F390827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 218 | 292 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100621812|Ga0068859_1006218122 |
| Length | 313 |
| Sequence | MPGASAGSPEGAPAWYSVAIMRIVSASWIALAVAVVASAGVPGCSKSGGSDGAGQKTLRLSMIPTTDPGKMARDSAPLVAYLEHATGAKVELTVPLNYAAVVEAFGADKVDIAYFGGFTYVQASKRFGAQPLVQRERDQAFHSLFITQADSPIATLEDLKGKSFAFGDVNSTSGHLMPEYYLRNRGVDPDVIARAIYTGGHDATALAVANKKVDAGALDEAVYAKLTKEGKLDAEKLRVFYITPPFFDYLWSARKALDPALADAFKKAMLALDPANPQHKPVLDLLQASRYVVAADASYDKLREAATAAGLLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 210 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 212 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 213 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 214 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 215 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 216 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.45 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 88.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2086237 | 2162886012 | Bacteria | 2292 |
| 2 | LJNas_1000023 | 3300000546 | Bacteria | 20717 |
| 3 | JGI24752J21851_1005171 | 3300001976 | Unclassified | 1708 |
| 4 | JGI24737J22298_10022391 | 3300001990 | Bacteria | 2008 |
| 5 | JGI24743J22301_10006642 | 3300001991 | Bacteria | 1979 |
| 6 | JGI24745J21846_1002784 | 3300002073 | Unclassified | 1807 |
| 7 | JGI24748J21848_1010697 | 3300002074 | Bacteria | 1079 |
| 8 | JGI24749J21850_1002921 | 3300002076 | Bacteria | 2392 |
| 9 | JGI24034J26672_10003589 | 3300002239 | Bacteria | 2168 |
| 10 | JGI25406J46586_10006480 | 3300003203 | Bacteria | 5386 |
| 11 | JGI25406J46586_10036770 | 3300003203 | Bacteria | 1773 |
| 12 | Ga0065712_10144137 | 3300005290 | Unclassified | 1423 |
| 13 | Ga0065715_10237170 | 3300005293 | Unclassified | 1212 |
| 14 | Ga0070658_10000704 | 3300005327 | Bacteria | 28959 |
| 15 | Ga0070676_10000212 | 3300005328 | Bacteria | 24798 |
| 16 | Ga0070683_100001594 | 3300005329 | Bacteria | 17553 |
| 17 | Ga0070683_100087850 | 3300005329 | Bacteria | 2916 |
| 18 | Ga0070683_100285250 | 3300005329 | Bacteria | 1571 |
| 19 | Ga0070690_100000145 | 3300005330 | Bacteria | 35940 |
| 20 | Ga0070690_100002317 | 3300005330 | Bacteria | 10221 |
| 21 | Ga0070670_100000821 | 3300005331 | Bacteria | 24241 |
| 22 | Ga0070677_10000156 | 3300005333 | Bacteria | 23147 |
| 23 | Ga0068869_100000343 | 3300005334 | Bacteria | 24882 |
| 24 | Ga0068869_100018792 | 3300005334 | Bacteria | 4712 |
| 25 | Ga0070666_10000457 | 3300005335 | Bacteria | 24882 |
| 26 | Ga0068868_100001968 | 3300005338 | Bacteria | 14084 |
| 27 | Ga0070660_100000203 | 3300005339 | Bacteria | 39748 |
| 28 | Ga0070689_100000159 | 3300005340 | Bacteria | 39820 |
| 29 | Ga0070687_100000002 | 3300005343 | Bacteria | 76542 |
| 30 | Ga0070661_100000134 | 3300005344 | Bacteria | 62179 |
| 31 | Ga0070692_10015742 | 3300005345 | Bacteria | 3583 |
| 32 | Ga0070668_100000039 | 3300005347 | Bacteria | 79523 |
| 33 | Ga0070669_100000644 | 3300005353 | Bacteria | 25819 |
| 34 | Ga0070675_100000669 | 3300005354 | Bacteria | 23742 |
| 35 | Ga0070671_100009351 | 3300005355 | Bacteria | 7870 |
| 36 | Ga0070674_100000118 | 3300005356 | Bacteria | 36017 |
| 37 | Ga0070673_100007699 | 3300005364 | Bacteria | 7128 |
| 38 | Ga0070688_100000186 | 3300005365 | Bacteria | 32942 |
| 39 | Ga0070688_100259839 | 3300005365 | Bacteria | 1240 |
| 40 | Ga0070659_100000298 | 3300005366 | Bacteria | 38865 |
| 41 | Ga0070667_100002069 | 3300005367 | Bacteria | 17762 |
| 42 | Ga0070703_10007118 | 3300005406 | Bacteria | 3140 |
| 43 | Ga0070705_100000291 | 3300005440 | Bacteria | 29842 |
| 44 | Ga0070705_100276613 | 3300005440 | Unclassified | 1191 |
| 45 | Ga0070700_100004741 | 3300005441 | Bacteria | 7133 |
| 46 | Ga0070700_100387502 | 3300005441 | Unclassified | 1047 |
| 47 | Ga0070708_100006365 | 3300005445 | Bacteria | 9402 |
| 48 | Ga0070708_100009969 | 3300005445 | Bacteria | 7682 |
| 49 | Ga0070708_100050004 | 3300005445 | Bacteria | 3700 |
| 50 | Ga0070708_100179513 | 3300005445 | Bacteria | 1978 |
| 51 | Ga0070708_100255822 | 3300005445 | Bacteria | 1645 |
| 52 | Ga0070663_100000088 | 3300005455 | Bacteria | 41407 |
| 53 | Ga0070678_100001096 | 3300005456 | Bacteria | 14186 |
| 54 | Ga0070662_100000587 | 3300005457 | Bacteria | 22123 |
| 55 | Ga0070681_10181084 | 3300005458 | Bacteria | 2029 |
| 56 | Ga0068867_100000195 | 3300005459 | Bacteria | 40012 |
| 57 | Ga0070685_10001159 | 3300005466 | Bacteria | 14087 |
| 58 | Ga0070706_100000120 | 3300005467 | Bacteria | 95553 |
| 59 | Ga0070706_100063793 | 3300005467 | Unclassified | 3404 |
| 60 | Ga0070706_100103626 | 3300005467 | Bacteria | 2645 |
| 61 | Ga0070707_100000184 | 3300005468 | Bacteria | 61598 |
| 62 | Ga0070707_100116789 | 3300005468 | Unclassified | 2590 |
| 63 | Ga0070698_100017385 | 3300005471 | Bacteria | 7579 |
| 64 | Ga0070699_100000013 | 3300005518 | Bacteria | 241303 |
| 65 | Ga0070699_100003774 | 3300005518 | Bacteria | 13394 |
| 66 | Ga0070679_100160638 | 3300005530 | Unclassified | 2221 |
| 67 | Ga0070679_100235167 | 3300005530 | Bacteria | 1791 |
| 68 | Ga0070684_100009112 | 3300005535 | Bacteria | 7805 |
| 69 | Ga0070697_100009456 | 3300005536 | Bacteria | 7615 |
