F390827

General Info

Members Datasets Scaffolds Average Seq Length
292 218 292 251

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100621812|Ga0068859_1006218122
Length 313
Sequence MPGASAGSPEGAPAWYSVAIMRIVSASWIALAVAVVASAGVPGCSKSGGSDGAGQKTLRLSMIPTTDPGKMARDSAPLVAYLEHATGAKVELTVPLNYAAVVEAFGADKVDIAYFGGFTYVQASKRFGAQPLVQRERDQAFHSLFITQADSPIATLEDLKGKSFAFGDVNSTSGHLMPEYYLRNRGVDPDVIARAIYTGGHDATALAVANKKVDAGALDEAVYAKLTKEGKLDAEKLRVFYITPPFFDYLWSARKALDPALADAFKKAMLALDPANPQHKPVLDLLQASRYVVAADASYDKLREAATAAGLLK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
212 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0
Rhizoplane 3.08
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2086237 2162886012 Bacteria 2292
2 LJNas_1000023 3300000546 Bacteria 20717
3 JGI24752J21851_1005171 3300001976 Unclassified 1708
4 JGI24737J22298_10022391 3300001990 Bacteria 2008
5 JGI24743J22301_10006642 3300001991 Bacteria 1979
6 JGI24745J21846_1002784 3300002073 Unclassified 1807
7 JGI24748J21848_1010697 3300002074 Bacteria 1079
8 JGI24749J21850_1002921 3300002076 Bacteria 2392
9 JGI24034J26672_10003589 3300002239 Bacteria 2168
10 JGI25406J46586_10006480 3300003203 Bacteria 5386
11 JGI25406J46586_10036770 3300003203 Bacteria 1773
12 Ga0065712_10144137 3300005290 Unclassified 1423
13 Ga0065715_10237170 3300005293 Unclassified 1212
14 Ga0070658_10000704 3300005327 Bacteria 28959
15 Ga0070676_10000212 3300005328 Bacteria 24798
16 Ga0070683_100001594 3300005329 Bacteria 17553
17 Ga0070683_100087850 3300005329 Bacteria 2916
18 Ga0070683_100285250 3300005329 Bacteria 1571
19 Ga0070690_100000145 3300005330 Bacteria 35940
20 Ga0070690_100002317 3300005330 Bacteria 10221
21 Ga0070670_100000821 3300005331 Bacteria 24241
22 Ga0070677_10000156 3300005333 Bacteria 23147
23 Ga0068869_100000343 3300005334 Bacteria 24882
24 Ga0068869_100018792 3300005334 Bacteria 4712
25 Ga0070666_10000457 3300005335 Bacteria 24882
26 Ga0068868_100001968 3300005338 Bacteria 14084
27 Ga0070660_100000203 3300005339 Bacteria 39748
28 Ga0070689_100000159 3300005340 Bacteria 39820
29 Ga0070687_100000002 3300005343 Bacteria 76542
30 Ga0070661_100000134 3300005344 Bacteria 62179
31 Ga0070692_10015742 3300005345 Bacteria 3583
32 Ga0070668_100000039 3300005347 Bacteria 79523
33 Ga0070669_100000644 3300005353 Bacteria 25819
34 Ga0070675_100000669 3300005354 Bacteria 23742
35 Ga0070671_100009351 3300005355 Bacteria 7870
36 Ga0070674_100000118 3300005356 Bacteria 36017
37 Ga0070673_100007699 3300005364 Bacteria 7128
38 Ga0070688_100000186 3300005365 Bacteria 32942
39 Ga0070688_100259839 3300005365 Bacteria 1240
40 Ga0070659_100000298 3300005366 Bacteria 38865
41 Ga0070667_100002069 3300005367 Bacteria 17762
42 Ga0070703_10007118 3300005406 Bacteria 3140
43 Ga0070705_100000291 3300005440 Bacteria 29842
44 Ga0070705_100276613 3300005440 Unclassified 1191
45 Ga0070700_100004741 3300005441 Bacteria 7133
46 Ga0070700_100387502 3300005441 Unclassified 1047
47 Ga0070708_100006365 3300005445 Bacteria 9402
48 Ga0070708_100009969 3300005445 Bacteria 7682
49 Ga0070708_100050004 3300005445 Bacteria 3700
50 Ga0070708_100179513 3300005445 Bacteria 1978
51 Ga0070708_100255822 3300005445 Bacteria 1645
52 Ga0070663_100000088 3300005455 Bacteria 41407
53 Ga0070678_100001096 3300005456 Bacteria 14186
54 Ga0070662_100000587 3300005457 Bacteria 22123
55 Ga0070681_10181084 3300005458 Bacteria 2029
56 Ga0068867_100000195 3300005459 Bacteria 40012
57 Ga0070685_10001159 3300005466 Bacteria 14087
58 Ga0070706_100000120 3300005467 Bacteria 95553
59 Ga0070706_100063793 3300005467 Unclassified 3404
60 Ga0070706_100103626 3300005467 Bacteria 2645
61 Ga0070707_100000184 3300005468 Bacteria 61598
62 Ga0070707_100116789 3300005468 Unclassified 2590
63 Ga0070698_100017385 3300005471 Bacteria 7579
64 Ga0070699_100000013 3300005518 Bacteria 241303
65 Ga0070699_100003774 3300005518 Bacteria 13394
66 Ga0070679_100160638 3300005530 Unclassified 2221
67 Ga0070679_100235167 3300005530 Bacteria 1791
68 Ga0070684_100009112 3300005535 Bacteria 7805
69 Ga0070697_100009456 3300005536 Bacteria 7615
70 Ga0070697_100014475 3300005536 Bacteria 6196
71 Ga0070697_100126422 3300005536 Bacteria 2142
72 Ga0070697_100146251 3300005536 Archaea 1990
73 Ga0068853_100000362 3300005539 Bacteria 31305
74 Ga0070672_100000194 3300005543 Bacteria 33633
75 Ga0070686_100000201 3300005544 Bacteria 41381
76 Ga0070695_100189468 3300005545 Bacteria 1463
77 Ga0070696_100000142 3300005546 Bacteria 39428
78 Ga0070696_100006969 3300005546 Bacteria 7541
79 Ga0070696_100261734 3300005546 Unclassified 1312
80 Ga0070693_100001963 3300005547 Bacteria 9418
81 Ga0070693_100022805 3300005547 Bacteria 3336
82 Ga0070665_100003421 3300005548 Bacteria 16957
83 Ga0070704_100278258 3300005549 Bacteria 1385
84 Ga0070704_100374409 3300005549 Bacteria 1208
85 Ga0068855_100000383 3300005563 Bacteria 54598
86 Ga0070664_100000502 3300005564 Bacteria 29641
87 Ga0070664_100084149 3300005564 Bacteria 2745
88 Ga0068857_100000362 3300005577 Bacteria 31675
