F390793

General Info

Members Datasets Scaffolds Average Seq Length
292 166 584 173

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100952651|Ga0068867_1009526511
Length 170
Sequence MDNDDMRLPLPSGSEVSLRPVSAADDEFLLTVYAGTREEELAQVPWSDEQKSQFLRSQFNLQREQYDLTYANVQYDVILVDERPAGRIWVSRGDEIRLLDIALLGEFQNRGVGTVLLRSLIDEAVRVKKSLRHMVFFLNTDAKRFYERLGFVVFEEVGAYLHMEWRDGSP

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
145 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
146 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
151 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
152 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
156 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
157 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
160 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
161 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
162 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 30.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100952651 3300005459 Bacteria 775
2 MRS1b_contig_392620 2162886011 Unclassified 1457
3 rootL2_10274025 3300003322 Unclassified 1480
4 Ga0065714_10002185 3300005288 Bacteria 199213
5 Ga0065704_10126508 3300005289 Bacteria 1688
6 Ga0065704_10144501 3300005289 Bacteria 1485
7 Ga0065712_10010250 3300005290 Unclassified 3462
8 Ga0065712_10067734 3300005290 Bacteria 110577
9 Ga0065715_10014893 3300005293 Bacteria 2112
10 Ga0065715_10089801 3300005293 Bacteria 8478
11 Ga0065707_10250373 3300005295 Unclassified 1127
12 Ga0065707_10268589 3300005295 Unclassified 1077
13 Ga0065707_10401349 3300005295 Unclassified 852
14 Ga0070676_10141873 3300005328 Bacteria 1530
15 Ga0070676_10167251 3300005328 Unclassified 1420
16 Ga0070690_100005999 3300005330 Bacteria 6863
17 Ga0068869_100071491 3300005334 Bacteria 2569
18 Ga0070680_100000437 3300005336 Bacteria 28394
19 Ga0070680_100024129 3300005336 Bacteria 4853
20 Ga0068868_100810343 3300005338 Unclassified 845
21 Ga0070689_101331351 3300005340 Bacteria 647
22 Ga0070691_10222516 3300005341 Unclassified 1001
23 Ga0070687_100045208 3300005343 Bacteria 2247
24 Ga0070692_10082984 3300005345 Bacteria 1729
25 Ga0070669_100024053 3300005353 Unclassified 4365
26 Ga0070669_100031760 3300005353 Bacteria 3814
27 Ga0070669_100520835 3300005353 Bacteria 988
28 Ga0070671_100412438 3300005355 Unclassified 1156
29 Ga0070674_100774465 3300005356 Unclassified 826
30 Ga0070673_100308462 3300005364 Bacteria 1395
31 Ga0070673_100690295 3300005364 Bacteria 937
32 Ga0070688_100231120 3300005365 Bacteria 1308
33 Ga0070659_100256999 3300005366 Unclassified 1449
34 Ga0070703_10000271 3300005406 Bacteria 24602
35 Ga0070703_10016490 3300005406 Bacteria 2120
36 Ga0070703_10273110 3300005406 Bacteria 694
37 Ga0070701_10015781 3300005438 Bacteria 3497
38 Ga0070701_10032150 3300005438 Unclassified 2611
39 Ga0070705_100084837 3300005440 Bacteria 1956
40 Ga0070705_100097912 3300005440 Unclassified 1845
41 Ga0070705_100245292 3300005440 Bacteria 1254