| 70 | Ga0070697_100014475 | 3300005536 | Bacteria | 6196 |
| 71 | Ga0070697_100126422 | 3300005536 | Bacteria | 2142 |
| 72 | Ga0070697_100146251 | 3300005536 | Archaea | 1990 |
| 73 | Ga0068853_100000362 | 3300005539 | Bacteria | 31305 |
| 74 | Ga0070672_100000194 | 3300005543 | Bacteria | 33633 |
| 75 | Ga0070686_100000201 | 3300005544 | Bacteria | 41381 |
| 76 | Ga0070695_100189468 | 3300005545 | Bacteria | 1463 |
| 77 | Ga0070696_100000142 | 3300005546 | Bacteria | 39428 |
| 78 | Ga0070696_100006969 | 3300005546 | Bacteria | 7541 |
| 79 | Ga0070696_100261734 | 3300005546 | Unclassified | 1312 |
| 80 | Ga0070693_100001963 | 3300005547 | Bacteria | 9418 |
| 81 | Ga0070693_100022805 | 3300005547 | Bacteria | 3336 |
| 82 | Ga0070665_100003421 | 3300005548 | Bacteria | 16957 |
| 83 | Ga0070704_100278258 | 3300005549 | Bacteria | 1385 |
| 84 | Ga0070704_100374409 | 3300005549 | Bacteria | 1208 |
| 85 | Ga0068855_100000383 | 3300005563 | Bacteria | 54598 |
| 86 | Ga0070664_100000502 | 3300005564 | Bacteria | 29641 |
| 87 | Ga0070664_100084149 | 3300005564 | Bacteria | 2745 |
| 88 | Ga0068857_100000362 | 3300005577 | Bacteria | 31675 |
| 89 | Ga0068854_100000520 | 3300005578 | Bacteria | 23365 |
| 90 | Ga0068856_100004741 | 3300005614 | Bacteria | 13498 |
| 91 | Ga0068852_100000211 | 3300005616 | Bacteria | 39692 |
| 92 | Ga0068859_100001182 | 3300005617 | Bacteria | 26638 |
| 93 | Ga0068859_100621812 | 3300005617 | Bacteria | 1173 |
| 94 | Ga0068864_100000579 | 3300005618 | Bacteria | 31124 |
| 95 | Ga0068866_10000131 | 3300005718 | Bacteria | 33190 |
| 96 | Ga0068861_100000362 | 3300005719 | Bacteria | 26031 |
| 97 | Ga0068851_10000114 | 3300005834 | Bacteria | 42839 |
| 98 | Ga0068870_10000278 | 3300005840 | Bacteria | 18928 |
| 99 | Ga0068863_100000473 | 3300005841 | Bacteria | 41129 |
| 100 | Ga0068863_100115036 | 3300005841 | Bacteria | 2563 |
| 101 | Ga0068863_100151877 | 3300005841 | Bacteria | 2216 |
| 102 | Ga0068863_100201614 | 3300005841 | Bacteria | 1914 |
| 103 | Ga0068858_100002171 | 3300005842 | Bacteria | 19907 |
| 104 | Ga0068860_100000977 | 3300005843 | Bacteria | 31691 |
| 105 | Ga0068862_100000870 | 3300005844 | Bacteria | 29442 |
| 106 | Ga0081540_1000033 | 3300005983 | Bacteria | 142902 |
| 107 | Ga0081540_1000160 | 3300005983 | Bacteria | 69415 |
| 108 | Ga0081540_1000605 | 3300005983 | Bacteria | 34193 |
| 109 | Ga0081539_10000505 | 3300005985 | Bacteria | 81474 |
| 110 | Ga0081539_10003368 | 3300005985 | Bacteria | 19786 |
| 111 | Ga0081539_10097594 | 3300005985 | Unclassified | 1504 |
| 112 | Ga0070717_10016364 | 3300006028 | Bacteria | 5749 |
| 113 | Ga0070717_10332687 | 3300006028 | Bacteria | 1355 |
| 114 | Ga0097621_100000104 | 3300006237 | Bacteria | 47633 |
| 115 | Ga0097621_100218262 | 3300006237 | Bacteria | 1661 |
| 116 | Ga0068871_100000502 | 3300006358 | Bacteria | 26699 |
| 117 | Ga0075428_100190057 | 3300006844 | Bacteria | 2221 |
| 118 | Ga0075433_10602710 | 3300006852 | Bacteria | 964 |
| 119 | Ga0075434_100092837 | 3300006871 | Bacteria | 3021 |
| 120 | Ga0075434_100114915 | 3300006871 | Bacteria | 2704 |
| 121 | Ga0075434_100486087 | 3300006871 | Bacteria | 1255 |
| 122 | Ga0068865_100000163 | 3300006881 | Bacteria | 36568 |
| 123 | Ga0097620_100001182 | 3300006931 | Bacteria | 26638 |
| 124 | Ga0097620_100621776 | 3300006931 | Bacteria | 1173 |
| 125 | Ga0075435_100146004 | 3300007076 | Unclassified | 1987 |
| 126 | Ga0099794_10007096 | 3300007265 | Unclassified | 4580 |
| 127 | Ga0099794_10011186 | 3300007265 | Bacteria | 3836 |
| 128 | Ga0099794_10018656 | 3300007265 | Bacteria | 3114 |
| 129 | Ga0099794_10058424 | 3300007265 | Bacteria | 1870 |
| 130 | Ga0105240_10003863 | 3300009093 | Bacteria | 23143 |
| 131 | Ga0105245_10000381 | 3300009098 | Bacteria | 41175 |
| 132 | Ga0105247_10000449 | 3300009101 | Bacteria | 34921 |
| 133 | Ga0114129_10009063 | 3300009147 | Bacteria | 14183 |
| 134 | Ga0114129_10037669 | 3300009147 | Bacteria | 6826 |
| 135 | Ga0114129_10554881 | 3300009147 | Unclassified | 1493 |
| 136 | Ga0105243_10002984 | 3300009148 | Bacteria | 13986 |
| 137 | Ga0105241_10000925 | 3300009174 | Bacteria | 22237 |
| 138 | Ga0105241_10079865 | 3300009174 | Plasmid | 2558 |
| 139 | Ga0105242_10001510 | 3300009176 | Bacteria | 18293 |
| 140 | Ga0105248_10000704 | 3300009177 | Bacteria | 37779 |
| 141 | Ga0105248_10495382 | 3300009177 | Bacteria | 1377 |
| 142 | Ga0105237_10000031 | 3300009545 | Bacteria | 197346 |
| 143 | Ga0105238_10001175 | 3300009551 | Bacteria | 26315 |
| 144 | Ga0105249_10000604 | 3300009553 | Bacteria | 32731 |
| 145 | Ga0105249_10109223 | 3300009553 | Bacteria | 2612 |
| 146 | Ga0105239_10000220 | 3300010375 | Bacteria | 84136 |
| 147 | Ga0105246_10004293 | 3300011119 | Bacteria | 8668 |
| 148 | Ga0157373_10012514 | 3300013100 | Bacteria | 6236 |
| 149 | Ga0157371_10000246 | 3300013102 | Bacteria | 76861 |
| 150 | Ga0157369_10000669 | 3300013105 | Bacteria | 44175 |
| 151 | Ga0157374_10000295 | 3300013296 | Bacteria | 46020 |
| 152 | Ga0157374_10587387 | 3300013296 | Unclassified | 1123 |
| 153 | Ga0157378_10003702 | 3300013297 | Bacteria | 13564 |
| 154 | Ga0163162_10000200 | 3300013306 | Bacteria | 55467 |
| 155 | Ga0157372_10007285 | 3300013307 | Bacteria | 11780 |
