302
551 Ga0496115_0353644
552 Ga0501299_125038
553 Ga0501036_0509706
554 Ga0501037_1135405
555 Ga0501042_0361610
556 Ga0501048_1321928
557 Ga0501068_0971700
558 Ga0501076_0298775
559 Ga0501261_046750
560 Ga0501081_0825207
561 Ga0501045_0302803
562 nmdc:mga03n38_88806_c1
563 nmdc:mga0yw44_6493_c1
564 nmdc:mga05p37_23851_c1
565 nmdc:mga05p37_2932_c1
566 nmdc:mga09592_253997_c1
567 nmdc:mga0qj67_469112_c1
568 nmdc:mga08y16_1024175_c1
569 nmdc:mga0n895_1164623_c1
570 nmdc:mga0n895_39269_c1
571 nmdc:mga0n895_7675_c1
572 nmdc:mga0n895_97769_c1
573 nmdc:mga0rr50_13420_c1
574 nmdc:mga0rr50_248300_c1
575 nmdc:mga0a205_10503_c1
576 nmdc:mga0a205_22812_c1
577 nmdc:mga0a205_95577_c1
578 Ga0495601_0220765
579 Ga0495601_0511876
580 Ga0495612_0040660
581 Ga0495619_0185591
582 Ga0466962_0087924
583 Ga0530510_0166072
584 Ga0530510_0302724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nun-assembly1.cif.gz_A structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose 0.7749 8 41
4h5b-assembly1.cif.gz_A crystal structure of dr_1245 from deinococcus radiodurans 0.7723 1 41
6j36-assembly1.cif.gz_A crystal structure of mycoplasma hyopneumoniae enolase 0.7658 3 41
5wzz-assembly2.cif.gz_B the siah e3 ubiquitin ligases promote wnt/ beta-catenin signaling through mediating wnt-induced axin degradation 0.7541 7 41
2pa6-assembly1.cif.gz_A crystal structure of mj0232 from methanococcus jannaschii 0.7511 4 41
ID Description Score Start End Superfamily
af_Q54E00_143_248_3.10.450.320 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Mitochondrial import inner membrane translocase subunit Tim21 0.8355 7 41 3.10.450.320
af_F1QMX7_108_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8171 9 41 3.50.50.60
af_A0A1D6FLI0_1_293_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7988 4 39 2.130.10.10
af_Q86I62_481_671_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7817 5 41 3.60.10.10
af_P25618_682_890_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7717 7 41 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7W0SXB7-F1-model_v4 Uncharacterized protein 0.9819 4 109
AF-A0A538FTU4-F1-model_v4 Uncharacterized protein 0.9727 21 110
AF-A0A538FTU4-F1-model_v4 Uncharacterized protein 0.9419 21 110
AF-A0A7W0SXB7-F1-model_v4 Uncharacterized protein 0.9301 4 109
AF-G0MWP9-F1-model_v4 F-box associated domain-containing protein 0.8592 1 41

Map