42 Ga0070705_100522143 3300005440 Unclassified 905
43 Ga0070700_100018111 3300005441 Bacteria 4043
44 Ga0070700_100050506 3300005441 Bacteria 2585
45 Ga0070694_100010258 3300005444 Bacteria 5771
46 Ga0070694_100771546 3300005444 Bacteria 786
47 Ga0070694_101079634 3300005444 Unclassified 669
48 Ga0070708_100840408 3300005445 Bacteria 863
49 Ga0070663_100295794 3300005455 Unclassified 1294
50 Ga0070678_101509631 3300005456 Unclassified 629
51 Ga0070662_100025708 3300005457 Unclassified 4069
52 Ga0070681_10000158 3300005458 Bacteria 52016
53 Ga0070681_10521089 3300005458 Bacteria 1102
54 Ga0068867_100049804 3300005459 Unclassified 3084
55 Ga0068867_100274683 3300005459 Unclassified 1379
56 Ga0070706_100013312 3300005467 Bacteria 7607
57 Ga0070706_100017462 3300005467 Bacteria 6622
58 Ga0070706_100045342 3300005467 Bacteria 4061
59 Ga0070706_100136955 3300005467 Bacteria 2285
60 Ga0070698_100028269 3300005471 Bacteria 5827
61 Ga0070698_100706541 3300005471 Unclassified 950
62 Ga0070699_100980879 3300005518 Bacteria 775
63 Ga0070679_100000173 3300005530 Bacteria 51987
64 Ga0070697_100624749 3300005536 Bacteria 948
65 Ga0070686_100005798 3300005544 Bacteria 6846
66 Ga0070695_100017544 3300005545 Bacteria 4342
67 Ga0070695_100262257 3300005545 Bacteria 1262
68 Ga0070695_100355383 3300005545 Bacteria 1099
69 Ga0070693_100162524 3300005547 Bacteria 1423
70 Ga0070693_100165160 3300005547 Bacteria 1413
71 Ga0070704_100025493 3300005549 Bacteria 3894
72 Ga0070664_100244083 3300005564 Unclassified 1613
73 Ga0068857_100167715 3300005577 Bacteria 1995
74 Ga0068854_100571663 3300005578 Bacteria 961
75 Ga0068856_100006432 3300005614 Bacteria 11528
76 Ga0068856_100813249 3300005614 Unclassified 954
77 Ga0070702_100024769 3300005615 Bacteria 3205
78 Ga0070702_100232082 3300005615 Unclassified 1240
79 Ga0068852_100164817 3300005616 Bacteria 2073
80 Ga0068859_100126262 3300005617 Bacteria 2627
81 Ga0068859_100306086 3300005617 Bacteria 1683
82 Ga0068859_100422619 3300005617 Unclassified 1429
83 Ga0068859_100479040 3300005617 Unclassified 1340
84 Ga0068859_100576225 3300005617 Bacteria 1219
85 Ga0068859_101111377 3300005617 Unclassified 869
86 Ga0068864_100365200 3300005618 Bacteria 1365
87 Ga0068861_100308536 3300005719 Unclassified 1373
88 Ga0068861_100363346 3300005719 Bacteria 1274
89 Ga0068870_10073824 3300005840 Bacteria 1867
90 Ga0068870_10117826 3300005840 Bacteria 1525
91 Ga0068863_100502313 3300005841 Bacteria 1194
92 Ga0068858_100209491 3300005842 Bacteria 1845
93 Ga0068858_100487156 3300005842 Bacteria 1190
94 Ga0068858_100554067 3300005842 Bacteria 1113
95 Ga0068860_100037539 3300005843 Bacteria 4638
96 Ga0068860_100044210 3300005843 Bacteria 4246
97 Ga0068860_100088856 3300005843 Unclassified 2941
98 Ga0068860_101567329 3300005843 Bacteria 680
99 Ga0068862_100006996 3300005844 Bacteria 9365
100 Ga0068862_100021413 3300005844 Bacteria 5402
101 Ga0068862_100181458 3300005844 Bacteria 1889