| 156 | Ga0157375_10001123 | 3300013308 | Bacteria | 23168 |
| 157 | Ga0163163_10001685 | 3300014325 | Bacteria | 18655 |
| 158 | Ga0182008_10048008 | 3300014497 | Unclassified | 2120 |
| 159 | Ga0157377_10000219 | 3300014745 | Bacteria | 30327 |
| 160 | Ga0157379_10000625 | 3300014968 | Bacteria | 28539 |
| 161 | Ga0157376_10000284 | 3300014969 | Bacteria | 34216 |
| 162 | Ga0157376_10461130 | 3300014969 | Bacteria | 1242 |
| 163 | Ga0163161_10028173 | 3300017792 | Bacteria | 3987 |
| 164 | Ga0213876_10000041 | 3300021384 | Bacteria | 169380 |
| 165 | Ga0207697_10001984 | 3300025315 | Bacteria | 10857 |
| 166 | Ga0207656_10000622 | 3300025321 | Bacteria | 11613 |
| 167 | Ga0207653_10000133 | 3300025885 | Bacteria | 53038 |
| 168 | Ga0207682_10000658 | 3300025893 | Bacteria | 16139 |
| 169 | Ga0207642_10000126 | 3300025899 | Bacteria | 21042 |
| 170 | Ga0207710_10007391 | 3300025900 | Bacteria | 4654 |
| 171 | Ga0207688_10000180 | 3300025901 | Bacteria | 28077 |
| 172 | Ga0207680_10001578 | 3300025903 | Bacteria | 10735 |
| 173 | Ga0207647_10026796 | 3300025904 | Bacteria | 3765 |
| 174 | Ga0207645_10000027 | 3300025907 | Bacteria | 96143 |
| 175 | Ga0207643_10000005 | 3300025908 | Bacteria | 182148 |
| 176 | Ga0207705_10007267 | 3300025909 | Bacteria | 8148 |
| 177 | Ga0207684_10000075 | 3300025910 | Bacteria | 183366 |
| 178 | Ga0207684_10087285 | 3300025910 | Bacteria | 2658 |
| 179 | Ga0207684_10155029 | 3300025910 | Unclassified | 1971 |
| 180 | Ga0207654_10006842 | 3300025911 | Bacteria | 5739 |
| 181 | Ga0207654_10090900 | 3300025911 | Unclassified | 1860 |
| 182 | Ga0207707_10150081 | 3300025912 | Bacteria | 2038 |
| 183 | Ga0207695_10013286 | 3300025913 | Bacteria | 9823 |
| 184 | Ga0207671_10000265 | 3300025914 | Bacteria | 78548 |
| 185 | Ga0207662_10000075 | 3300025918 | Bacteria | 45170 |
| 186 | Ga0207657_10000029 | 3300025919 | Bacteria | 137747 |
| 187 | Ga0207649_10000386 | 3300025920 | Bacteria | 33017 |
| 188 | Ga0207652_10067146 | 3300025921 | Bacteria | 3109 |
| 189 | Ga0207646_10015800 | 3300025922 | Bacteria | 7109 |
| 190 | Ga0207681_10000063 | 3300025923 | Bacteria | 99129 |
| 191 | Ga0207694_10010542 | 3300025924 | Bacteria | 6971 |
| 192 | Ga0207650_10000232 | 3300025925 | Bacteria | 62024 |
| 193 | Ga0207659_10000243 | 3300025926 | Bacteria | 33179 |
| 194 | Ga0207687_10002959 | 3300025927 | Bacteria | 11512 |
| 195 | Ga0207644_10001285 | 3300025931 | Bacteria | 16163 |
| 196 | Ga0207690_10001131 | 3300025932 | Bacteria | 17002 |
| 197 | Ga0207706_10000231 | 3300025933 | Bacteria | 60951 |
| 198 | Ga0207686_10000823 | 3300025934 | Bacteria | 18934 |
| 199 | Ga0207686_10162899 | 3300025934 | Bacteria | 1565 |
| 200 | Ga0207709_10017429 | 3300025935 | Plasmid | 4009 |
| 201 | Ga0207709_10080621 | 3300025935 | Bacteria | 2096 |
| 202 | Ga0207670_10001311 | 3300025936 | Bacteria | 13135 |
| 203 | Ga0207669_10004745 | 3300025937 | Bacteria | 6019 |
| 204 | Ga0207704_10001151 | 3300025938 | Bacteria | 11764 |
| 205 | Ga0207691_10000068 | 3300025940 | Bacteria | 84243 |
| 206 | Ga0207711_10000068 | 3300025941 | Bacteria | 116544 |
| 207 | Ga0207689_10000375 | 3300025942 | Bacteria | 42073 |
| 208 | Ga0207689_10042776 | 3300025942 | Bacteria | 3746 |
| 209 | Ga0207661_10004322 | 3300025944 | Bacteria | 9944 |
| 210 | Ga0207661_10235737 | 3300025944 | Bacteria | 1622 |
| 211 | Ga0207661_10423219 | 3300025944 | Bacteria | 1210 |
| 212 | Ga0207679_10000135 | 3300025945 | Bacteria | 60279 |
| 213 | Ga0207679_10059136 | 3300025945 | Bacteria | 2843 |
| 214 | Ga0207667_10001908 | 3300025949 | Bacteria | 26171 |
| 215 | Ga0207651_10000040 | 3300025960 | Bacteria | 62487 |
| 216 | Ga0207712_10000187 | 3300025961 | Bacteria | 64116 |
| 217 | Ga0207712_10307108 | 3300025961 | Bacteria | 1304 |
| 218 | Ga0207668_10001124 | 3300025972 | Bacteria | 15955 |
| 219 | Ga0207640_10000399 | 3300025981 | Bacteria | 27562 |
| 220 | Ga0207658_10000246 | 3300025986 | Bacteria | 56484 |
| 221 | Ga0207677_10000018 | 3300026023 | Bacteria | 139501 |
| 222 | Ga0207703_10000112 | 3300026035 | Bacteria | 96518 |
| 223 | Ga0207639_10000324 | 3300026041 | Bacteria | 33242 |
| 224 | Ga0207678_10000349 | 3300026067 | Bacteria | 41962 |
| 225 | Ga0207708_10007589 | 3300026075 | Bacteria | 8025 |
| 226 | Ga0207641_10000329 | 3300026088 | Bacteria | 58136 |
| 227 | Ga0207641_10105130 | 3300026088 | Bacteria | 2493 |
| 228 | Ga0207641_10376561 | 3300026088 | Bacteria | 1358 |
| 229 | Ga0207648_10001848 | 3300026089 | Bacteria | 23168 |
| 230 | Ga0207676_10000289 | 3300026095 | Bacteria | 43323 |
| 231 | Ga0207674_10000304 | 3300026116 | Bacteria | 62363 |
| 232 | Ga0207675_100000002 | 3300026118 | Bacteria | 325956 |
| 233 | Ga0207675_100096464 | 3300026118 | Bacteria | 2784 |
| 234 | Ga0207683_10000070 | 3300026121 | Bacteria | 78648 |
| 235 | Ga0207698_10000132 | 3300026142 | Bacteria | 46951 |
| 236 | Ga0209588_1008882 | 3300027671 | Bacteria | 2989 |
| 237 | Ga0209588_1035050 | 3300027671 | Bacteria | 1613 |
| 238 | Ga0209588_1050423 | 3300027671 | Bacteria | 1346 |
| 239 | Ga0209588_1077705 | 3300027671 | Unclassified | 1073 |
| 240 | Ga0268266_10000139 | 3300028379 | Bacteria | 140538 |
