F390572

General Info

Members Datasets Scaffolds Average Seq Length
291 217 582 143

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0296165|Ga0496122_0296165_28_510
Length 160
Sequence MRSRVSAGFDPKEMIMTAYYPSDAAIAALAEGFLGCSIPKEEWTHAAHFAMTLWLMRHQPERDLPRAMPGLIRAYNESVGGVNSDTAGYHETITQASIRAARAFLIERPAGEPLHQTVDALMAGALGGSGWPLTYWSRAHLFSVAARRGWVEPDLQPLPF

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 0.34
Rhizoplane 1.37
Rhizosphere 82.47
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0296165 3300048925 Bacteria 875
2 JGI24736J21556_1000471 3300001904 Bacteria 7533
3 JGI24741J21665_1000255 3300001915 Bacteria 15938
4 JGI24740J21852_10001194 3300001979 Bacteria 11724
5 JGI24739J22299_10001497 3300001989 Bacteria 8820
6 JGI24737J22298_10001886 3300001990 Bacteria 7497
7 JGI24735J21928_10001449 3300002067 Bacteria 8389
8 JGI24738J21930_10002069 3300002075 Bacteria 5380
9 rootH1_10053271 3300003316 Bacteria 5668
10 Ga0070658_10277982 3300005327 Bacteria 1425
11 Ga0070658_10281509 3300005327 Bacteria 1415
12 Ga0070683_100493910 3300005329 Bacteria 1169
13 Ga0070683_100598382 3300005329 Bacteria 1055
14 Ga0070683_100632793 3300005329 Unclassified 1024
15 Ga0070690_100010038 3300005330 Bacteria 5497
16 Ga0070670_100270445 3300005331 Bacteria 1483
17 Ga0068869_100206908 3300005334 Bacteria 1550
18 Ga0070666_10056410 3300005335 Bacteria 2652
19 Ga0068868_100185451 3300005338 Bacteria 1728
20 Ga0070660_100011131 3300005339 Bacteria 6380
21 Ga0070660_100225097 3300005339 Bacteria 1525
22 Ga0070689_100465472 3300005340 Bacteria 1078
23 Ga0070689_100562517 3300005340 Bacteria 984
24 Ga0070661_100010771 3300005344 Bacteria 6366
25 Ga0070668_100018147 3300005347 Bacteria 5279
26 Ga0070668_100435860 3300005347 Bacteria 1124
27 Ga0070669_100976150 3300005353 Unclassified 726
28 Ga0070675_100046018 3300005354 Bacteria 3572
29 Ga0070671_100009948 3300005355 Bacteria 7639
30 Ga0070674_100048014 3300005356 Bacteria 2928
31 Ga0070673_100110286 3300005364 Bacteria 2281
32 Ga0070673_101270017 3300005364 Bacteria 691
33 Ga0070688_100013859 3300005365 Bacteria 4559
34 Ga0070701_10010256 3300005438 Bacteria 4135
35 Ga0070711_100970022 3300005439 Unclassified 728
36 Ga0070705_100056436 3300005440 Bacteria 2312
37 Ga0070700_100075500 3300005441 Bacteria 2162
38 Ga0070663_100003984 3300005455 Bacteria 8618
39 Ga0070663_100119519 3300005455 Bacteria 1989
40 Ga0070678_100046537 3300005456 Bacteria 3111
41 Ga0070662_100558226 3300005457 Bacteria 960
42 Ga0070681_10561796 3300005458 Bacteria 1055
43 Ga0068867_100038063 3300005459 Bacteria 3500
44 Ga0070684_100095655 3300005535 Bacteria 2647
45 Ga0068853_101167997 3300005539 Bacteria 743
46 Ga0070672_100060620 3300005543 Bacteria 2979
47 Ga0070672_100094079 3300005543 Bacteria 2422
48 Ga0070665_100029466 3300005548 Bacteria 5525
49 Ga0070665_101404828 3300005548 Bacteria 707