102 Ga0068862_100209029 3300005844 Bacteria 1763
103 Ga0081455_10491051 3300005937 Unclassified 827
104 Ga0081539_10000156 3300005985 Bacteria 158871
105 Ga0097621_100104355 3300006237 Bacteria 2388
106 Ga0068871_100016489 3300006358 Bacteria 5566
107 Ga0075428_100055948 3300006844 Bacteria 4322
108 Ga0075428_100198691 3300006844 Bacteria 2168
109 Ga0075431_100388521 3300006847 Unclassified 1398
110 Ga0075433_10068170 3300006852 Bacteria 3123
111 Ga0075433_10176908 3300006852 Bacteria 1899
112 Ga0075433_10178305 3300006852 Unclassified 1891
113 Ga0075433_10314475 3300006852 Bacteria 1386
114 Ga0075433_10620948 3300006852 Unclassified 948
115 Ga0075434_100130624 3300006871 Unclassified 2530
116 Ga0075434_100446125 3300006871 Bacteria 1315
117 Ga0075429_100024991 3300006880 Bacteria 5186
118 Ga0097620_100126278 3300006931 Bacteria 2627
119 Ga0097620_100306095 3300006931 Bacteria 1683
120 Ga0097620_100422660 3300006931 Unclassified 1429
121 Ga0097620_100479071 3300006931 Unclassified 1340
122 Ga0097620_100576156 3300006931 Bacteria 1219
123 Ga0097620_101111394 3300006931 Unclassified 869
124 Ga0075435_100476212 3300007076 Bacteria 1078
125 Ga0099794_10052605 3300007265 Unclassified 1963
126 Ga0105251_10252135 3300009011 Unclassified 796
127 Ga0111539_10153258 3300009094 Bacteria 2697
128 Ga0105245_10339272 3300009098 Bacteria 1485
129 Ga0105245_12238211 3300009098 Unclassified 600
130 Ga0105247_10018366 3300009101 Bacteria 4196
131 Ga0105247_10227473 3300009101 Bacteria 1265
132 Ga0114129_10557688 3300009147 Bacteria 1489
133 Ga0105243_10000199 3300009148 Bacteria 70022
134 Ga0105241_10019067 3300009174 Bacteria 5059
135 Ga0105242_10000105 3300009176 Bacteria 60065
136 Ga0105248_10008640 3300009177 Bacteria 11188
137 Ga0105248_10015792 3300009177 Bacteria 8322
138 Ga0105248_10046365 3300009177 Bacteria 4871
139 Ga0105248_10111875 3300009177 Bacteria 3080
140 Ga0105238_10005435 3300009551 Bacteria 12587
141 Ga0105249_10077743 3300009553 Bacteria 3078
142 Ga0105249_10150823 3300009553 Unclassified 2238
143 Ga0105249_10348813 3300009553 Bacteria 1499
144 Ga0105249_11416363 3300009553 Bacteria 767
145 Ga0105239_10515805 3300010375 Unclassified 1360
146 Ga0105246_10131540 3300011119 Unclassified 1870
147 Ga0105246_10247459 3300011119 Bacteria 1413
148 Ga0157373_10003863 3300013100 Bacteria 11320
149 Ga0157373_10007782 3300013100 Bacteria 7967
150 Ga0157373_10093312 3300013100 Unclassified 2120
151 Ga0157378_10080371 3300013297 Bacteria 2945
152 Ga0157378_11040561 3300013297 Bacteria 854
153 Ga0157378_11308296 3300013297 Bacteria 766
154 Ga0163162_10008008 3300013306 Bacteria 10308
155 Ga0163162_10159673 3300013306 Bacteria 2376
156 Ga0163162_10188372 3300013306 Bacteria 2190
157 Ga0163162_10328298 3300013306 Unclassified 1662
158 Ga0163162_12409084 3300013306 Unclassified 605
159 Ga0157372_11593853 3300013307 Bacteria 752
160 Ga0157375_10028250 3300013308 Bacteria 5255
161 Ga0157375_10703343 3300013308 Bacteria 1164