| 241 | Ga0268265_10000148 | 3300028380 | Bacteria | 86667 |
| 242 | Ga0268264_10000312 | 3300028381 | Bacteria | 78042 |
| 243 | Ga0268264_10148889 | 3300028381 | Bacteria | 2096 |
| 244 | Ga0307517_10112577 | 3300028786 | Bacteria | 2060 |
| 245 | Ga0307515_10012313 | 3300028794 | Bacteria | 16095 |
| 246 | Ga0265332_10064101 | 3300031238 | Bacteria | 1569 |
| 247 | Ga0307509_10018062 | 3300031507 | Bacteria | 8098 |
| 248 | Ga0307509_10064053 | 3300031507 | Bacteria | 3869 |
| 249 | Ga0307508_10215736 | 3300031616 | Bacteria | 1519 |
| 250 | Ga0307508_10295574 | 3300031616 | Bacteria | 1213 |
| 251 | Ga0307507_10107677 | 3300033179 | Bacteria | 2296 |
| 252 | Ga0373941_0015448 | 3300035115 | Bacteria | 2059 |
| 253 | Ga0373956_0178615 | 3300035119 | Unclassified | 1003 |
| 254 | Ga0373961_0000008 | 3300035241 | Bacteria | 139095 |
| 255 | Ga0436364_1298933 | 3300037853 | Bacteria | 1590 |
| 256 | Ga0436365_1476328 | 3300039437 | Bacteria | 212791 |
| 257 | Ga0436360_1038520 | 3300039438 | Unclassified | 968 |
| 258 | Ga0436361_0453030 | 3300039447 | Unclassified | 1444 |
| 259 | Ga0436361_0600523 | 3300039447 | Bacteria | 14642 |
| 260 | Ga0436361_0661927 | 3300039447 | Bacteria | 15656 |
| 261 | Ga0436363_1085495 | 3300039450 | Bacteria | 3083 |
| 262 | Ga0436363_1449302 | 3300039450 | Bacteria | 1588 |
| 263 | Ga0436362_1201345 | 3300039453 | Bacteria | 1359 |
| 264 | Ga0439455_0005474 | 3300042012 | Bacteria | 2582 |
| 265 | Ga0451577_0222426 | 3300042876 | Bacteria | 1706 |
| 266 | Ga0453683_0013081 | 3300044673 | Bacteria | 5427 |
| 267 | Ga0496101_0121676 | 3300048904 | Bacteria | 1974 |
| 268 | Ga0496102_0001277 | 3300048905 | Bacteria | 22718 |
| 269 | Ga0496105_0588314 | 3300048908 | Bacteria | 865 |
| 270 | Ga0496106_0001048 | 3300048909 | Bacteria | 20344 |
| 271 | Ga0496108_0022027 | 3300048911 | Bacteria | 5239 |
| 272 | Ga0496109_0001513 | 3300048912 | Bacteria | 19335 |
| 273 | Ga0496112_0000162 | 3300048915 | Bacteria | 42364 |
| 274 | Ga0496112_0008145 | 3300048915 | Bacteria | 9365 |
| 275 | Ga0496113_0355936 | 3300048916 | Unclassified | 1174 |
| 276 | nmdc:mga05p37_1311_c1 | 3300050507 | Bacteria | 28942 |
| 277 | nmdc:mga05p37_135375_c1 | 3300050507 | Bacteria | 3022 |
| 278 | nmdc:mga09592_59867_c1 | 3300050508 | Unclassified | 3219 |
| 279 | nmdc:mga0n895_86325_c1 | 3300050512 | Bacteria | 3134 |
| 280 | Ga0500578_0079670 | 3300053086 | Bacteria | 2084 |
| 281 | Ga0500646_0018239 | 3300053090 | Bacteria | 1846 |
| 282 | Ga0500566_0001777 | 3300053094 | Bacteria | 12666 |
| 283 | Ga0500640_000294 | 3300053095 | Bacteria | 11263 |
| 284 | Ga0500554_000059 | 3300053102 | Bacteria | 19672 |
| 285 | Ga0500595_000356 | 3300053119 | Bacteria | 29768 |
| 286 | Ga0500614_000828 | 3300053123 | Bacteria | 7798 |
| 287 | Ga0500614_002453 | 3300053123 | Bacteria | 4134 |
| 288 | Ga0500559_0005590 | 3300053136 | Bacteria | 5767 |
| 289 | Ga0500638_081581 | 3300053162 | Bacteria | 1535 |
| 290 | Ga0500636_0206077 | 3300053177 | Unclassified | 1036 |
| 291 | Ga0500637_0127467 | 3300053178 | Bacteria | 1476 |
| 292 | Ga0500637_0144506 | 3300053178 | Bacteria | 1376 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035115 | Ga0373941_0015448 | Ga0373941_0015448_412_1287 | 208 |
| 2 | 3300039447 | Ga0436361_0453030 | Ga0436361_0453030_490_1359 | 208 |
| 3 | 3300039438 | Ga0436360_1038520 | Ga0436360_1038520_28_879 | 222 |
| 4 | 3300039447 | Ga0436361_0600523 | Ga0436361_0600523_9842_10669 | 222 |
| 5 | 3300039447 | Ga0436361_0661927 | Ga0436361_0661927_10162_11010 | 222 |
| 6 | 3300039453 | Ga0436362_1201345 | Ga0436362_1201345_240_1091 | 222 |
| 7 | 3300005334 | Ga0068869_100018792 | Ga0068869_1000187924 | 224 |
| 8 | 3300005841 | Ga0068863_100115036 | Ga0068863_1001150362 | 224 |
| 9 | 3300006871 | Ga0075434_100092837 | Ga0075434_1000928372 | 224 |
| 10 | 3300009147 | Ga0114129_10009063 | Ga0114129_100090637 | 224 |
| 11 | 3300025934 | Ga0207686_10162899 | Ga0207686_101628992 | 224 |
| 12 | 3300025942 | Ga0207689_10042776 | Ga0207689_100427763 | 224 |
| 13 | 3300026088 | Ga0207641_10105130 | Ga0207641_101051302 | 224 |
| 14 | 3300026118 | Ga0207675_100096464 | Ga0207675_1000964642 | 224 |
| 15 | 3300028381 | Ga0268264_10148889 | Ga0268264_101488893 | 224 |
| 16 | 3300050507 | nmdc:mga05p37_135375_c1 | nmdc:mga05p37_135375_c1_809_1648 | 224 |
| 17 | 3300050512 | nmdc:mga0n895_86325_c1 | nmdc:mga0n895_86325_c1_2046_2885 | 224 |
| 18 | 3300000546 | LJNas_1000023 | LJNas_100002312 | 225 |
| 19 | 3300003203 | JGI25406J46586_10006480 | JGI25406J46586_100064802 | 225 |
| 20 | 3300003203 | JGI25406J46586_10036770 | JGI25406J46586_100367701 | 225 |
| 21 | 3300005329 | Ga0070683_100087850 | Ga0070683_1000878502 | 225 |
| 22 | 3300005329 | Ga0070683_100285250 | Ga0070683_1002852502 | 225 |
| 23 | 3300005330 | Ga0070690_100002317 | Ga0070690_1000023176 | 225 |
| 24 | 3300005365 | Ga0070688_100259839 | Ga0070688_1002598391 | 225 |
| 25 | 3300005406 | Ga0070703_10007118 | Ga0070703_100071182 | 225 |
| 26 | 3300005440 | Ga0070705_100276613 | Ga0070705_1002766132 | 225 |
| 27 | 3300005441 | Ga0070700_100387502 | Ga0070700_1003875021 | 225 |
| 28 | 3300005445 | Ga0070708_100006365 | Ga0070708_1000063654 | 225 |