50 Ga0070704_100168295 3300005549 Bacteria 1740
51 Ga0068855_100023948 3300005563 Bacteria 7310
52 Ga0068855_100105769 3300005563 Bacteria 3235
53 Ga0070664_100015126 3300005564 Bacteria 6301
54 Ga0068857_100206566 3300005577 Bacteria 1791
55 Ga0068857_100893225 3300005577 Unclassified 852
56 Ga0068857_101029716 3300005577 Unclassified 793
57 Ga0068856_100007021 3300005614 Bacteria 10999
58 Ga0070702_100082912 3300005615 Unclassified 1925
59 Ga0068852_100152199 3300005616 Bacteria 2152
60 Ga0068859_100004300 3300005617 Bacteria 14532
61 Ga0068859_100006150 3300005617 Bacteria 12203
62 Ga0068859_102389373 3300005617 Bacteria 582
63 Ga0068866_10480576 3300005718 Unclassified 818
64 Ga0068861_100010840 3300005719 Bacteria 6335
65 Ga0068861_101972236 3300005719 Unclassified 582
66 Ga0068851_10040191 3300005834 Bacteria 2350
67 Ga0068870_10051367 3300005840 Unclassified 2182
68 Ga0068863_100012892 3300005841 Bacteria 8060
69 Ga0068863_100107449 3300005841 Bacteria 2656
70 Ga0068858_100006139 3300005842 Bacteria 11719
71 Ga0068858_100056022 3300005842 Bacteria 3644
72 Ga0068860_100012276 3300005843 Bacteria 8442
73 Ga0068860_100084236 3300005843 Bacteria 3024
74 Ga0068862_100012359 3300005844 Bacteria 7058
75 Ga0081538_10105643 3300005981 Bacteria 1401
76 Ga0075363_100063795 3300006048 Bacteria 1989
77 Ga0075367_10000028 3300006178 Bacteria 31226
78 Ga0097621_100433269 3300006237 Bacteria 1182
79 Ga0075370_10031616 3300006353 Bacteria 2955
80 Ga0097620_100004300 3300006931 Bacteria 14532
81 Ga0097620_100006150 3300006931 Bacteria 12203
82 Ga0097620_102390458 3300006931 Bacteria 582
83 Ga0099826_10140507 3300006948 Unclassified 1396
84 Ga0105240_10007666 3300009093 Bacteria 15628
85 Ga0105240_10012265 3300009093 Bacteria 11843
86 Ga0105240_10034648 3300009093 Bacteria 6509
87 Ga0105240_10594216 3300009093 Unclassified 1219
88 Ga0105247_10000341 3300009101 Bacteria 40810
89 Ga0105247_10366093 3300009101 Unclassified 1018
90 Ga0105243_10004499 3300009148 Bacteria 11019
91 Ga0105241_10009670 3300009174 Bacteria 7086
92 Ga0105241_10311780 3300009174 Unclassified 1354
93 Ga0105248_10090828 3300009177 Bacteria 3439
94 Ga0105237_10001092 3300009545 Bacteria 36314
95 Ga0105237_10011013 3300009545 Bacteria 9594
96 Ga0105237_10583547 3300009545 Bacteria 1125
97 Ga0105238_10561390 3300009551 Bacteria 1147
98 Ga0105249_10012256 3300009553 Bacteria 7553
99 Ga0105249_10216650 3300009553 Bacteria 1882
100 Ga0105239_10001853 3300010375 Bacteria 27666
101 Ga0105239_10100249 3300010375 Bacteria 3203
102 Ga0105239_10818159 3300010375 Bacteria 1067
103 Ga0105246_10383155 3300011119 Bacteria 1162
104 Ga0157373_10071506 3300013100 Bacteria 2450
105 Ga0157370_10010836 3300013104 Bacteria 9576
106 Ga0157378_11458824 3300013297 Unclassified 728
107 Ga0157372_11212573 3300013307 Bacteria 872