162 Ga0157375_11097257 3300013308 Bacteria 931
163 Ga0163163_10021718 3300014325 Bacteria 6063
164 Ga0163163_10448146 3300014325 Bacteria 1351
165 Ga0157380_10007130 3300014326 Bacteria 7920
166 Ga0157380_10009008 3300014326 Bacteria 7129
167 Ga0157380_10262973 3300014326 Bacteria 1568
168 Ga0157380_10400823 3300014326 Unclassified 1302
169 Ga0157377_10509793 3300014745 Unclassified 842
170 Ga0163161_10440856 3300017792 Bacteria 1051
171 Ga0213876_10000620 3300021384 Bacteria 26119
172 Ga0207653_10000026 3300025885 Bacteria 114420
173 Ga0207653_10130264 3300025885 Bacteria 913
174 Ga0207710_10082653 3300025900 Bacteria 1492
175 Ga0207645_10028631 3300025907 Unclassified 3596
176 Ga0207645_10249895 3300025907 Bacteria 1173
177 Ga0207645_10319935 3300025907 Unclassified 1035
178 Ga0207643_10005616 3300025908 Bacteria 6704
179 Ga0207643_10011131 3300025908 Bacteria 4857
180 Ga0207643_10391865 3300025908 Unclassified 877
181 Ga0207684_10000358 3300025910 Bacteria 62368
182 Ga0207684_10022956 3300025910 Bacteria 5328
183 Ga0207684_10619466 3300025910 Unclassified 923
184 Ga0207707_10580648 3300025912 Unclassified 950
185 Ga0207660_10030799 3300025917 Bacteria 3689
186 Ga0207662_10040778 3300025918 Bacteria 2731
187 Ga0207662_10047362 3300025918 Viruses 2546
188 Ga0207662_10102780 3300025918 Bacteria 1773
189 Ga0207646_10279113 3300025922 Unclassified 1510
190 Ga0207646_10814044 3300025922 Unclassified 831
191 Ga0207681_10006643 3300025923 Bacteria 7102
192 Ga0207681_10020113 3300025923 Unclassified 4226
193 Ga0207681_10048967 3300025923 Unclassified 2855
194 Ga0207694_10005564 3300025924 Bacteria 9658
195 Ga0207694_10876885 3300025924 Unclassified 759
196 Ga0207650_10248737 3300025925 Unclassified 1439
197 Ga0207650_11014134 3300025925 Unclassified 706
198 Ga0207644_10358201 3300025931 Unclassified 1186
199 Ga0207690_10239081 3300025932 Unclassified 1398
200 Ga0207706_10041838 3300025933 Unclassified 4061
201 Ga0207706_10121990 3300025933 Unclassified 2292
202 Ga0207686_10000064 3300025934 Bacteria 95481
203 Ga0207709_10000150 3300025935 Bacteria 95086
204 Ga0207709_10076081 3300025935 Unclassified 2148
205 Ga0207670_10112862 3300025936 Bacteria 1962
206 Ga0207665_10575093 3300025939 Bacteria 878
207 Ga0207711_10005433 3300025941 Bacteria 10778
208 Ga0207711_10007485 3300025941 Bacteria 9132
209 Ga0207711_10134269 3300025941 Bacteria 2221
210 Ga0207711_10295428 3300025941 Bacteria 1494
211 Ga0207689_10115130 3300025942 Bacteria 2210
212 Ga0207689_10122316 3300025942 Unclassified 2140
213 Ga0207651_10007688 3300025960 Bacteria 5758
214 Ga0207651_10568320 3300025960 Bacteria 988
215 Ga0207651_10895760 3300025960 Unclassified 790
216 Ga0207712_10392334 3300025961 Bacteria 1164
217 Ga0207712_10885089 3300025961 Bacteria 788
218 Ga0207640_10338245 3300025981 Unclassified 1205
219 Ga0207703_10201553 3300026035 Bacteria 1769
220 Ga0207703_10315855 3300026035 Bacteria 1429
221 Ga0207708_10042120 3300026075 Bacteria 3481