| 29 | 3300005445 | Ga0070708_100009969 | Ga0070708_1000099695 | 225 |
| 30 | 3300005445 | Ga0070708_100050004 | Ga0070708_1000500043 | 225 |
| 31 | 3300005445 | Ga0070708_100179513 | Ga0070708_1001795132 | 225 |
| 32 | 3300005445 | Ga0070708_100255822 | Ga0070708_1002558221 | 225 |
| 33 | 3300005467 | Ga0070706_100000120 | Ga0070706_1000001202 | 225 |
| 34 | 3300005467 | Ga0070706_100063793 | Ga0070706_1000637932 | 225 |
| 35 | 3300005467 | Ga0070706_100103626 | Ga0070706_1001036262 | 225 |
| 36 | 3300005468 | Ga0070707_100000184 | Ga0070707_10000018452 | 225 |
| 37 | 3300005468 | Ga0070707_100116789 | Ga0070707_1001167892 | 225 |
| 38 | 3300005471 | Ga0070698_100017385 | Ga0070698_1000173855 | 225 |
| 39 | 3300005518 | Ga0070699_100000013 | Ga0070699_100000013173 | 225 |
| 40 | 3300005518 | Ga0070699_100003774 | Ga0070699_10000377412 | 225 |
| 41 | 3300005530 | Ga0070679_100160638 | Ga0070679_1001606382 | 225 |
| 42 | 3300005536 | Ga0070697_100009456 | Ga0070697_1000094568 | 225 |
| 43 | 3300005536 | Ga0070697_100014475 | Ga0070697_1000144751 | 225 |
| 44 | 3300005536 | Ga0070697_100126422 | Ga0070697_1001264223 | 225 |
| 45 | 3300005536 | Ga0070697_100146251 | Ga0070697_1001462512 | 225 |
| 46 | 3300005545 | Ga0070695_100189468 | Ga0070695_1001894682 | 225 |
| 47 | 3300005546 | Ga0070696_100000142 | Ga0070696_10000014223 | 225 |
| 48 | 3300005546 | Ga0070696_100261734 | Ga0070696_1002617342 | 225 |
| 49 | 3300005547 | Ga0070693_100001963 | Ga0070693_1000019638 | 225 |
| 50 | 3300005549 | Ga0070704_100374409 | Ga0070704_1003744092 | 225 |
| 51 | 3300005617 | Ga0068859_100621812 | Ga0068859_1006218122 | 225 |
| 52 | 3300005841 | Ga0068863_100151877 | Ga0068863_1001518773 | 225 |
| 53 | 3300005841 | Ga0068863_100201614 | Ga0068863_1002016142 | 225 |
| 54 | 3300005985 | Ga0081539_10000505 | Ga0081539_1000050511 | 225 |
| 55 | 3300005985 | Ga0081539_10003368 | Ga0081539_1000336819 | 225 |
| 56 | 3300005985 | Ga0081539_10097594 | Ga0081539_100975942 | 225 |
| 57 | 3300006028 | Ga0070717_10016364 | Ga0070717_100163643 | 225 |
| 58 | 3300006028 | Ga0070717_10332687 | Ga0070717_103326872 | 225 |
| 59 | 3300006844 | Ga0075428_100190057 | Ga0075428_1001900573 | 225 |
| 60 | 3300006852 | Ga0075433_10602710 | Ga0075433_106027101 | 225 |
| 61 | 3300006871 | Ga0075434_100114915 | Ga0075434_1001149152 | 225 |
| 62 | 3300006871 | Ga0075434_100486087 | Ga0075434_1004860872 | 225 |
| 63 | 3300006931 | Ga0097620_100621776 | Ga0097620_1006217762 | 225 |
| 64 | 3300007076 | Ga0075435_100146004 | Ga0075435_1001460042 | 225 |
| 65 | 3300007265 | Ga0099794_10007096 | Ga0099794_100070964 | 225 |
| 66 | 3300007265 | Ga0099794_10011186 | Ga0099794_100111863 | 225 |
| 67 | 3300007265 | Ga0099794_10018656 | Ga0099794_100186563 | 225 |
| 68 | 3300007265 | Ga0099794_10058424 | Ga0099794_100584242 | 225 |
| 69 | 3300009147 | Ga0114129_10037669 | Ga0114129_100376693 | 225 |
| 70 | 3300009147 | Ga0114129_10554881 | Ga0114129_105548812 | 225 |
| 71 | 3300009174 | Ga0105241_10079865 | Ga0105241_100798651 | 225 |
| 72 | 3300009177 | Ga0105248_10495382 | Ga0105248_104953821 | 225 |
| 73 | 3300009553 | Ga0105249_10109223 | Ga0105249_101092233 | 225 |
| 74 | 3300013296 | Ga0157374_10587387 | Ga0157374_105873871 | 225 |
| 75 | 3300021384 | Ga0213876_10000041 | Ga0213876_1000004125 | 225 |
| 76 | 3300025885 | Ga0207653_10000133 | Ga0207653_1000013351 | 225 |
| 77 | 3300025910 | Ga0207684_10000075 | Ga0207684_1000007578 | 225 |
| 78 | 3300025910 | Ga0207684_10087285 | Ga0207684_100872852 | 225 |
| 79 | 3300025910 | Ga0207684_10155029 | Ga0207684_101550292 | 225 |
| 80 | 3300025911 | Ga0207654_10090900 | Ga0207654_100909001 | 225 |
| 81 | 3300025922 | Ga0207646_10015800 | Ga0207646_100158001 | 225 |
| 82 | 3300025935 | Ga0207709_10017429 | Ga0207709_100174295 | 225 |
| 83 | 3300025944 | Ga0207661_10235737 | Ga0207661_102357372 | 225 |
| 84 | 3300025944 | Ga0207661_10423219 | Ga0207661_104232192 | 225 |
| 85 | 3300025961 | Ga0207712_10307108 | Ga0207712_103071081 | 225 |
| 86 | 3300026088 | Ga0207641_10376561 | Ga0207641_103765612 | 225 |
| 87 | 3300027671 | Ga0209588_1008882 | Ga0209588_10088823 | 225 |
| 88 | 3300027671 | Ga0209588_1035050 | Ga0209588_10350502 | 225 |
| 89 | 3300027671 | Ga0209588_1050423 | Ga0209588_10504232 | 225 |
| 90 | 3300027671 | Ga0209588_1077705 | Ga0209588_10777052 | 225 |
| 91 | 3300028786 | Ga0307517_10112577 | Ga0307517_101125773 | 225 |
| 92 | 3300028794 | Ga0307515_10012313 | Ga0307515_100123136 | 225 |
| 93 | 3300031238 | Ga0265332_10064101 | Ga0265332_100641012 | 225 |
| 94 | 3300031507 | Ga0307509_10018062 | Ga0307509_100180626 | 225 |
| 95 | 3300031507 | Ga0307509_10064053 | Ga0307509_100640531 | 225 |
| 96 | 3300031616 | Ga0307508_10215736 | Ga0307508_102157362 | 225 |
| 97 | 3300031616 | Ga0307508_10295574 | Ga0307508_102955741 | 225 |
| 98 | 3300033179 | Ga0307507_10107677 | Ga0307507_101076772 | 225 |
| 99 | 3300035119 | Ga0373956_0178615 | Ga0373956_0178615_120_992 | 225 |
| 100 | 3300035241 | Ga0373961_0000008 | Ga0373961_0000008_77728_78621 | 225 |
| 101 | 3300037853 | Ga0436364_1298933 | Ga0436364_1298933_424_1290 | 225 |
| 102 | 3300039437 | Ga0436365_1476328 | Ga0436365_1476328_71084_71968 | 225 |
| 103 | 3300039450 | Ga0436363_1085495 | Ga0436363_1085495_1371_2231 | 225 |