108 Ga0157375_13646285 3300013308 Unclassified 512
109 Ga0163163_10125606 3300014325 Bacteria 2603
110 Ga0157380_10017036 3300014326 Bacteria 5370
111 Ga0157379_10091730 3300014968 Bacteria 2725
112 Ga0209257_1006657 3300025304 Bacteria 7334
113 Ga0207656_10003658 3300025321 Bacteria 5314
114 Ga0207710_10011419 3300025900 Bacteria 3740
115 Ga0207647_10001478 3300025904 Bacteria 18054
116 Ga0207705_10028871 3300025909 Bacteria 3954
117 Ga0207654_10037210 3300025911 Bacteria 2723
118 Ga0207654_10301709 3300025911 Bacteria 1089
119 Ga0207707_10517072 3300025912 Bacteria 1017
120 Ga0207695_10006576 3300025913 Bacteria 15034
121 Ga0207695_10109082 3300025913 Bacteria 2751
122 Ga0207671_10008116 3300025914 Bacteria 8963
123 Ga0207671_10014697 3300025914 Bacteria 6173
124 Ga0207662_10004348 3300025918 Bacteria 7441
125 Ga0207649_10290480 3300025920 Unclassified 1192
126 Ga0207652_10030639 3300025921 Bacteria 4506
127 Ga0207694_10567261 3300025924 Bacteria 953
128 Ga0207650_10309990 3300025925 Bacteria 1291
129 Ga0207659_10032591 3300025926 Bacteria 3578
130 Ga0207700_11580649 3300025928 Unclassified 581
131 Ga0207706_10040987 3300025933 Bacteria 4105
132 Ga0207706_10108505 3300025933 Bacteria 2443
133 Ga0207709_10205161 3300025935 Bacteria 1411
134 Ga0207670_10529328 3300025936 Unclassified 960
135 Ga0207670_10668893 3300025936 Bacteria 857
136 Ga0207704_10035716 3300025938 Bacteria 2851
137 Ga0207704_11007953 3300025938 Bacteria 704
138 Ga0207691_10626988 3300025940 Unclassified 909
139 Ga0207711_10526380 3300025941 Bacteria 1102
140 Ga0207689_10009003 3300025942 Bacteria 8646
141 Ga0207661_10529599 3300025944 Bacteria 1078
142 Ga0207661_10621228 3300025944 Unclassified 992
143 Ga0207661_10826187 3300025944 Bacteria 853
144 Ga0207667_10010557 3300025949 Bacteria 10790
145 Ga0207667_10074939 3300025949 Bacteria 3514
146 Ga0207651_10355295 3300025960 Bacteria 1235
147 Ga0207712_10095876 3300025961 Bacteria 2195
148 Ga0207658_11670890 3300025986 Unclassified 582
149 Ga0207677_10251572 3300026023 Bacteria 1435
150 Ga0207703_10499929 3300026035 Bacteria 1141
151 Ga0207703_10615615 3300026035 Bacteria 1028
152 Ga0207639_10002355 3300026041 Bacteria 12700
153 Ga0207639_11971448 3300026041 Unclassified 545
154 Ga0207678_10000402 3300026067 Bacteria 39370
155 Ga0207678_10071780 3300026067 Bacteria 2968
156 Ga0207708_10006698 3300026075 Bacteria 8522
157 Ga0207702_10004355 3300026078 Bacteria 12623
158 Ga0207702_10327889 3300026078 Bacteria 1460
159 Ga0207641_10025184 3300026088 Bacteria 4906
160 Ga0207648_10005301 3300026089 Bacteria 13010
161 Ga0207676_10737421 3300026095 Bacteria 957
162 Ga0207674_10538444 3300026116 Bacteria 1128
163 Ga0207674_11857300 3300026116 Unclassified 569
164 Ga0207675_100009518 3300026118 Bacteria 9089
165 Ga0207683_10301762 3300026121 Bacteria 1465
166 Ga0207698_10008392 3300026142 Bacteria 6532