222 Ga0207708_10089462 3300026075 Bacteria 2373
223 Ga0207702_10008531 3300026078 Bacteria 8638
224 Ga0207702_10306007 3300026078 Unclassified 1510
225 Ga0207641_10121890 3300026088 Bacteria 2328
226 Ga0207676_10292942 3300026095 Bacteria 1483
227 Ga0207676_10472664 3300026095 Bacteria 1186
228 Ga0207676_10712543 3300026095 Unclassified 973
229 Ga0207674_10222321 3300026116 Bacteria 1836
230 Ga0207674_10256539 3300026116 Bacteria 1695
231 Ga0207674_10592115 3300026116 Bacteria 1071
232 Ga0207675_100020168 3300026118 Bacteria 6216
233 Ga0207675_100173147 3300026118 Bacteria 2064
234 Ga0207675_100377437 3300026118 Bacteria 1393
235 Ga0207675_100386646 3300026118 Unclassified 1377
236 Ga0207675_100902064 3300026118 Unclassified 900
237 Ga0207683_11338695 3300026121 Unclassified 663
238 Ga0209588_1053530 3300027671 Bacteria 1305
239 Ga0268265_10029443 3300028380 Unclassified 3941
240 Ga0268265_11197711 3300028380 Bacteria 757
241 Ga0268265_11271875 3300028380 Unclassified 735
242 Ga0268264_10024379 3300028381 Bacteria 4939
243 Ga0268264_10154278 3300028381 Bacteria 2062
244 Ga0268264_10177944 3300028381 Unclassified 1929
245 Ga0307416_100806993 3300032002 Unclassified 1034
246 Ga0307414_10208923 3300032004 Bacteria 1594
247 Ga0307411_10196026 3300032005 Bacteria 1547
248 Ga0307411_10359703 3300032005 Bacteria 1190
249 Ga0307415_100556877 3300032126 Bacteria 1013
250 Ga0373951_0002732 3300035091 Bacteria 4419
251 Ga0373951_0109835 3300035091 Unclassified 741
252 Ga0395900_0361125 3300037418 Bacteria 1424
253 Ga0436365_0748815 3300039437 Bacteria 55323
254 Ga0439453_0140655 3300041408 Bacteria 567
255 Ga0439446_0174509 3300042156 Unclassified 716
256 Ga0453683_0218971 3300044673 Unclassified 1210
257 Ga0453683_0259170 3300044673 Unclassified 1109
258 Ga0451576_0823670 3300045051 Unclassified 974
259 Ga0451576_1140065 3300045051 Unclassified 815
260 Ga0496102_0130908 3300048905 Bacteria 2348
261 Ga0496103_0640412 3300048906 Unclassified 676
262 Ga0496104_0554480 3300048907 Bacteria 1060
263 Ga0496106_0008702 3300048909 Bacteria 7511
264 Ga0496106_0269889 3300048909 Bacteria 1362
265 Ga0496107_0170377 3300048910 Unclassified 1615
266 Ga0496108_0970618 3300048911 Bacteria 727
267 Ga0501292_001469 3300049515 Bacteria 2906
268 Ga0501295_019427 3300049518 Bacteria 1220
269 Ga0501297_005517 3300049520 Bacteria 1324
270 Ga0501298_022189 3300049521 Bacteria 1194
271 Ga0501299_002789 3300049522 Bacteria 2461
272 Ga0501048_0392430 3300049582 Bacteria 992
273 Ga0501202_002415 3300049652 Bacteria 3133
274 Ga0501207_007249 3300049654 Bacteria 1579
275 Ga0501216_006469 3300049660 Unclassified 1797
276 Ga0501223_031090 3300049663 Bacteria 1038
277 Ga0501233_079903 3300049668 Bacteria 840
278 Ga0501243_022190 3300049675 Bacteria 1050
279 Ga0501256_003151 3300049685 Bacteria 1353
280 Ga0501221_032595 3300049704 Unclassified 1095
281 Ga0501225_0005201 3300049705 Bacteria 3830
282 Ga0501234_005257 3300049707 Bacteria 2026
283 Ga0501270_062852 3300049767 Unclassified 701
284 Ga0501283_005132 3300049779 Bacteria 1790
285 Ga0501212_001949 3300049851 Bacteria 2420
286 nmdc:mga09592_97213_c1 3300050508 Bacteria 2520
287 nmdc:mga08y16_415642_c1 3300050511 Bacteria 1375
288 nmdc:mga0n895_27393_c1 3300050512 Bacteria 5414
289 nmdc:mga0a205_194755_c1 3300050515 Bacteria 1918
290 nmdc:mga0a205_27582_c1 3300050515 Bacteria 5424
291 nmdc:mga0a205_485168_c1 3300050515 Bacteria 1094
292 nmdc:mga0a205_68467_c1 3300050515 Bacteria 3428
293 Ga0068867_100952651
294 MRS1b_contig_392620
295 rootL2_10274025
296 Ga0065714_10002185
297 Ga0065704_10126508
298 Ga0065704_10144501
299 Ga0065712_10010250
300 Ga0065712_10067734
301 Ga0065715_10014893
302 Ga0065715_10089801
303 Ga0065707_10250373
304 Ga0065707_10268589
305 Ga0065707_10401349
306 Ga0070676_10141873
307 Ga0070676_10167251
308 Ga0070690_100005999
309 Ga0068869_100071491
310 Ga0070680_100000437
311 Ga0070680_100024129
312 Ga0068868_100810343
313 Ga0070689_101331351
314 Ga0070691_10222516
315 Ga0070687_100045208
316 Ga0070692_10082984
317 Ga0070669_100024053
318 Ga0070669_100031760
319 Ga0070669_100520835
320 Ga0070671_100412438
321 Ga0070674_100774465
322 Ga0070673_100308462
323 Ga0070673_100690295
324 Ga0070688_100231120
325 Ga0070659_100256999
326 Ga0070703_10000271
327 Ga0070703_10016490
328 Ga0070703_10273110
329 Ga0070701_10015781
330 Ga0070701_10032150
331 Ga0070705_100084837
332 Ga0070705_100097912
333 Ga0070705_100245292
334 Ga0070705_100522143
335 Ga0070700_100018111
336 Ga0070700_100050506
337 Ga0070694_100010258
338 Ga0070694_100771546
339 Ga0070694_101079634
340 Ga0070708_100840408
341 Ga0070663_100295794
342 Ga0070678_101509631
343 Ga0070662_100025708
344 Ga0070681_10000158
345 Ga0070681_10521089
346 Ga0068867_100049804
347 Ga0068867_100274683
348 Ga0070706_100013312
349 Ga0070706_100017462
350 Ga0070706_100045342
351 Ga0070706_100136955
352 Ga0070698_100028269
353 Ga0070698_100706541
354 Ga0070699_100980879
355 Ga0070679_100000173
356 Ga0070697_100624749
357 Ga0070686_100005798
358 Ga0070695_100017544
359 Ga0070695_100262257
360 Ga0070695_100355383
361 Ga0070693_100162524
362 Ga0070693_100165160
363 Ga0070704_100025493
364 Ga0070664_100244083
365 Ga0068857_100167715
366 Ga0068854_100571663
367 Ga0068856_100006432
368 Ga0068856_100813249
369 Ga0070702_100024769
370 Ga0070702_100232082
371 Ga0068852_100164817
372 Ga0068859_100126262
373 Ga0068859_100306086
374 Ga0068859_100422619
375 Ga0068859_100479040
376 Ga0068859_100576225
377 Ga0068859_101111377
378 Ga0068864_100365200
379 Ga0068861_100308536
380 Ga0068861_100363346
381 Ga0068870_10073824
382 Ga0068870_10117826
383 Ga0068863_100502313
384 Ga0068858_100209491
385 Ga0068858_100487156
386 Ga0068858_100554067
387 Ga0068860_100037539
388 Ga0068860_100044210
389 Ga0068860_100088856
390 Ga0068860_101567329
391 Ga0068862_100006996
392 Ga0068862_100021413
393 Ga0068862_100181458
394 Ga0068862_100209029
395 Ga0081455_10491051
396 Ga0081539_10000156
397 Ga0097621_100104355
398 Ga0068871_100016489
399 Ga0075428_100055948
400 Ga0075428_100198691
401 Ga0075431_100388521
402 Ga0075433_10068170
403 Ga0075433_10176908
404 Ga0075433_10178305
405 Ga0075433_10314475
406 Ga0075433_10620948
407 Ga0075434_100130624
408 Ga0075434_100446125
409 Ga0075429_100024991
410 Ga0097620_100126278
411 Ga0097620_100306095
412 Ga0097620_100422660
413 Ga0097620_100479071
414 Ga0097620_100576156
415 Ga0097620_101111394
416 Ga0075435_100476212
417 Ga0099794_10052605
418 Ga0105251_10252135
419 Ga0111539_10153258
420 Ga0105245_10339272
421 Ga0105245_12238211
422 Ga0105247_10018366
423 Ga0105247_10227473
424 Ga0114129_10557688
425 Ga0105243_10000199
426 Ga0105241_10019067
427 Ga0105242_10000105
428 Ga0105248_10008640
429 Ga0105248_10015792
430 Ga0105248_10046365
431 Ga0105248_10111875
432 Ga0105238_10005435
433 Ga0105249_10077743
434 Ga0105249_10150823
435 Ga0105249_10348813
436 Ga0105249_11416363
437 Ga0105239_10515805
438 Ga0105246_10131540
439 Ga0105246_10247459
440 Ga0157373_10003863
441 Ga0157373_10007782
442 Ga0157373_10093312
443 Ga0157378_10080371
444 Ga0157378_11040561
445 Ga0157378_11308296
446 Ga0163162_10008008
447 Ga0163162_10159673
448 Ga0163162_10188372
449 Ga0163162_10328298
450 Ga0163162_12409084
451 Ga0157372_11593853
452 Ga0157375_10028250
453 Ga0157375_10703343
454 Ga0157375_11097257
455 Ga0163163_10021718
456 Ga0163163_10448146
457 Ga0157380_10007130
458 Ga0157380_10009008
459 Ga0157380_10262973
460 Ga0157380_10400823
461 Ga0157377_10509793
462 Ga0163161_10440856
463 Ga0213876_10000620
464 Ga0207653_10000026
465 Ga0207653_10130264
466 Ga0207710_10082653
467 Ga0207645_10028631
468 Ga0207645_10249895
469 Ga0207645_10319935
470 Ga0207643_10005616
471 Ga0207643_10011131
472 Ga0207643_10391865
473 Ga0207684_10000358
474 Ga0207684_10022956
475 Ga0207684_10619466
476 Ga0207707_10580648
477 Ga0207660_10030799
478 Ga0207662_10040778
479 Ga0207662_10047362
480 Ga0207662_10102780
481 Ga0207646_10279113
482 Ga0207646_10814044
483 Ga0207681_10006643
484 Ga0207681_10020113
485 Ga0207681_10048967
486 Ga0207694_10005564
487 Ga0207694_10876885
488 Ga0207650_10248737
489 Ga0207650_11014134
490 Ga0207644_10358201
491 Ga0207690_10239081
492 Ga0207706_10041838
493 Ga0207706_10121990
494 Ga0207686_10000064
495 Ga0207709_10000150
496 Ga0207709_10076081
497 Ga0207670_10112862
498 Ga0207665_10575093
499 Ga0207711_10005433
500 Ga0207711_10007485
501 Ga0207711_10134269
502 Ga0207711_10295428
503 Ga0207689_10115130
504 Ga0207689_10122316
505 Ga0207651_10007688
506 Ga0207651_10568320
507 Ga0207651_10895760
508 Ga0207712_10392334
509 Ga0207712_10885089
510 Ga0207640_10338245
511 Ga0207703_10201553
512 Ga0207703_10315855
513 Ga0207708_10042120
514 Ga0207708_10089462
515 Ga0207702_10008531
516 Ga0207702_10306007
517 Ga0207641_10121890
518 Ga0207676_10292942
519 Ga0207676_10472664
520 Ga0207676_10712543
521 Ga0207674_10222321
522 Ga0207674_10256539
523 Ga0207674_10592115
524 Ga0207675_100020168
525 Ga0207675_100173147
526 Ga0207675_100377437
527 Ga0207675_100386646
528 Ga0207675_100902064
529 Ga0207683_11338695
530 Ga0209588_1053530
531 Ga0268265_10029443
532 Ga0268265_11197711
533 Ga0268265_11271875
534 Ga0268264_10024379
535 Ga0268264_10154278
536 Ga0268264_10177944
537 Ga0307416_100806993
538 Ga0307414_10208923
539 Ga0307411_10196026
540 Ga0307411_10359703
541 Ga0307415_100556877
542 Ga0373951_0002732
543 Ga0373951_0109835
544 Ga0395900_0361125
545 Ga0436365_0748815
546 Ga0439453_0140655
547 Ga0439446_0174509
548 Ga0453683_0218971
549 Ga0453683_0259170
550 Ga0451576_0823670
551 Ga0451576_1140065
552 Ga0496102_0130908
553 Ga0496103_0640412
554 Ga0496104_0554480
555 Ga0496106_0008702
556 Ga0496106_0269889
557 Ga0496107_0170377
558 Ga0496108_0970618
559 Ga0501292_001469
560 Ga0501295_019427
561 Ga0501297_005517
562 Ga0501298_022189
563 Ga0501299_002789
564 Ga0501048_0392430
565 Ga0501202_002415
566 Ga0501207_007249
567 Ga0501216_006469
568 Ga0501223_031090
569 Ga0501233_079903
570 Ga0501243_022190
571 Ga0501256_003151
572 Ga0501221_032595
573 Ga0501225_0005201
574 Ga0501234_005257
575 Ga0501270_062852
576 Ga0501283_005132
577 Ga0501212_001949
578 nmdc:mga09592_97213_c1
579 nmdc:mga08y16_415642_c1
580 nmdc:mga0n895_27393_c1
581 nmdc:mga0a205_194755_c1
582 nmdc:mga0a205_27582_c1
583 nmdc:mga0a205_485168_c1
584 nmdc:mga0a205_68467_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

86

158

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

43

165

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

34

151

0.73

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

72

153

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iuf-assembly1.cif.gz_B crystal structure of anti-crispr protein acrva5 0.8191 85 166
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.809 71 167
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8084 72 168
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8074 72 168
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.7958 73 166
ID Description Score Start End Superfamily
af_B6SUK9_20_214_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8995 83 158 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8914 98 167 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8496 114 169 3.40.630.30
af_K7VFD8_74_198_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8459 85 169 3.40.630.30
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8381 73 169 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V8L4R5-F1-model_v4 GNAT family N-acetyltransferase 0.983 24 169 GO:0016747
AF-A0A2V8Q536-F1-model_v4 N-acetyltransferase domain-containing protein 0.983 73 169 GO:0016747
AF-A0A101IHN6-F1-model_v4 Putative acyltransferase 0.9821 72 169 GO:0016747
AF-A3TL48-F1-model_v4 N-acetyltransferase domain-containing protein 0.9819 14 169 GO:0016747
AF-A0A0B3RI66-F1-model_v4 Acetyltransferase, GNAT family (EC 2.3.1.-) 0.9767 16 168 GO:0016747

Map