| 104 | 3300039450 | Ga0436363_1449302 | Ga0436363_1449302_516_1274 | 225 |
| 105 | 3300042876 | Ga0451577_0222426 | Ga0451577_0222426_306_1190 | 225 |
| 106 | 3300044673 | Ga0453683_0013081 | Ga0453683_0013081_3748_4632 | 225 |
| 107 | 3300048908 | Ga0496105_0588314 | Ga0496105_0588314_51_809 | 225 |
| 108 | 3300048915 | Ga0496112_0008145 | Ga0496112_0008145_4319_5179 | 225 |
| 109 | 3300050507 | nmdc:mga05p37_1311_c1 | nmdc:mga05p37_1311_c1_16971_17729 | 225 |
| 110 | 3300050508 | nmdc:mga09592_59867_c1 | nmdc:mga09592_59867_c1_66_932 | 225 |
| 111 | 3300053086 | Ga0500578_0079670 | Ga0500578_0079670_222_1070 | 225 |
| 112 | 3300053090 | Ga0500646_0018239 | Ga0500646_0018239_973_1731 | 225 |
| 113 | 3300053094 | Ga0500566_0001777 | Ga0500566_0001777_10187_11029 | 225 |
| 114 | 3300053095 | Ga0500640_000294 | Ga0500640_000294_2217_3059 | 225 |
| 115 | 3300053102 | Ga0500554_000059 | Ga0500554_000059_17081_17923 | 225 |
| 116 | 3300053119 | Ga0500595_000356 | Ga0500595_000356_7756_8598 | 225 |
| 117 | 3300053123 | Ga0500614_000828 | Ga0500614_000828_5225_6067 | 225 |
| 118 | 3300053123 | Ga0500614_002453 | Ga0500614_002453_1998_2876 | 225 |
| 119 | 3300053136 | Ga0500559_0005590 | Ga0500559_0005590_1027_1869 | 225 |
| 120 | 3300053162 | Ga0500638_081581 | Ga0500638_081581_260_1138 | 225 |
| 121 | 3300053177 | Ga0500636_0206077 | Ga0500636_0206077_15_863 | 225 |
| 122 | 3300053178 | Ga0500637_0127467 | Ga0500637_0127467_177_1055 | 225 |
| 123 | 3300053178 | Ga0500637_0144506 | Ga0500637_0144506_151_1050 | 225 |
| 124 | 2162886012 | MBSR1b_contig_2086237 | MBSR1b_0411.00005350 | 226 |
| 125 | 3300001976 | JGI24752J21851_1005171 | JGI24752J21851_10051713 | 226 |
| 126 | 3300001990 | JGI24737J22298_10022391 | JGI24737J22298_100223912 | 226 |
| 127 | 3300001991 | JGI24743J22301_10006642 | JGI24743J22301_100066423 | 226 |
| 128 | 3300002073 | JGI24745J21846_1002784 | JGI24745J21846_10027843 | 226 |
| 129 | 3300002074 | JGI24748J21848_1010697 | JGI24748J21848_10106972 | 226 |
| 130 | 3300002076 | JGI24749J21850_1002921 | JGI24749J21850_10029213 | 226 |
| 131 | 3300002239 | JGI24034J26672_10003589 | JGI24034J26672_100035892 | 226 |
| 132 | 3300005290 | Ga0065712_10144137 | Ga0065712_101441371 | 226 |
| 133 | 3300005293 | Ga0065715_10237170 | Ga0065715_102371702 | 226 |
| 134 | 3300005327 | Ga0070658_10000704 | Ga0070658_1000070429 | 226 |
| 135 | 3300005328 | Ga0070676_10000212 | Ga0070676_1000021216 | 226 |
| 136 | 3300005329 | Ga0070683_100001594 | Ga0070683_1000015945 | 226 |
| 137 | 3300005330 | Ga0070690_100000145 | Ga0070690_10000014529 | 226 |
| 138 | 3300005331 | Ga0070670_100000821 | Ga0070670_10000082117 | 226 |
| 139 | 3300005333 | Ga0070677_10000156 | Ga0070677_100001569 | 226 |
| 140 | 3300005334 | Ga0068869_100000343 | Ga0068869_10000034316 | 226 |
| 141 | 3300005335 | Ga0070666_10000457 | Ga0070666_1000045716 | 226 |
| 142 | 3300005338 | Ga0068868_100001968 | Ga0068868_10000196812 | 226 |
| 143 | 3300005339 | Ga0070660_100000203 | Ga0070660_10000020317 | 226 |
| 144 | 3300005340 | Ga0070689_100000159 | Ga0070689_10000015930 | 226 |
| 145 | 3300005343 | Ga0070687_100000002 | Ga0070687_10000000242 | 226 |
| 146 | 3300005344 | Ga0070661_100000134 | Ga0070661_10000013442 | 226 |
| 147 | 3300005345 | Ga0070692_10015742 | Ga0070692_100157422 | 226 |
| 148 | 3300005347 | Ga0070668_100000039 | Ga0070668_10000003930 | 226 |
| 149 | 3300005353 | Ga0070669_100000644 | Ga0070669_10000064412 | 226 |
| 150 | 3300005354 | Ga0070675_100000669 | Ga0070675_10000066912 | 226 |
| 151 | 3300005355 | Ga0070671_100009351 | Ga0070671_1000093514 | 226 |
| 152 | 3300005356 | Ga0070674_100000118 | Ga0070674_10000011827 | 226 |
| 153 | 3300005364 | Ga0070673_100007699 | Ga0070673_1000076996 | 226 |
| 154 | 3300005365 | Ga0070688_100000186 | Ga0070688_1000001869 | 226 |
| 155 | 3300005366 | Ga0070659_100000298 | Ga0070659_10000029816 | 226 |
| 156 | 3300005367 | Ga0070667_100002069 | Ga0070667_10000206912 | 226 |
| 157 | 3300005440 | Ga0070705_100000291 | Ga0070705_10000029134 | 226 |
| 158 | 3300005441 | Ga0070700_100004741 | Ga0070700_1000047418 | 226 |
| 159 | 3300005455 | Ga0070663_100000088 | Ga0070663_10000008829 | 226 |
| 160 | 3300005456 | Ga0070678_100001096 | Ga0070678_1000010963 | 226 |
| 161 | 3300005457 | Ga0070662_100000587 | Ga0070662_10000058712 | 226 |
| 162 | 3300005458 | Ga0070681_10181084 | Ga0070681_101810842 | 226 |
| 163 | 3300005459 | Ga0068867_100000195 | Ga0068867_10000019517 | 226 |
| 164 | 3300005466 | Ga0070685_10001159 | Ga0070685_100011593 | 226 |
| 165 | 3300005530 | Ga0070679_100235167 | Ga0070679_1002351672 | 226 |
| 166 | 3300005535 | Ga0070684_100009112 | Ga0070684_1000091123 | 226 |
| 167 | 3300005539 | Ga0068853_100000362 | Ga0068853_10000036224 | 226 |
| 168 | 3300005543 | Ga0070672_100000194 | Ga0070672_10000019424 | 226 |
| 169 | 3300005544 | Ga0070686_100000201 | Ga0070686_10000020120 | 226 |
| 170 | 3300005546 | Ga0070696_100006969 | Ga0070696_1000069693 | 226 |
| 171 | 3300005547 | Ga0070693_100022805 | Ga0070693_1000228053 | 226 |
| 172 | 3300005548 | Ga0070665_100003421 | Ga0070665_10000342112 | 226 |
| 173 | 3300005549 | Ga0070704_100278258 | Ga0070704_1002782582 | 226 |