167 Ga0209813_10000019 3300027866 Bacteria 75575
168 Ga0268266_10145667 3300028379 Bacteria 2129
169 Ga0268266_10806130 3300028379 Bacteria 907
170 Ga0268264_10040594 3300028381 Bacteria 3845
171 Ga0268264_10090723 3300028381 Bacteria 2634
172 Ga0265331_10012361 3300031250 Bacteria 4626
173 Ga0265327_10000525 3300031251 Bacteria 66250
174 Ga0307408_100218863 3300031548 Bacteria 1552
175 Ga0307408_100542500 3300031548 Bacteria 1025
176 Ga0307410_10068153 3300031852 Bacteria 2456
177 Ga0307406_10034097 3300031901 Bacteria 3120
178 Ga0307407_10217781 3300031903 Bacteria 1289
179 Ga0307409_100441705 3300031995 Bacteria 1253
180 Ga0307416_100016778 3300032002 Bacteria 5102
181 Ga0307414_10024633 3300032004 Bacteria 3841
182 Ga0307411_10241858 3300032005 Bacteria 1413
183 Ga0373950_0000015 3300034818 Bacteria 281101
184 Ga0373923_0229763 3300035111 Bacteria 864
185 Ga0373936_0050495 3300035113 Bacteria 1682
186 Ga0373943_0010247 3300035170 Bacteria 4204
187 Ga0373955_0097025 3300035172 Bacteria 1687
188 Ga0373961_0046813 3300035241 Bacteria 1269
189 Ga0373935_0243144 3300035692 Bacteria 1257
190 Ga0373935_0624427 3300035692 Bacteria 789
191 Ga0373933_0512931 3300035724 Bacteria 786
192 Ga0373937_0584154 3300036401 Bacteria 1061
193 Ga0373925_0049251 3300037068 Bacteria 3140
194 Ga0395900_0698752 3300037418 Bacteria 948
195 Ga0395900_1794929 3300037418 Bacteria 524
196 Ga0395898_0165177 3300037466 Bacteria 2117
197 Ga0395901_0467326 3300038443 Bacteria 1288
198 Ga0436360_0211948 3300039438 Bacteria 945
199 Ga0436363_1481412 3300039450 Bacteria 782
200 Ga0466961_0315954 3300044693 Unclassified 953
201 Ga0495627_000206 3300046453 Bacteria 63802
202 Ga0495638_0000012 3300046460 Bacteria 435577
203 Ga0495664_0051204 3300046477 Bacteria 2452
204 Ga0495584_0008076 3300046491 Bacteria 5471
205 Ga0495585_0179309 3300046492 Bacteria 1090
206 Ga0495583_0000358 3300046506 Bacteria 71745
207 Ga0495583_0000411 3300046506 Bacteria 65040
208 Ga0495606_0001416 3300046507 Bacteria 32217
209 Ga0495606_0047472 3300046507 Bacteria 2830
210 Ga0495610_0272088 3300046512 Unclassified 663
211 Ga0495628_0029762 3300046516 Bacteria 4426
212 Ga0495630_0173024 3300046517 Bacteria 1645
213 Ga0495632_0000095 3300046519 Bacteria 89499
214 Ga0495632_0000832 3300046519 Bacteria 27194
215 Ga0495637_0001011 3300046520 Bacteria 17698
216 Ga0495643_0000038 3300046522 Bacteria 236010
217 Ga0495643_0466058 3300046522 Unclassified 548
218 Ga0495648_0000038 3300046524 Bacteria 191612
219 Ga0495648_0010720 3300046524 Bacteria 6959
220 Ga0495663_0000028 3300046525 Bacteria 89526
221 Ga0495645_0245001 3300046543 Bacteria 1194
222 Ga0495633_0000136 3300046558 Bacteria 97314
223 Ga0495633_0001114 3300046558 Bacteria 21590
224 Ga0495633_0018816 3300046558 Bacteria 3501
225 Ga0495633_0031576 3300046558 Bacteria 2566
226 Ga0495668_0674086 3300046616 Bacteria 572
227 Ga0495634_0006775 3300046642 Bacteria 8678
228 Ga0495611_0024357 3300046648 Bacteria 2632
229 Ga0495625_0233433 3300046660 Bacteria 1200
230 Ga0495661_0422243 3300046665 Bacteria 645
231 Ga0495599_0497918 3300046678 Unclassified 717
232 Ga0495670_0036974 3300046691 Bacteria 2433
233 Ga0495671_0000027 3300046692 Bacteria 236011
234 Ga0495671_0000034 3300046692 Bacteria 195385
235 Ga0495674_0003363 3300047319 Bacteria 15526
236 Ga0495672_0313406 3300047320 Bacteria 739
237 Ga0495673_0000013 3300047469 Bacteria 612902
238 Ga0495681_0001132 3300047470 Bacteria 20269
239 Ga0495686_0000300 3300047472 Bacteria 85146
240 Ga0495686_0002745 3300047472 Bacteria 16093
241 Ga0495686_0016221 3300047472 Bacteria 5057
242 Ga0495686_0248770 3300047472 Unclassified 1000
243 Ga0496103_0506356 3300048906 Bacteria 772
244 Ga0496107_0300858 3300048910 Bacteria 1194
245 Ga0496108_0272402 3300048911 Bacteria 1474
246 Ga0496109_1414340 3300048912 Unclassified 631
247 Ga0496117_0022828 3300048920 Bacteria 5011
248 Ga0496118_0020233 3300048921 Bacteria 5910
249 Ga0496119_0041102 3300048922 Bacteria 2950
250 Ga0496121_0055757 3300048924 Bacteria 3289
251 Ga0496122_0026811 3300048925 Bacteria 4951
252 Ga0496123_0003423 3300048926 Bacteria 17842
253 Ga0496124_0004789 3300048927 Bacteria 15583
254 Ga0496124_0107079 3300048927 Bacteria 2256
255 Ga0496124_0362273 3300048927 Bacteria 1021
256 Ga0496125_0086102 3300048928 Bacteria 2378
257 Ga0495682_0009051 3300049460 Bacteria 3905
258 Ga0501034_0282789 3300049571 Bacteria 1598
259 Ga0501067_0000609 3300049583 Bacteria 19277
260 Ga0501073_0000272 3300049589 Bacteria 34209
261 Ga0501077_0604840 3300049593 Unclassified 704
262 Ga0501083_0248129 3300049744 Bacteria 1159
263 nmdc:mga03n38_42376_c1 3300050490 Bacteria 1989
264 nmdc:mga06z11_255_c1 3300050494 Bacteria 20756
265 nmdc:mga04h51_62_c1 3300050495 Bacteria 34326
266 nmdc:mga07m45_47781_c1 3300050496 Bacteria 2406
267 Ga0500643_000233 3300053087 Bacteria 51480
268 Ga0500566_0211179 3300053094 Bacteria 972
269 Ga0500641_0001800 3300053096 Bacteria 7597
270 Ga0500555_000174 3300053103 Bacteria 29409
271 Ga0500556_0002681 3300053104 Bacteria 5538
272 Ga0500556_0003101 3300053104 Bacteria 4960
273 Ga0500562_000507 3300053108 Bacteria 9457
274 Ga0500562_001325 3300053108 Bacteria 6108
275 Ga0500562_002487 3300053108 Bacteria 4609
276 Ga0500572_132225 3300053111 Bacteria 811
277 Ga0500593_219717 3300053117 Bacteria 669
278 Ga0500595_027384 3300053119 Bacteria 1952
279 Ga0500573_0268834 3300053140 Bacteria 869
280 Ga0500577_0114247 3300053142 Bacteria 1117
281 Ga0500616_0010650 3300053153 Bacteria 5487
282 Ga0500616_0012751 3300053153 Bacteria 4907
283 Ga0500616_0021483 3300053153 Bacteria 3619
284 Ga0500622_0007184 3300053156 Bacteria 6348
285 Ga0500622_0031145 3300053156 Bacteria 2798
286 Ga0500622_0140318 3300053156 Bacteria 1153
287 Ga0500627_0225479 3300053158 Unclassified 835
288 Ga0500645_000517 3300053730 Bacteria 25761
289 Ga0500645_002520 3300053730 Bacteria 8097
290 Ga0500645_054861 3300053730 Bacteria 1158
291 2512644442 2512564014 Bacteria 4639632
292 Ga0496122_0296165
293 JGI24736J21556_1000471
294 JGI24741J21665_1000255
295 JGI24740J21852_10001194
296 JGI24739J22299_10001497
297 JGI24737J22298_10001886
298 JGI24735J21928_10001449
299 JGI24738J21930_10002069
300 rootH1_10053271
301 Ga0070658_10277982
302 Ga0070658_10281509
303 Ga0070683_100493910
304 Ga0070683_100598382
305 Ga0070683_100632793
306 Ga0070690_100010038
307 Ga0070670_100270445
308 Ga0068869_100206908
309 Ga0070666_10056410
310 Ga0068868_100185451
311 Ga0070660_100011131
312 Ga0070660_100225097
313 Ga0070689_100465472
314 Ga0070689_100562517
315 Ga0070661_100010771
316 Ga0070668_100018147
317 Ga0070668_100435860
318 Ga0070669_100976150
319 Ga0070675_100046018
320 Ga0070671_100009948
321 Ga0070674_100048014
322 Ga0070673_100110286
323 Ga0070673_101270017
324 Ga0070688_100013859
325 Ga0070701_10010256
326 Ga0070711_100970022
327 Ga0070705_100056436
328 Ga0070700_100075500
329 Ga0070663_100003984
330 Ga0070663_100119519
331 Ga0070678_100046537
332 Ga0070662_100558226
333 Ga0070681_10561796
334 Ga0068867_100038063
335 Ga0070684_100095655
336 Ga0068853_101167997
337 Ga0070672_100060620
338 Ga0070672_100094079
339 Ga0070665_100029466
340 Ga0070665_101404828
341 Ga0070704_100168295
342 Ga0068855_100023948
343 Ga0068855_100105769
344 Ga0070664_100015126
345 Ga0068857_100206566
346 Ga0068857_100893225
347 Ga0068857_101029716
348 Ga0068856_100007021
349 Ga0070702_100082912
350 Ga0068852_100152199
351 Ga0068859_100004300
352 Ga0068859_100006150
353 Ga0068859_102389373
354 Ga0068866_10480576
355 Ga0068861_100010840
356 Ga0068861_101972236
357 Ga0068851_10040191
358 Ga0068870_10051367
359 Ga0068863_100012892
360 Ga0068863_100107449
361 Ga0068858_100006139
362 Ga0068858_100056022
363 Ga0068860_100012276
364 Ga0068860_100084236
365 Ga0068862_100012359
366 Ga0081538_10105643
367 Ga0075363_100063795
368 Ga0075367_10000028
369 Ga0097621_100433269
370 Ga0075370_10031616
371 Ga0097620_100004300
372 Ga0097620_100006150
373 Ga0097620_102390458
374 Ga0099826_10140507
375 Ga0105240_10007666
376 Ga0105240_10012265
377 Ga0105240_10034648
378 Ga0105240_10594216
379 Ga0105247_10000341
380 Ga0105247_10366093
381 Ga0105243_10004499
382 Ga0105241_10009670
383 Ga0105241_10311780
384 Ga0105248_10090828
385 Ga0105237_10001092
386 Ga0105237_10011013
387 Ga0105237_10583547
388 Ga0105238_10561390
389 Ga0105249_10012256
390 Ga0105249_10216650
391 Ga0105239_10001853
392 Ga0105239_10100249
393 Ga0105239_10818159
394 Ga0105246_10383155
395 Ga0157373_10071506
396 Ga0157370_10010836
397 Ga0157378_11458824
398 Ga0157372_11212573
399 Ga0157375_13646285
400 Ga0163163_10125606
401 Ga0157380_10017036
402 Ga0157379_10091730
403 Ga0209257_1006657
404 Ga0207656_10003658
405 Ga0207710_10011419
406 Ga0207647_10001478
407 Ga0207705_10028871
408 Ga0207654_10037210
409 Ga0207654_10301709
410 Ga0207707_10517072
411 Ga0207695_10006576
412 Ga0207695_10109082
413 Ga0207671_10008116
414 Ga0207671_10014697
415 Ga0207662_10004348
416 Ga0207649_10290480
417 Ga0207652_10030639
418 Ga0207694_10567261
419 Ga0207650_10309990
420 Ga0207659_10032591
421 Ga0207700_11580649
422 Ga0207706_10040987
423 Ga0207706_10108505
424 Ga0207709_10205161
425 Ga0207670_10529328
426 Ga0207670_10668893
427 Ga0207704_10035716
428 Ga0207704_11007953
429 Ga0207691_10626988
430 Ga0207711_10526380
431 Ga0207689_10009003
432 Ga0207661_10529599
433 Ga0207661_10621228
434 Ga0207661_10826187
435 Ga0207667_10010557
436 Ga0207667_10074939
437 Ga0207651_10355295
438 Ga0207712_10095876
439 Ga0207658_11670890
440 Ga0207677_10251572
441 Ga0207703_10499929
442 Ga0207703_10615615
443 Ga0207639_10002355
444 Ga0207639_11971448
445 Ga0207678_10000402
446 Ga0207678_10071780
447 Ga0207708_10006698
448 Ga0207702_10004355
449 Ga0207702_10327889
450 Ga0207641_10025184
451 Ga0207648_10005301
452 Ga0207676_10737421
453 Ga0207674_10538444
454 Ga0207674_11857300
455 Ga0207675_100009518
456 Ga0207683_10301762
457 Ga0207698_10008392
458 Ga0209813_10000019
459 Ga0268266_10145667
460 Ga0268266_10806130
461 Ga0268264_10040594
462 Ga0268264_10090723
463 Ga0265331_10012361
464 Ga0265327_10000525
465 Ga0307408_100218863
466 Ga0307408_100542500
467 Ga0307410_10068153
468 Ga0307406_10034097
469 Ga0307407_10217781
470 Ga0307409_100441705
471 Ga0307416_100016778
472 Ga0307414_10024633
473 Ga0307411_10241858
474 Ga0373950_0000015
475 Ga0373923_0229763
476 Ga0373936_0050495
477 Ga0373943_0010247
478 Ga0373955_0097025
479 Ga0373961_0046813
480 Ga0373935_0243144
481 Ga0373935_0624427
482 Ga0373933_0512931
483 Ga0373937_0584154
484 Ga0373925_0049251
485 Ga0395900_0698752
486 Ga0395900_1794929
487 Ga0395898_0165177
488 Ga0395901_0467326
489 Ga0436360_0211948
490 Ga0436363_1481412
491 Ga0466961_0315954
492 Ga0495627_000206
493 Ga0495638_0000012
494 Ga0495664_0051204
495 Ga0495584_0008076
496 Ga0495585_0179309
497 Ga0495583_0000358
498 Ga0495583_0000411
499 Ga0495606_0001416
500 Ga0495606_0047472
501 Ga0495610_0272088
502 Ga0495628_0029762
503 Ga0495630_0173024
504 Ga0495632_0000095
505 Ga0495632_0000832
506 Ga0495637_0001011
507 Ga0495643_0000038
508 Ga0495643_0466058
509 Ga0495648_0000038
510 Ga0495648_0010720
511 Ga0495663_0000028
512 Ga0495645_0245001
513 Ga0495633_0000136
514 Ga0495633_0001114
515 Ga0495633_0018816
516 Ga0495633_0031576
517 Ga0495668_0674086
518 Ga0495634_0006775
519 Ga0495611_0024357
520 Ga0495625_0233433
521 Ga0495661_0422243
522 Ga0495599_0497918
523 Ga0495670_0036974
524 Ga0495671_0000027
525 Ga0495671_0000034
526 Ga0495674_0003363
527 Ga0495672_0313406
528 Ga0495673_0000013
529 Ga0495681_0001132
530 Ga0495686_0000300
531 Ga0495686_0002745
532 Ga0495686_0016221
533 Ga0495686_0248770
534 Ga0496103_0506356
535 Ga0496107_0300858
536 Ga0496108_0272402
537 Ga0496109_1414340
538 Ga0496117_0022828
539 Ga0496118_0020233
540 Ga0496119_0041102
541 Ga0496121_0055757
542 Ga0496122_0026811
543 Ga0496123_0003423
544 Ga0496124_0004789
545 Ga0496124_0107079
546 Ga0496124_0362273
547 Ga0496125_0086102
548 Ga0495682_0009051
549 Ga0501034_0282789
550 Ga0501067_0000609
551 Ga0501073_0000272
552 Ga0501077_0604840
553 Ga0501083_0248129
554 nmdc:mga03n38_42376_c1
555 nmdc:mga06z11_255_c1
556 nmdc:mga04h51_62_c1
557 nmdc:mga07m45_47781_c1
558 Ga0500643_000233
559 Ga0500566_0211179
560 Ga0500641_0001800
561 Ga0500555_000174
562 Ga0500556_0002681
563 Ga0500556_0003101
564 Ga0500562_000507
565 Ga0500562_001325
566 Ga0500562_002487
567 Ga0500572_132225
568 Ga0500593_219717
569 Ga0500595_027384
570 Ga0500573_0268834
571 Ga0500577_0114247
572 Ga0500616_0010650
573 Ga0500616_0012751
574 Ga0500616_0021483
575 Ga0500622_0007184
576 Ga0500622_0031145
577 Ga0500622_0140318
578 Ga0500627_0225479
579 Ga0500645_000517
580 Ga0500645_002520
581 Ga0500645_054861
582 2512644442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qsg-assembly1.cif.gz_A-2 crystal structure of nad-binding phosphogluconate dehydrogenase-like protein from alicyclobacillus acidocaldarius 0.4258 5 105
1pvp-assembly1.cif.gz_B-2 basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, alshg bound to the engineered recognition site loxm7 0.4174 5 93
2crx-assembly1.cif.gz_B-2 structure of the holliday junction intermediate in cre-loxp site-specific recombination 0.4151 5 93
4ry3-assembly1.cif.gz_A crystal structure of human fanconi-associated nuclease 1 0.3755 6 93
3dcf-assembly1.cif.gz_B crystal structure of transcriptional regulator of the tetr/acrr family (yp_290855.1) from thermobifida fusca yx-er1 at 2.50 a resolution 0.3575 6 106
ID Description Score Start End Superfamily
af_A4IDX8_116_219_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5105 26 86 1.10.472.10
af_P71830_8_201_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.4817 8 102 1.10.357.10
af_Q54YB5_238_462_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4602 5 79 1.25.40.10
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.456 25 79 1.10.10.600
af_Q9VE72_9_143_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4438 8 79 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A249MR91-F1-model_v4 Uncharacterized protein 0.9943 3 140
AF-A0A560X748-F1-model_v4 Uncharacterized protein 0.9894 3 100
AF-W0A8C7-F1-model_v4 Uncharacterized protein 0.9842 5 136
AF-A0A7W4K773-F1-model_v4 Uncharacterized protein 0.9746 9 140
AF-A0A845I3L2-F1-model_v4 ADP-ribosylglycohydrolase family protein 0.9745 3 140

Map