89 Ga0068854_100000520 3300005578 Bacteria 23365
90 Ga0068856_100004741 3300005614 Bacteria 13498
91 Ga0068852_100000211 3300005616 Bacteria 39692
92 Ga0068859_100001182 3300005617 Bacteria 26638
93 Ga0068859_100621812 3300005617 Bacteria 1173
94 Ga0068864_100000579 3300005618 Bacteria 31124
95 Ga0068866_10000131 3300005718 Bacteria 33190
96 Ga0068861_100000362 3300005719 Bacteria 26031
97 Ga0068851_10000114 3300005834 Bacteria 42839
98 Ga0068870_10000278 3300005840 Bacteria 18928
99 Ga0068863_100000473 3300005841 Bacteria 41129
100 Ga0068863_100115036 3300005841 Bacteria 2563
101 Ga0068863_100151877 3300005841 Bacteria 2216
102 Ga0068863_100201614 3300005841 Bacteria 1914
103 Ga0068858_100002171 3300005842 Bacteria 19907
104 Ga0068860_100000977 3300005843 Bacteria 31691
105 Ga0068862_100000870 3300005844 Bacteria 29442
106 Ga0081540_1000033 3300005983 Bacteria 142902
107 Ga0081540_1000160 3300005983 Bacteria 69415
108 Ga0081540_1000605 3300005983 Bacteria 34193
109 Ga0081539_10000505 3300005985 Bacteria 81474
110 Ga0081539_10003368 3300005985 Bacteria 19786
111 Ga0081539_10097594 3300005985 Unclassified 1504
112 Ga0070717_10016364 3300006028 Bacteria 5749
113 Ga0070717_10332687 3300006028 Bacteria 1355
114 Ga0097621_100000104 3300006237 Bacteria 47633
115 Ga0097621_100218262 3300006237 Bacteria 1661
116 Ga0068871_100000502 3300006358 Bacteria 26699
117 Ga0075428_100190057 3300006844 Bacteria 2221
118 Ga0075433_10602710 3300006852 Bacteria 964
119 Ga0075434_100092837 3300006871 Bacteria 3021
120 Ga0075434_100114915 3300006871 Bacteria 2704
121 Ga0075434_100486087 3300006871 Bacteria 1255
122 Ga0068865_100000163 3300006881 Bacteria 36568
123 Ga0097620_100001182 3300006931 Bacteria 26638
124 Ga0097620_100621776 3300006931 Bacteria 1173
125 Ga0075435_100146004 3300007076 Unclassified 1987
126 Ga0099794_10007096 3300007265 Unclassified 4580
127 Ga0099794_10011186 3300007265 Bacteria 3836
128 Ga0099794_10018656 3300007265 Bacteria 3114
129 Ga0099794_10058424 3300007265 Bacteria 1870
130 Ga0105240_10003863 3300009093 Bacteria 23143
131 Ga0105245_10000381 3300009098 Bacteria 41175
132 Ga0105247_10000449 3300009101 Bacteria 34921
133 Ga0114129_10009063 3300009147 Bacteria 14183
134 Ga0114129_10037669 3300009147 Bacteria 6826
135 Ga0114129_10554881 3300009147 Unclassified 1493
136 Ga0105243_10002984 3300009148 Bacteria 13986
137 Ga0105241_10000925 3300009174 Bacteria 22237
138 Ga0105241_10079865 3300009174 Plasmid 2558
139 Ga0105242_10001510 3300009176 Bacteria 18293
140 Ga0105248_10000704 3300009177 Bacteria 37779
141 Ga0105248_10495382 3300009177 Bacteria 1377
142 Ga0105237_10000031 3300009545 Bacteria 197346
143 Ga0105238_10001175 3300009551 Bacteria 26315
144 Ga0105249_10000604 3300009553 Bacteria 32731
145 Ga0105249_10109223 3300009553 Bacteria 2612
146 Ga0105239_10000220 3300010375 Bacteria 84136
147 Ga0105246_10004293 3300011119 Bacteria 8668
148 Ga0157373_10012514 3300013100 Bacteria 6236
149 Ga0157371_10000246 3300013102 Bacteria 76861
150 Ga0157369_10000669 3300013105 Bacteria 44175
151 Ga0157374_10000295 3300013296 Bacteria 46020
152 Ga0157374_10587387 3300013296 Unclassified 1123
153 Ga0157378_10003702 3300013297 Bacteria 13564
154 Ga0163162_10000200 3300013306 Bacteria 55467
155 Ga0157372_10007285 3300013307 Bacteria 11780
156 Ga0157375_10001123 3300013308 Bacteria 23168
157 Ga0163163_10001685 3300014325 Bacteria 18655
158 Ga0182008_10048008 3300014497 Unclassified 2120
159 Ga0157377_10000219 3300014745 Bacteria 30327
160 Ga0157379_10000625 3300014968 Bacteria 28539
161 Ga0157376_10000284 3300014969 Bacteria 34216
162 Ga0157376_10461130 3300014969 Bacteria 1242
163 Ga0163161_10028173 3300017792 Bacteria 3987
164 Ga0213876_10000041 3300021384 Bacteria 169380
165 Ga0207697_10001984 3300025315 Bacteria 10857
166 Ga0207656_10000622 3300025321 Bacteria 11613
167 Ga0207653_10000133 3300025885 Bacteria 53038
168 Ga0207682_10000658 3300025893 Bacteria 16139
169 Ga0207642_10000126 3300025899 Bacteria 21042
170 Ga0207710_10007391 3300025900 Bacteria 4654
171 Ga0207688_10000180 3300025901 Bacteria 28077
172 Ga0207680_10001578 3300025903 Bacteria 10735
173 Ga0207647_10026796 3300025904 Bacteria 3765
174 Ga0207645_10000027 3300025907 Bacteria 96143
175 Ga0207643_10000005 3300025908 Bacteria 182148
176 Ga0207705_10007267 3300025909 Bacteria 8148
177 Ga0207684_10000075 3300025910 Bacteria 183366
178 Ga0207684_10087285 3300025910 Bacteria 2658
179 Ga0207684_10155029 3300025910 Unclassified 1971
180 Ga0207654_10006842 3300025911 Bacteria 5739
181 Ga0207654_10090900 3300025911 Unclassified 1860
182 Ga0207707_10150081 3300025912 Bacteria 2038
183 Ga0207695_10013286 3300025913 Bacteria 9823
184 Ga0207671_10000265 3300025914 Bacteria 78548
185 Ga0207662_10000075 3300025918 Bacteria 45170
186 Ga0207657_10000029 3300025919 Bacteria 137747
187 Ga0207649_10000386 3300025920 Bacteria 33017
188 Ga0207652_10067146 3300025921 Bacteria 3109
189 Ga0207646_10015800 3300025922 Bacteria 7109
190 Ga0207681_10000063 3300025923 Bacteria 99129
191 Ga0207694_10010542 3300025924 Bacteria 6971
192 Ga0207650_10000232 3300025925 Bacteria 62024
193 Ga0207659_10000243 3300025926 Bacteria 33179
194 Ga0207687_10002959 3300025927 Bacteria 11512
195 Ga0207644_10001285 3300025931 Bacteria 16163
196 Ga0207690_10001131 3300025932 Bacteria 17002
197 Ga0207706_10000231 3300025933 Bacteria 60951
198 Ga0207686_10000823 3300025934 Bacteria 18934
199 Ga0207686_10162899 3300025934 Bacteria 1565
200 Ga0207709_10017429 3300025935 Plasmid 4009
201 Ga0207709_10080621 3300025935 Bacteria 2096
202 Ga0207670_10001311 3300025936 Bacteria 13135
203 Ga0207669_10004745 3300025937 Bacteria 6019
204 Ga0207704_10001151 3300025938 Bacteria 11764
205 Ga0207691_10000068 3300025940 Bacteria 84243
206 Ga0207711_10000068 3300025941 Bacteria 116544
207 Ga0207689_10000375 3300025942 Bacteria 42073
208 Ga0207689_10042776 3300025942 Bacteria 3746
209 Ga0207661_10004322 3300025944 Bacteria 9944
210 Ga0207661_10235737 3300025944 Bacteria 1622
211 Ga0207661_10423219 3300025944 Bacteria 1210
212 Ga0207679_10000135 3300025945 Bacteria 60279
213 Ga0207679_10059136 3300025945 Bacteria 2843
214 Ga0207667_10001908 3300025949 Bacteria 26171
215 Ga0207651_10000040 3300025960 Bacteria 62487
216 Ga0207712_10000187 3300025961 Bacteria 64116
217 Ga0207712_10307108 3300025961 Bacteria 1304
218 Ga0207668_10001124 3300025972 Bacteria 15955
219 Ga0207640_10000399 3300025981 Bacteria 27562
220 Ga0207658_10000246 3300025986 Bacteria 56484
221 Ga0207677_10000018 3300026023 Bacteria 139501
222 Ga0207703_10000112 3300026035 Bacteria 96518
223 Ga0207639_10000324 3300026041 Bacteria 33242
224 Ga0207678_10000349 3300026067 Bacteria 41962
225 Ga0207708_10007589 3300026075 Bacteria 8025
226 Ga0207641_10000329 3300026088 Bacteria 58136
227 Ga0207641_10105130 3300026088 Bacteria 2493
228 Ga0207641_10376561 3300026088 Bacteria 1358
229 Ga0207648_10001848 3300026089 Bacteria 23168
230 Ga0207676_10000289 3300026095 Bacteria 43323
231 Ga0207674_10000304 3300026116 Bacteria 62363
232 Ga0207675_100000002 3300026118 Bacteria 325956
233 Ga0207675_100096464 3300026118 Bacteria 2784
234 Ga0207683_10000070 3300026121 Bacteria 78648
235 Ga0207698_10000132 3300026142 Bacteria 46951
236 Ga0209588_1008882 3300027671 Bacteria 2989
237 Ga0209588_1035050 3300027671 Bacteria 1613
238 Ga0209588_1050423 3300027671 Bacteria 1346
239 Ga0209588_1077705 3300027671 Unclassified 1073
240 Ga0268266_10000139 3300028379 Bacteria 140538
241 Ga0268265_10000148 3300028380 Bacteria 86667
242 Ga0268264_10000312 3300028381 Bacteria 78042
243 Ga0268264_10148889 3300028381 Bacteria 2096
244 Ga0307517_10112577 3300028786 Bacteria 2060
245 Ga0307515_10012313 3300028794 Bacteria 16095
246 Ga0265332_10064101 3300031238 Bacteria 1569
247 Ga0307509_10018062 3300031507 Bacteria 8098
248 Ga0307509_10064053 3300031507 Bacteria 3869
249 Ga0307508_10215736 3300031616 Bacteria 1519
250 Ga0307508_10295574 3300031616 Bacteria 1213
251 Ga0307507_10107677 3300033179 Bacteria 2296
252 Ga0373941_0015448 3300035115 Bacteria 2059
253 Ga0373956_0178615 3300035119 Unclassified 1003
254 Ga0373961_0000008 3300035241 Bacteria 139095
255 Ga0436364_1298933 3300037853 Bacteria 1590
256 Ga0436365_1476328 3300039437 Bacteria 212791
257 Ga0436360_1038520 3300039438 Unclassified 968
258 Ga0436361_0453030 3300039447 Unclassified 1444
259 Ga0436361_0600523 3300039447 Bacteria 14642
260 Ga0436361_0661927 3300039447 Bacteria 15656
261 Ga0436363_1085495 3300039450 Bacteria 3083
262 Ga0436363_1449302 3300039450 Bacteria 1588
263 Ga0436362_1201345 3300039453 Bacteria 1359
264 Ga0439455_0005474 3300042012 Bacteria 2582
265 Ga0451577_0222426 3300042876 Bacteria 1706
266 Ga0453683_0013081 3300044673 Bacteria 5427
267 Ga0496101_0121676 3300048904 Bacteria 1974
268 Ga0496102_0001277 3300048905 Bacteria 22718
269 Ga0496105_0588314 3300048908 Bacteria 865
270 Ga0496106_0001048 3300048909 Bacteria 20344
271 Ga0496108_0022027 3300048911 Bacteria 5239
272 Ga0496109_0001513 3300048912 Bacteria 19335
273 Ga0496112_0000162 3300048915 Bacteria 42364
274 Ga0496112_0008145 3300048915 Bacteria 9365
275 Ga0496113_0355936 3300048916 Unclassified 1174
276 nmdc:mga05p37_1311_c1 3300050507 Bacteria 28942
277 nmdc:mga05p37_135375_c1 3300050507 Bacteria 3022
278 nmdc:mga09592_59867_c1 3300050508 Unclassified 3219
279 nmdc:mga0n895_86325_c1 3300050512 Bacteria 3134
280 Ga0500578_0079670 3300053086 Bacteria 2084
281 Ga0500646_0018239 3300053090 Bacteria 1846
282 Ga0500566_0001777 3300053094 Bacteria 12666
283 Ga0500640_000294 3300053095 Bacteria 11263
284 Ga0500554_000059 3300053102 Bacteria 19672
285 Ga0500595_000356 3300053119 Bacteria 29768
286 Ga0500614_000828 3300053123 Bacteria 7798
287 Ga0500614_002453 3300053123 Bacteria 4134
288 Ga0500559_0005590 3300053136 Bacteria 5767
289 Ga0500638_081581 3300053162 Bacteria 1535
290 Ga0500636_0206077 3300053177 Unclassified 1036
291 Ga0500637_0127467 3300053178 Bacteria 1476
292 Ga0500637_0144506 3300053178 Bacteria 1376

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0015448 Ga0373941_0015448_412_1287 208
2 3300039447 Ga0436361_0453030 Ga0436361_0453030_490_1359 208
3 3300039438 Ga0436360_1038520 Ga0436360_1038520_28_879 222
4 3300039447 Ga0436361_0600523 Ga0436361_0600523_9842_10669 222
5 3300039447 Ga0436361_0661927 Ga0436361_0661927_10162_11010 222
6 3300039453 Ga0436362_1201345 Ga0436362_1201345_240_1091 222
7 3300005334 Ga0068869_100018792 Ga0068869_1000187924 224
8 3300005841 Ga0068863_100115036 Ga0068863_1001150362 224
9 3300006871 Ga0075434_100092837 Ga0075434_1000928372 224
10 3300009147 Ga0114129_10009063 Ga0114129_100090637 224
11 3300025934 Ga0207686_10162899 Ga0207686_101628992 224
12 3300025942 Ga0207689_10042776 Ga0207689_100427763 224
13 3300026088 Ga0207641_10105130 Ga0207641_101051302 224
14 3300026118 Ga0207675_100096464 Ga0207675_1000964642 224
15 3300028381 Ga0268264_10148889 Ga0268264_101488893 224
16 3300050507 nmdc:mga05p37_135375_c1 nmdc:mga05p37_135375_c1_809_1648 224
17 3300050512 nmdc:mga0n895_86325_c1 nmdc:mga0n895_86325_c1_2046_2885 224
18 3300000546 LJNas_1000023 LJNas_100002312 225
19 3300003203 JGI25406J46586_10006480 JGI25406J46586_100064802 225
20 3300003203 JGI25406J46586_10036770 JGI25406J46586_100367701 225
21 3300005329 Ga0070683_100087850 Ga0070683_1000878502 225
22 3300005329 Ga0070683_100285250 Ga0070683_1002852502 225
23 3300005330 Ga0070690_100002317 Ga0070690_1000023176 225
24 3300005365 Ga0070688_100259839 Ga0070688_1002598391 225
25 3300005406 Ga0070703_10007118 Ga0070703_100071182 225
26 3300005440 Ga0070705_100276613 Ga0070705_1002766132 225
27 3300005441 Ga0070700_100387502 Ga0070700_1003875021 225
28 3300005445 Ga0070708_100006365 Ga0070708_1000063654 225
29 3300005445 Ga0070708_100009969 Ga0070708_1000099695 225
30 3300005445 Ga0070708_100050004 Ga0070708_1000500043 225
31 3300005445 Ga0070708_100179513 Ga0070708_1001795132 225
32 3300005445 Ga0070708_100255822 Ga0070708_1002558221 225
33 3300005467 Ga0070706_100000120 Ga0070706_1000001202 225
34 3300005467 Ga0070706_100063793 Ga0070706_1000637932 225
35 3300005467 Ga0070706_100103626 Ga0070706_1001036262 225
36 3300005468 Ga0070707_100000184 Ga0070707_10000018452 225
37 3300005468 Ga0070707_100116789 Ga0070707_1001167892 225
38 3300005471 Ga0070698_100017385 Ga0070698_1000173855 225
39 3300005518 Ga0070699_100000013 Ga0070699_100000013173 225
40 3300005518 Ga0070699_100003774 Ga0070699_10000377412 225
41 3300005530 Ga0070679_100160638 Ga0070679_1001606382 225
42 3300005536 Ga0070697_100009456 Ga0070697_1000094568 225
43 3300005536 Ga0070697_100014475 Ga0070697_1000144751 225
44 3300005536 Ga0070697_100126422 Ga0070697_1001264223 225
45 3300005536 Ga0070697_100146251 Ga0070697_1001462512 225
46 3300005545 Ga0070695_100189468 Ga0070695_1001894682 225
47 3300005546 Ga0070696_100000142 Ga0070696_10000014223 225
48 3300005546 Ga0070696_100261734 Ga0070696_1002617342 225
49 3300005547 Ga0070693_100001963 Ga0070693_1000019638 225
50 3300005549 Ga0070704_100374409 Ga0070704_1003744092 225
51 3300005617 Ga0068859_100621812 Ga0068859_1006218122 225
52 3300005841 Ga0068863_100151877 Ga0068863_1001518773 225
53 3300005841 Ga0068863_100201614 Ga0068863_1002016142 225
54 3300005985 Ga0081539_10000505 Ga0081539_1000050511 225
55 3300005985 Ga0081539_10003368 Ga0081539_1000336819 225
56 3300005985 Ga0081539_10097594 Ga0081539_100975942 225
57 3300006028 Ga0070717_10016364 Ga0070717_100163643 225
58 3300006028 Ga0070717_10332687 Ga0070717_103326872 225
59 3300006844 Ga0075428_100190057 Ga0075428_1001900573 225
60 3300006852 Ga0075433_10602710 Ga0075433_106027101 225
61 3300006871 Ga0075434_100114915 Ga0075434_1001149152 225
62 3300006871 Ga0075434_100486087 Ga0075434_1004860872 225
63 3300006931 Ga0097620_100621776 Ga0097620_1006217762 225
64 3300007076 Ga0075435_100146004 Ga0075435_1001460042 225
65 3300007265 Ga0099794_10007096 Ga0099794_100070964 225
66 3300007265 Ga0099794_10011186 Ga0099794_100111863 225
67 3300007265 Ga0099794_10018656 Ga0099794_100186563 225
68 3300007265 Ga0099794_10058424 Ga0099794_100584242 225
69 3300009147 Ga0114129_10037669 Ga0114129_100376693 225
70 3300009147 Ga0114129_10554881 Ga0114129_105548812 225
71 3300009174 Ga0105241_10079865 Ga0105241_100798651 225
72 3300009177 Ga0105248_10495382 Ga0105248_104953821 225
73 3300009553 Ga0105249_10109223 Ga0105249_101092233 225
74 3300013296 Ga0157374_10587387 Ga0157374_105873871 225
75 3300021384 Ga0213876_10000041 Ga0213876_1000004125 225
76 3300025885 Ga0207653_10000133 Ga0207653_1000013351 225
77 3300025910 Ga0207684_10000075 Ga0207684_1000007578 225
78 3300025910 Ga0207684_10087285 Ga0207684_100872852 225
79 3300025910 Ga0207684_10155029 Ga0207684_101550292 225
80 3300025911 Ga0207654_10090900 Ga0207654_100909001 225
81 3300025922 Ga0207646_10015800 Ga0207646_100158001 225
82 3300025935 Ga0207709_10017429 Ga0207709_100174295 225
83 3300025944 Ga0207661_10235737 Ga0207661_102357372 225
84 3300025944 Ga0207661_10423219 Ga0207661_104232192 225
85 3300025961 Ga0207712_10307108 Ga0207712_103071081 225
86 3300026088 Ga0207641_10376561 Ga0207641_103765612 225
87 3300027671 Ga0209588_1008882 Ga0209588_10088823 225
88 3300027671 Ga0209588_1035050 Ga0209588_10350502 225
89 3300027671 Ga0209588_1050423 Ga0209588_10504232 225
90 3300027671 Ga0209588_1077705 Ga0209588_10777052 225
91 3300028786 Ga0307517_10112577 Ga0307517_101125773 225
92 3300028794 Ga0307515_10012313 Ga0307515_100123136 225
93 3300031238 Ga0265332_10064101 Ga0265332_100641012 225
94 3300031507 Ga0307509_10018062 Ga0307509_100180626 225
95 3300031507 Ga0307509_10064053 Ga0307509_100640531 225
96 3300031616 Ga0307508_10215736 Ga0307508_102157362 225
97 3300031616 Ga0307508_10295574 Ga0307508_102955741 225
98 3300033179 Ga0307507_10107677 Ga0307507_101076772 225
99 3300035119 Ga0373956_0178615 Ga0373956_0178615_120_992 225
100 3300035241 Ga0373961_0000008 Ga0373961_0000008_77728_78621 225
101 3300037853 Ga0436364_1298933 Ga0436364_1298933_424_1290 225
102 3300039437 Ga0436365_1476328 Ga0436365_1476328_71084_71968 225
103 3300039450 Ga0436363_1085495 Ga0436363_1085495_1371_2231 225
104 3300039450 Ga0436363_1449302 Ga0436363_1449302_516_1274 225
105 3300042876 Ga0451577_0222426 Ga0451577_0222426_306_1190 225
106 3300044673 Ga0453683_0013081 Ga0453683_0013081_3748_4632 225
107 3300048908 Ga0496105_0588314 Ga0496105_0588314_51_809 225
108 3300048915 Ga0496112_0008145 Ga0496112_0008145_4319_5179 225
109 3300050507 nmdc:mga05p37_1311_c1 nmdc:mga05p37_1311_c1_16971_17729 225
110 3300050508 nmdc:mga09592_59867_c1 nmdc:mga09592_59867_c1_66_932 225
111 3300053086 Ga0500578_0079670 Ga0500578_0079670_222_1070 225
112 3300053090 Ga0500646_0018239 Ga0500646_0018239_973_1731 225
113 3300053094 Ga0500566_0001777 Ga0500566_0001777_10187_11029 225
114 3300053095 Ga0500640_000294 Ga0500640_000294_2217_3059 225
115 3300053102 Ga0500554_000059 Ga0500554_000059_17081_17923 225
116 3300053119 Ga0500595_000356 Ga0500595_000356_7756_8598 225
117 3300053123 Ga0500614_000828 Ga0500614_000828_5225_6067 225
118 3300053123 Ga0500614_002453 Ga0500614_002453_1998_2876 225
119 3300053136 Ga0500559_0005590 Ga0500559_0005590_1027_1869 225
120 3300053162 Ga0500638_081581 Ga0500638_081581_260_1138 225
121 3300053177 Ga0500636_0206077 Ga0500636_0206077_15_863 225
122 3300053178 Ga0500637_0127467 Ga0500637_0127467_177_1055 225
123 3300053178 Ga0500637_0144506 Ga0500637_0144506_151_1050 225
124 2162886012 MBSR1b_contig_2086237 MBSR1b_0411.00005350 226
125 3300001976 JGI24752J21851_1005171 JGI24752J21851_10051713 226
126 3300001990 JGI24737J22298_10022391 JGI24737J22298_100223912 226
127 3300001991 JGI24743J22301_10006642 JGI24743J22301_100066423 226
128 3300002073 JGI24745J21846_1002784 JGI24745J21846_10027843 226
129 3300002074 JGI24748J21848_1010697 JGI24748J21848_10106972 226
130 3300002076 JGI24749J21850_1002921 JGI24749J21850_10029213 226
131 3300002239 JGI24034J26672_10003589 JGI24034J26672_100035892 226
132 3300005290 Ga0065712_10144137 Ga0065712_101441371 226
133 3300005293 Ga0065715_10237170 Ga0065715_102371702 226
134 3300005327 Ga0070658_10000704 Ga0070658_1000070429 226
135 3300005328 Ga0070676_10000212 Ga0070676_1000021216 226
136 3300005329 Ga0070683_100001594 Ga0070683_1000015945 226
137 3300005330 Ga0070690_100000145 Ga0070690_10000014529 226
138 3300005331 Ga0070670_100000821 Ga0070670_10000082117 226
139 3300005333 Ga0070677_10000156 Ga0070677_100001569 226
140 3300005334 Ga0068869_100000343 Ga0068869_10000034316 226
141 3300005335 Ga0070666_10000457 Ga0070666_1000045716 226
142 3300005338 Ga0068868_100001968 Ga0068868_10000196812 226
143 3300005339 Ga0070660_100000203 Ga0070660_10000020317 226
144 3300005340 Ga0070689_100000159 Ga0070689_10000015930 226
145 3300005343 Ga0070687_100000002 Ga0070687_10000000242 226
146 3300005344 Ga0070661_100000134 Ga0070661_10000013442 226
147 3300005345 Ga0070692_10015742 Ga0070692_100157422 226
148 3300005347 Ga0070668_100000039 Ga0070668_10000003930 226
149 3300005353 Ga0070669_100000644 Ga0070669_10000064412 226
150 3300005354 Ga0070675_100000669 Ga0070675_10000066912 226
151 3300005355 Ga0070671_100009351 Ga0070671_1000093514 226
152 3300005356 Ga0070674_100000118 Ga0070674_10000011827 226
153 3300005364 Ga0070673_100007699 Ga0070673_1000076996 226
154 3300005365 Ga0070688_100000186 Ga0070688_1000001869 226
155 3300005366 Ga0070659_100000298 Ga0070659_10000029816 226
156 3300005367 Ga0070667_100002069 Ga0070667_10000206912 226
157 3300005440 Ga0070705_100000291 Ga0070705_10000029134 226
158 3300005441 Ga0070700_100004741 Ga0070700_1000047418 226
159 3300005455 Ga0070663_100000088 Ga0070663_10000008829 226
160 3300005456 Ga0070678_100001096 Ga0070678_1000010963 226
161 3300005457 Ga0070662_100000587 Ga0070662_10000058712 226
162 3300005458 Ga0070681_10181084 Ga0070681_101810842 226
163 3300005459 Ga0068867_100000195 Ga0068867_10000019517 226
164 3300005466 Ga0070685_10001159 Ga0070685_100011593 226
165 3300005530 Ga0070679_100235167 Ga0070679_1002351672 226
166 3300005535 Ga0070684_100009112 Ga0070684_1000091123 226
167 3300005539 Ga0068853_100000362 Ga0068853_10000036224 226
168 3300005543 Ga0070672_100000194 Ga0070672_10000019424 226
169 3300005544 Ga0070686_100000201 Ga0070686_10000020120 226
170 3300005546 Ga0070696_100006969 Ga0070696_1000069693 226
171 3300005547 Ga0070693_100022805 Ga0070693_1000228053 226
172 3300005548 Ga0070665_100003421 Ga0070665_10000342112 226
173 3300005549 Ga0070704_100278258 Ga0070704_1002782582 226
174 3300005563 Ga0068855_100000383 Ga0068855_10000038348 226
175 3300005564 Ga0070664_100000502 Ga0070664_1000005025 226
176 3300005564 Ga0070664_100084149 Ga0070664_1000841493 226
177 3300005577 Ga0068857_100000362 Ga0068857_10000036226 226
178 3300005578 Ga0068854_100000520 Ga0068854_10000052010 226
179 3300005614 Ga0068856_100004741 Ga0068856_1000047415 226
180 3300005616 Ga0068852_100000211 Ga0068852_10000021116 226
181 3300005617 Ga0068859_100001182 Ga0068859_1000011822 226
182 3300005618 Ga0068864_100000579 Ga0068864_10000057930 226
183 3300005718 Ga0068866_10000131 Ga0068866_1000013120 226
184 3300005719 Ga0068861_100000362 Ga0068861_10000036230 226
185 3300005834 Ga0068851_10000114 Ga0068851_1000011421 226
186 3300005840 Ga0068870_10000278 Ga0068870_1000027814 226
187 3300005841 Ga0068863_100000473 Ga0068863_1000004733 226
188 3300005842 Ga0068858_100002171 Ga0068858_10000217112 226
189 3300005843 Ga0068860_100000977 Ga0068860_10000097725 226
190 3300005844 Ga0068862_100000870 Ga0068862_10000087010 226
191 3300005983 Ga0081540_1000033 Ga0081540_100003357 226
192 3300005983 Ga0081540_1000160 Ga0081540_100016016 226
193 3300005983 Ga0081540_1000605 Ga0081540_100060524 226
194 3300006237 Ga0097621_100000104 Ga0097621_10000010413 226
195 3300006237 Ga0097621_100218262 Ga0097621_1002182622 226
196 3300006358 Ga0068871_100000502 Ga0068871_10000050219 226
197 3300006881 Ga0068865_100000163 Ga0068865_10000016330 226
198 3300006931 Ga0097620_100001182 Ga0097620_10000118231 226
199 3300009093 Ga0105240_10003863 Ga0105240_1000386310 226
200 3300009098 Ga0105245_10000381 Ga0105245_1000038129 226
201 3300009101 Ga0105247_10000449 Ga0105247_1000044916 226
202 3300009148 Ga0105243_10002984 Ga0105243_1000298413 226
203 3300009174 Ga0105241_10000925 Ga0105241_1000092520 226
204 3300009176 Ga0105242_10001510 Ga0105242_1000151012 226
205 3300009177 Ga0105248_10000704 Ga0105248_1000070441 226
206 3300009545 Ga0105237_10000031 Ga0105237_1000003156 226
207 3300009551 Ga0105238_10001175 Ga0105238_100011752 226
208 3300009553 Ga0105249_10000604 Ga0105249_100006049 226
209 3300010375 Ga0105239_10000220 Ga0105239_1000022059 226
210 3300011119 Ga0105246_10004293 Ga0105246_100042935 226
211 3300013100 Ga0157373_10012514 Ga0157373_100125143 226
212 3300013102 Ga0157371_10000246 Ga0157371_1000024656 226
213 3300013105 Ga0157369_10000669 Ga0157369_1000066936 226
214 3300013296 Ga0157374_10000295 Ga0157374_1000029529 226
215 3300013297 Ga0157378_10003702 Ga0157378_100037025 226
216 3300013306 Ga0163162_10000200 Ga0163162_1000020036 226
217 3300013307 Ga0157372_10007285 Ga0157372_100072856 226
218 3300013308 Ga0157375_10001123 Ga0157375_1000112316 226
219 3300014325 Ga0163163_10001685 Ga0163163_1000168514 226
220 3300014497 Ga0182008_10048008 Ga0182008_100480082 226
221 3300014745 Ga0157377_10000219 Ga0157377_100002198 226
222 3300014968 Ga0157379_10000625 Ga0157379_100006257 226
223 3300014969 Ga0157376_10000284 Ga0157376_1000028429 226
224 3300014969 Ga0157376_10461130 Ga0157376_104611301 226
225 3300017792 Ga0163161_10028173 Ga0163161_100281734 226
226 3300025315 Ga0207697_10001984 Ga0207697_100019843 226
227 3300025321 Ga0207656_10000622 Ga0207656_100006226 226
228 3300025893 Ga0207682_10000658 Ga0207682_1000065817 226
229 3300025899 Ga0207642_10000126 Ga0207642_100001263 226
230 3300025900 Ga0207710_10007391 Ga0207710_100073915 226
231 3300025901 Ga0207688_10000180 Ga0207688_1000018028 226
232 3300025903 Ga0207680_10001578 Ga0207680_100015789 226
233 3300025904 Ga0207647_10026796 Ga0207647_100267963 226
234 3300025907 Ga0207645_10000027 Ga0207645_1000002776 226
235 3300025908 Ga0207643_10000005 Ga0207643_10000005133 226
236 3300025909 Ga0207705_10007267 Ga0207705_100072673 226
237 3300025911 Ga0207654_10006842 Ga0207654_100068422 226
238 3300025912 Ga0207707_10150081 Ga0207707_101500812 226
239 3300025913 Ga0207695_10013286 Ga0207695_100132869 226
240 3300025914 Ga0207671_10000265 Ga0207671_1000026538 226
241 3300025918 Ga0207662_10000075 Ga0207662_1000007540 226
242 3300025919 Ga0207657_10000029 Ga0207657_1000002928 226
243 3300025920 Ga0207649_10000386 Ga0207649_100003868 226
244 3300025921 Ga0207652_10067146 Ga0207652_100671463 226
245 3300025923 Ga0207681_10000063 Ga0207681_1000006315 226
246 3300025924 Ga0207694_10010542 Ga0207694_100105422 226
247 3300025925 Ga0207650_10000232 Ga0207650_1000023241 226
248 3300025926 Ga0207659_10000243 Ga0207659_1000024310 226
249 3300025927 Ga0207687_10002959 Ga0207687_100029593 226
250 3300025931 Ga0207644_10001285 Ga0207644_1000128510 226
251 3300025932 Ga0207690_10001131 Ga0207690_1000113112 226
252 3300025933 Ga0207706_10000231 Ga0207706_1000023140 226
253 3300025934 Ga0207686_10000823 Ga0207686_100008238 226
254 3300025935 Ga0207709_10080621 Ga0207709_100806213 226
255 3300025936 Ga0207670_10001311 Ga0207670_100013115 226
256 3300025937 Ga0207669_10004745 Ga0207669_100047452 226
257 3300025938 Ga0207704_10001151 Ga0207704_100011513 226
258 3300025940 Ga0207691_10000068 Ga0207691_1000006856 226
259 3300025941 Ga0207711_10000068 Ga0207711_1000006896 226
260 3300025942 Ga0207689_10000375 Ga0207689_1000037532 226
261 3300025944 Ga0207661_10004322 Ga0207661_100043225 226
262 3300025945 Ga0207679_10000135 Ga0207679_100001359 226
263 3300025945 Ga0207679_10059136 Ga0207679_100591363 226
264 3300025949 Ga0207667_10001908 Ga0207667_100019082 226
265 3300025960 Ga0207651_10000040 Ga0207651_1000004056 226
266 3300025961 Ga0207712_10000187 Ga0207712_1000018732 226
267 3300025972 Ga0207668_10001124 Ga0207668_1000112412 226
268 3300025981 Ga0207640_10000399 Ga0207640_100003993 226
269 3300025986 Ga0207658_10000246 Ga0207658_1000024629 226
270 3300026023 Ga0207677_10000018 Ga0207677_1000001856 226
271 3300026035 Ga0207703_10000112 Ga0207703_1000011276 226
272 3300026041 Ga0207639_10000324 Ga0207639_1000032426 226
273 3300026067 Ga0207678_10000349 Ga0207678_1000034929 226
274 3300026075 Ga0207708_10007589 Ga0207708_100075892 226
275 3300026088 Ga0207641_10000329 Ga0207641_100003299 226
276 3300026089 Ga0207648_10001848 Ga0207648_1000184816 226
277 3300026095 Ga0207676_10000289 Ga0207676_1000028945 226
278 3300026116 Ga0207674_10000304 Ga0207674_100003049 226
279 3300026118 Ga0207675_100000002 Ga0207675_10000000279 226
280 3300026121 Ga0207683_10000070 Ga0207683_1000007029 226
281 3300026142 Ga0207698_10000132 Ga0207698_1000013227 226
282 3300028379 Ga0268266_10000139 Ga0268266_1000013999 226
283 3300028380 Ga0268265_10000148 Ga0268265_1000014862 226
284 3300028381 Ga0268264_10000312 Ga0268264_1000031229 226
285 3300042012 Ga0439455_0005474 Ga0439455_0005474_247_1095 226
286 3300048904 Ga0496101_0121676 Ga0496101_0121676_76_834 226
287 3300048905 Ga0496102_0001277 Ga0496102_0001277_7418_8176 226
288 3300048909 Ga0496106_0001048 Ga0496106_0001048_2126_2884 226
289 3300048911 Ga0496108_0022027 Ga0496108_0022027_1385_2143 226
290 3300048912 Ga0496109_0001513 Ga0496109_0001513_13903_14661 226
291 3300048915 Ga0496112_0000162 Ga0496112_0000162_37277_38035 226
292 3300048916 Ga0496113_0355936 Ga0496113_0355936_220_978 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

60

299

0.99

PF09084

NMT1

NMT1/THI5 like

81

248

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ghq-assembly1.cif.gz_A htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution 0.8066 8 224
6ghq-assembly1.cif.gz_A htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution 0.775 8 224
5o2k-assembly4.cif.gz_C native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution 0.7745 2 224
5o2k-assembly4.cif.gz_C native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution 0.7624 2 224
7zck-assembly1.cif.gz_C room temperature crystal structure of phnd from synechococcus mits9220 in complex with phosphate 0.7504 2 226
ID Description Score Start End Superfamily
4oeuB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8407 31 53 3.40.190.10
af_Q2G1L7_48_134_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8285 2 50 3.40.190.10
5isuA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8112 33 77 3.40.190.10
3qujD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7946 2 208 3.40.190.10
3qujD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7569 2 208 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5N1GHC8-F1-model_v4 Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein 0.8569 9 224
AF-L1JXY8-F1-model_v4 Uncharacterized protein 0.8523 18 223
AF-A0A2P8HWN6-F1-model_v4 Phosphonate transport system substrate-binding protein 0.8522 2 223 GO:0043190
GO:0055085
AF-A0A1Q5S3N4-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.8436 9 226
AF-A0A538M0W8-F1-model_v4 Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein 0.8397 11 226

Feature Viewer

pLDDT pTM Quality
80.76 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map