| 174 | 3300005563 | Ga0068855_100000383 | Ga0068855_10000038348 | 226 |
| 175 | 3300005564 | Ga0070664_100000502 | Ga0070664_1000005025 | 226 |
| 176 | 3300005564 | Ga0070664_100084149 | Ga0070664_1000841493 | 226 |
| 177 | 3300005577 | Ga0068857_100000362 | Ga0068857_10000036226 | 226 |
| 178 | 3300005578 | Ga0068854_100000520 | Ga0068854_10000052010 | 226 |
| 179 | 3300005614 | Ga0068856_100004741 | Ga0068856_1000047415 | 226 |
| 180 | 3300005616 | Ga0068852_100000211 | Ga0068852_10000021116 | 226 |
| 181 | 3300005617 | Ga0068859_100001182 | Ga0068859_1000011822 | 226 |
| 182 | 3300005618 | Ga0068864_100000579 | Ga0068864_10000057930 | 226 |
| 183 | 3300005718 | Ga0068866_10000131 | Ga0068866_1000013120 | 226 |
| 184 | 3300005719 | Ga0068861_100000362 | Ga0068861_10000036230 | 226 |
| 185 | 3300005834 | Ga0068851_10000114 | Ga0068851_1000011421 | 226 |
| 186 | 3300005840 | Ga0068870_10000278 | Ga0068870_1000027814 | 226 |
| 187 | 3300005841 | Ga0068863_100000473 | Ga0068863_1000004733 | 226 |
| 188 | 3300005842 | Ga0068858_100002171 | Ga0068858_10000217112 | 226 |
| 189 | 3300005843 | Ga0068860_100000977 | Ga0068860_10000097725 | 226 |
| 190 | 3300005844 | Ga0068862_100000870 | Ga0068862_10000087010 | 226 |
| 191 | 3300005983 | Ga0081540_1000033 | Ga0081540_100003357 | 226 |
| 192 | 3300005983 | Ga0081540_1000160 | Ga0081540_100016016 | 226 |
| 193 | 3300005983 | Ga0081540_1000605 | Ga0081540_100060524 | 226 |
| 194 | 3300006237 | Ga0097621_100000104 | Ga0097621_10000010413 | 226 |
| 195 | 3300006237 | Ga0097621_100218262 | Ga0097621_1002182622 | 226 |
| 196 | 3300006358 | Ga0068871_100000502 | Ga0068871_10000050219 | 226 |
| 197 | 3300006881 | Ga0068865_100000163 | Ga0068865_10000016330 | 226 |
| 198 | 3300006931 | Ga0097620_100001182 | Ga0097620_10000118231 | 226 |
| 199 | 3300009093 | Ga0105240_10003863 | Ga0105240_1000386310 | 226 |
| 200 | 3300009098 | Ga0105245_10000381 | Ga0105245_1000038129 | 226 |
| 201 | 3300009101 | Ga0105247_10000449 | Ga0105247_1000044916 | 226 |
| 202 | 3300009148 | Ga0105243_10002984 | Ga0105243_1000298413 | 226 |
| 203 | 3300009174 | Ga0105241_10000925 | Ga0105241_1000092520 | 226 |
| 204 | 3300009176 | Ga0105242_10001510 | Ga0105242_1000151012 | 226 |
| 205 | 3300009177 | Ga0105248_10000704 | Ga0105248_1000070441 | 226 |
| 206 | 3300009545 | Ga0105237_10000031 | Ga0105237_1000003156 | 226 |
| 207 | 3300009551 | Ga0105238_10001175 | Ga0105238_100011752 | 226 |
| 208 | 3300009553 | Ga0105249_10000604 | Ga0105249_100006049 | 226 |
| 209 | 3300010375 | Ga0105239_10000220 | Ga0105239_1000022059 | 226 |
| 210 | 3300011119 | Ga0105246_10004293 | Ga0105246_100042935 | 226 |
| 211 | 3300013100 | Ga0157373_10012514 | Ga0157373_100125143 | 226 |
| 212 | 3300013102 | Ga0157371_10000246 | Ga0157371_1000024656 | 226 |
| 213 | 3300013105 | Ga0157369_10000669 | Ga0157369_1000066936 | 226 |
| 214 | 3300013296 | Ga0157374_10000295 | Ga0157374_1000029529 | 226 |
| 215 | 3300013297 | Ga0157378_10003702 | Ga0157378_100037025 | 226 |
| 216 | 3300013306 | Ga0163162_10000200 | Ga0163162_1000020036 | 226 |
| 217 | 3300013307 | Ga0157372_10007285 | Ga0157372_100072856 | 226 |
| 218 | 3300013308 | Ga0157375_10001123 | Ga0157375_1000112316 | 226 |
| 219 | 3300014325 | Ga0163163_10001685 | Ga0163163_1000168514 | 226 |
| 220 | 3300014497 | Ga0182008_10048008 | Ga0182008_100480082 | 226 |
| 221 | 3300014745 | Ga0157377_10000219 | Ga0157377_100002198 | 226 |
| 222 | 3300014968 | Ga0157379_10000625 | Ga0157379_100006257 | 226 |
| 223 | 3300014969 | Ga0157376_10000284 | Ga0157376_1000028429 | 226 |
| 224 | 3300014969 | Ga0157376_10461130 | Ga0157376_104611301 | 226 |
| 225 | 3300017792 | Ga0163161_10028173 | Ga0163161_100281734 | 226 |
| 226 | 3300025315 | Ga0207697_10001984 | Ga0207697_100019843 | 226 |
| 227 | 3300025321 | Ga0207656_10000622 | Ga0207656_100006226 | 226 |
| 228 | 3300025893 | Ga0207682_10000658 | Ga0207682_1000065817 | 226 |
| 229 | 3300025899 | Ga0207642_10000126 | Ga0207642_100001263 | 226 |
| 230 | 3300025900 | Ga0207710_10007391 | Ga0207710_100073915 | 226 |
| 231 | 3300025901 | Ga0207688_10000180 | Ga0207688_1000018028 | 226 |
| 232 | 3300025903 | Ga0207680_10001578 | Ga0207680_100015789 | 226 |
| 233 | 3300025904 | Ga0207647_10026796 | Ga0207647_100267963 | 226 |
| 234 | 3300025907 | Ga0207645_10000027 | Ga0207645_1000002776 | 226 |
| 235 | 3300025908 | Ga0207643_10000005 | Ga0207643_10000005133 | 226 |
| 236 | 3300025909 | Ga0207705_10007267 | Ga0207705_100072673 | 226 |
| 237 | 3300025911 | Ga0207654_10006842 | Ga0207654_100068422 | 226 |
| 238 | 3300025912 | Ga0207707_10150081 | Ga0207707_101500812 | 226 |
| 239 | 3300025913 | Ga0207695_10013286 | Ga0207695_100132869 | 226 |
| 240 | 3300025914 | Ga0207671_10000265 | Ga0207671_1000026538 | 226 |
| 241 | 3300025918 | Ga0207662_10000075 | Ga0207662_1000007540 | 226 |
| 242 | 3300025919 | Ga0207657_10000029 | Ga0207657_1000002928 | 226 |
| 243 | 3300025920 | Ga0207649_10000386 | Ga0207649_100003868 | 226 |
| 244 | 3300025921 | Ga0207652_10067146 | Ga0207652_100671463 | 226 |
| 245 | 3300025923 | Ga0207681_10000063 | Ga0207681_1000006315 | 226 |
| 246 | 3300025924 | Ga0207694_10010542 | Ga0207694_100105422 | 226 |
| 247 | 3300025925 | Ga0207650_10000232 | Ga0207650_1000023241 | 226 |
| 248 | 3300025926 | Ga0207659_10000243 | Ga0207659_1000024310 | 226 |
| 249 | 3300025927 | Ga0207687_10002959 | Ga0207687_100029593 | 226 |
| 250 | 3300025931 | Ga0207644_10001285 | Ga0207644_1000128510 | 226 |
| 251 | 3300025932 | Ga0207690_10001131 | Ga0207690_1000113112 | 226 |
| 252 | 3300025933 | Ga0207706_10000231 | Ga0207706_1000023140 | 226 |
| 253 | 3300025934 | Ga0207686_10000823 | Ga0207686_100008238 | 226 |
| 254 | 3300025935 | Ga0207709_10080621 | Ga0207709_100806213 | 226 |
| 255 | 3300025936 | Ga0207670_10001311 | Ga0207670_100013115 | 226 |
| 256 | 3300025937 | Ga0207669_10004745 | Ga0207669_100047452 | 226 |
| 257 | 3300025938 | Ga0207704_10001151 | Ga0207704_100011513 | 226 |
| 258 | 3300025940 | Ga0207691_10000068 | Ga0207691_1000006856 | 226 |
| 259 | 3300025941 | Ga0207711_10000068 | Ga0207711_1000006896 | 226 |
| 260 | 3300025942 | Ga0207689_10000375 | Ga0207689_1000037532 | 226 |
| 261 | 3300025944 | Ga0207661_10004322 | Ga0207661_100043225 | 226 |
| 262 | 3300025945 | Ga0207679_10000135 | Ga0207679_100001359 | 226 |
| 263 | 3300025945 | Ga0207679_10059136 | Ga0207679_100591363 | 226 |
| 264 | 3300025949 | Ga0207667_10001908 | Ga0207667_100019082 | 226 |
| 265 | 3300025960 | Ga0207651_10000040 | Ga0207651_1000004056 | 226 |
| 266 | 3300025961 | Ga0207712_10000187 | Ga0207712_1000018732 | 226 |
| 267 | 3300025972 | Ga0207668_10001124 | Ga0207668_1000112412 | 226 |
| 268 | 3300025981 | Ga0207640_10000399 | Ga0207640_100003993 | 226 |
| 269 | 3300025986 | Ga0207658_10000246 | Ga0207658_1000024629 | 226 |
| 270 | 3300026023 | Ga0207677_10000018 | Ga0207677_1000001856 | 226 |
| 271 | 3300026035 | Ga0207703_10000112 | Ga0207703_1000011276 | 226 |
| 272 | 3300026041 | Ga0207639_10000324 | Ga0207639_1000032426 | 226 |
| 273 | 3300026067 | Ga0207678_10000349 | Ga0207678_1000034929 | 226 |
| 274 | 3300026075 | Ga0207708_10007589 | Ga0207708_100075892 | 226 |
| 275 | 3300026088 | Ga0207641_10000329 | Ga0207641_100003299 | 226 |
| 276 | 3300026089 | Ga0207648_10001848 | Ga0207648_1000184816 | 226 |
| 277 | 3300026095 | Ga0207676_10000289 | Ga0207676_1000028945 | 226 |
| 278 | 3300026116 | Ga0207674_10000304 | Ga0207674_100003049 | 226 |
| 279 | 3300026118 | Ga0207675_100000002 | Ga0207675_10000000279 | 226 |
| 280 | 3300026121 | Ga0207683_10000070 | Ga0207683_1000007029 | 226 |
| 281 | 3300026142 | Ga0207698_10000132 | Ga0207698_1000013227 | 226 |
| 282 | 3300028379 | Ga0268266_10000139 | Ga0268266_1000013999 | 226 |
| 283 | 3300028380 | Ga0268265_10000148 | Ga0268265_1000014862 | 226 |
| 284 | 3300028381 | Ga0268264_10000312 | Ga0268264_1000031229 | 226 |
| 285 | 3300042012 | Ga0439455_0005474 | Ga0439455_0005474_247_1095 | 226 |
| 286 | 3300048904 | Ga0496101_0121676 | Ga0496101_0121676_76_834 | 226 |
| 287 | 3300048905 | Ga0496102_0001277 | Ga0496102_0001277_7418_8176 | 226 |
| 288 | 3300048909 | Ga0496106_0001048 | Ga0496106_0001048_2126_2884 | 226 |
| 289 | 3300048911 | Ga0496108_0022027 | Ga0496108_0022027_1385_2143 | 226 |
| 290 | 3300048912 | Ga0496109_0001513 | Ga0496109_0001513_13903_14661 | 226 |
| 291 | 3300048915 | Ga0496112_0000162 | Ga0496112_0000162_37277_38035 | 226 |
| 292 | 3300048916 | Ga0496113_0355936 | Ga0496113_0355936_220_978 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF12974
Phosphonate-bd
ABC transporter, phosphonate, periplasmic substrate-binding protein
60
299
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ghq-assembly1.cif.gz_A | htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution | 0.8066 | 8 | 224 |
| 6ghq-assembly1.cif.gz_A | htxb d206n protein variant from pseudomonas stutzeri in a partially open conformation to 1.53 a resolution | 0.775 | 8 | 224 |
| 5o2k-assembly4.cif.gz_C | native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution | 0.7745 | 2 | 224 |
| 5o2k-assembly4.cif.gz_C | native apo-structure of pseudomonas stutzeri ptxb to 2.1 a resolution | 0.7624 | 2 | 224 |
| 7zck-assembly1.cif.gz_C | room temperature crystal structure of phnd from synechococcus mits9220 in complex with phosphate | 0.7504 | 2 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oeuB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8407 | 31 | 53 | 3.40.190.10 |
| af_Q2G1L7_48_134_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8285 | 2 | 50 | 3.40.190.10 |
| 5isuA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8112 | 33 | 77 | 3.40.190.10 |
| 3qujD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7946 | 2 | 208 | 3.40.190.10 |
| 3qujD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7569 | 2 | 208 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N1GHC8-F1-model_v4 | Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | 0.8569 | 9 | 224 |
|
| AF-L1JXY8-F1-model_v4 | Uncharacterized protein | 0.8523 | 18 | 223 |
|
| AF-A0A2P8HWN6-F1-model_v4 | Phosphonate transport system substrate-binding protein | 0.8522 | 2 | 223 |
GO:0043190
GO:0055085 |
| AF-A0A1Q5S3N4-F1-model_v4 | Phosphate ABC transporter substrate-binding protein | 0.8436 | 9 | 226 |
|
| AF-A0A538M0W8-F1-model_v4 | Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | 0.8397 | 11 | 226 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar