F390564

General Info

Members Datasets Scaffolds Average Seq Length
291 159 582 313

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0099867|Ga0496111_0099867_263_1294
Length 343
Sequence MAGGFFVFLVAFHSYEGKQHMQVSQELFKEAAHEIGLGEEVVSTQTRLSHLKALEAESIYILREAVAEFARPVMLYSIGKDSSVMLRLAQKAFYPGKIPFPLLHVDTSYKFPEMIEFRDRYTREIGAELIVHQNREALAAGANPFALGTQKCCGLLKTKSLLDALSEGGFDAAFGGARRDEEKSRAKERIYSFRDAQGQWDPKNQRPELWNIFNSRIDKGESIRIFPLSNWTELDIWLYIHTENIPIVPLYFAKEREVVVRGGSIVVIHSRDQVLPGEKTQFVSCRMRSLGCVPCTGAIRSHACTVPEIIEEMISFRRSERENRVIDHDEEGSMETKKREGYF

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 3.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.81
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0099867 3300048914 Bacteria 2131
2 Ga0058862_10113360 3300004803 Bacteria 2008
3 Ga0070680_100076024 3300005336 Bacteria 2764
4 Ga0070682_100018573 3300005337 Bacteria 4068
5 Ga0070709_10006772 3300005434 Bacteria 6255
6 Ga0070714_100004359 3300005435 Bacteria 10666
7 Ga0070714_100154761 3300005435 Bacteria 2069
8 Ga0070713_100016093 3300005436 Bacteria 5615
9 Ga0070713_100069261 3300005436 Bacteria 2975
10 Ga0070713_100075914 3300005436 Bacteria 2852
11 Ga0070711_100050759 3300005439 Bacteria 2846
12 Ga0070663_100020777 3300005455 Bacteria 4352
13 Ga0070679_100285842 3300005530 Bacteria 1601
14 Ga0068853_100185917 3300005539 Bacteria 1886
15 Ga0070665_100230227 3300005548 Bacteria 1853
16 Ga0070665_100457074 3300005548 Bacteria 1287
17 Ga0068855_100005760 3300005563 Bacteria 15132
18 Ga0068855_100373761 3300005563 Bacteria 1566
19 Ga0068856_100011509 3300005614 Bacteria 8586
20 Ga0068856_100095869 3300005614 Bacteria 2955
21 Ga0068856_100594156 3300005614 Bacteria 1128
22 Ga0068858_100090341 3300005842 Bacteria 2850
23 Ga0070717_10001670 3300006028 Bacteria 15434
24 Ga0070717_10148671 3300006028 Bacteria 2025
25 Ga0070716_100169040 3300006173 Bacteria 1425
26 Ga0070712_100046454 3300006175 Bacteria 3002
27 Ga0097621_100067145 3300006237 Bacteria 2955
28 Ga0075434_100029411 3300006871 Bacteria 5406
29 Ga0099795_10023585 3300007788 Bacteria 2043
30 Ga0105240_10034698 3300009093 Bacteria 6505
31 Ga0105240_10082853 3300009093 Bacteria 3938
32 Ga0105240_10221667 3300009093 Bacteria 2203
33 Ga0105240_10380051 3300009093 Bacteria 1595
34 Ga0105240_10402289 3300009093 Bacteria 1542
35 Ga0111539_10031361 3300009094 Bacteria 6457
36 Ga0111539_10445948 3300009094 Bacteria 1507
37 Ga0105242_10204783 3300009176 Bacteria 1754
38 Ga0105238_10217941 3300009551 Bacteria 1884
39 Ga0105238_10219171 3300009551 Bacteria 1879
40 Ga0105238_10240078 3300009551 Bacteria 1789
41 Ga0105238_10319976 3300009551 Bacteria 1537
42 Ga0099796_10004449 3300010159 Bacteria 3391
43 Ga0105239_10324200 3300010375 Bacteria 1737
44 Ga0105239_10524600 3300010375 Bacteria 1348
45 Ga0105239_10590013 3300010375 Bacteria 1267
46 Ga0157370_10247185 3300013104 Bacteria 1650
47 Ga0157369_10000396 3300013105 Bacteria 58117
48 Ga0157369_10001357 3300013105 Bacteria 30238
49 Ga0157369_10158460 3300013105 Bacteria 2390
50 Ga0157378_10005072 3300013297 Bacteria 11566
51 Ga0163162_10160159 3300013306 Bacteria 2372
52 Ga0157375_10702651 3300013308 Bacteria 1165
53 Ga0163163_10614088 3300014325 Bacteria 1151
54 Ga0157379_10063568 3300014968 Bacteria 3299
55 Ga0157379_10069237 3300014968 Bacteria 3155
56 Ga0157376_10238944 3300014969 Bacteria 1692
57 Ga0163161_10058394 3300017792 Bacteria 2805
58 Ga0197907_10119347 3300020069 Bacteria 1433
59 Ga0206356_11244728 3300020070 Bacteria 1426
60 Ga0206349_1123456 3300020075 Bacteria 1241
61 Ga0206351_10813248 3300020077 Bacteria 1319
62 Ga0206352_10864160 3300020078 Bacteria 1248
63 Ga0206354_11678114 3300020081 Bacteria 1203
64 Ga0213872_10000579 3300021361 Bacteria 28340
65 Ga0213875_10000109 3300021388 Bacteria 94035
66 Ga0213875_10003916 3300021388 Bacteria 8324
67 Ga0213875_10011003 3300021388 Bacteria 4517
68 Ga0213875_10014724 3300021388 Bacteria 3814
69 Ga0224712_10001627 3300022467 Bacteria 5275
70 Ga0228598_1000773 3300024227 Bacteria 6867
71 Ga0228598_1006370 3300024227 Bacteria 2444
72 Ga0207699_10080251 3300025906 Bacteria 2021
73 Ga0207654_10056086 3300025911 Bacteria 2284
74 Ga0207707_10278347 3300025912 Bacteria 1449
75 Ga0207695_10061049 3300025913 Bacteria 3898
76 Ga0207695_10160926 3300025913 Bacteria 2176
77 Ga0207695_10175503 3300025913 Bacteria 2065
78 Ga0207693_10022608 3300025915 Bacteria 4995
79 Ga0207657_10148312 3300025919 Bacteria 1912
80 Ga0207646_10153372 3300025922 Bacteria 2078
81 Ga0207694_10132263 3300025924 Bacteria 2001
82 Ga0207694_10179812 3300025924 Bacteria 1715
83 Ga0207687_10003871 3300025927 Bacteria 10051
84 Ga0207687_10121590 3300025927 Bacteria 1953
85 Ga0207700_10060802 3300025928 Bacteria 2862
86 Ga0207700_10330413 3300025928 Bacteria 1323
87 Ga0207664_10002689 3300025929 Bacteria 11794
88 Ga0207686_10137824 3300025934 Bacteria 1682
89 Ga0207667_10005956 3300025949 Bacteria 14842
90 Ga0207667_10325718 3300025949 Bacteria 1569
91 Ga0207703_10009916 3300026035 Bacteria 7473
92 Ga0207639_10154376 3300026041 Bacteria 1927
93 Ga0207678_10096025 3300026067 Bacteria 2533
94 Ga0207702_10043946 3300026078 Bacteria 3753
95 Ga0207702_10180922 3300026078 Bacteria 1942
96 Ga0207702_10628937 3300026078 Bacteria 1055
97 Ga0207428_10037521 3300027907 Bacteria 3942
98 Ga0268266_10190372 3300028379 Bacteria 1873
99 Ga0268266_10381641 3300028379 Bacteria 1329
100 Ga0268266_10607014 3300028379 Bacteria 1051
101 Ga0265319_1001048 3300028563 Bacteria 17236
102 Ga0265319_1010784 3300028563 Bacteria 3790
103 Ga0265338_10055789 3300028800 Bacteria 3511
104 Ga0265338_10062343 3300028800 Bacteria 3259
105 Ga0265760_10006446 3300031090 Bacteria 3356
106 Ga0265332_10049282 3300031238 Bacteria 1811
107 Ga0265320_10000061 3300031240 Bacteria 101367
108 Ga0265325_10006793 3300031241 Bacteria 6920
109 Ga0265325_10008409 3300031241 Bacteria 6094
110 Ga0265325_10012887 3300031241 Bacteria 4769
111 Ga0265325_10105357 3300031241 Bacteria 1376
112 Ga0265329_10000191 3300031242 Bacteria 31583
113 Ga0265339_10001171 3300031249 Bacteria 19815
114 Ga0265331_10000192 3300031250 Bacteria 75526
115 Ga0265331_10014655 3300031250 Bacteria 4165
116 Ga0265331_10068945 3300031250 Bacteria 1657
117 Ga0265316_10000637 3300031344 Bacteria 39071
118 Ga0265316_10002209 3300031344 Bacteria 20461
119 Ga0265316_10022364 3300031344 Bacteria 5332
120 Ga0265316_10023476 3300031344 Bacteria 5181
121 Ga0265316_10035744 3300031344 Bacteria 4022
122 Ga0307408_100069133 3300031548 Bacteria 2603
123 Ga0307408_100222469 3300031548 Bacteria 1541
124 Ga0265313_10008052 3300031595 Bacteria 7059
125 Ga0265313_10088509 3300031595 Bacteria 1394
126 Ga0265314_10004772 3300031711 Bacteria 12423
127 Ga0265342_10000566 3300031712 Bacteria 39108
128 Ga0307413_10197146 3300031824 Bacteria 1451
129 Ga0307410_10002284 3300031852 Bacteria 9192
130 Ga0307410_10345498 3300031852 Bacteria 1187
131 Ga0307409_100002401 3300031995 Bacteria 9772
132 Ga0307414_10235565 3300032004 Bacteria 1512
133 Ga0307411_10150680 3300032005 Bacteria 1728
134 Ga0307415_100010641 3300032126 Bacteria 5219
135 Ga0373926_0003787 3300035083 Bacteria 4929
136 Ga0373926_0052249 3300035083 Bacteria 1476
137 Ga0373944_0027134 3300035089 Bacteria 1696
138 Ga0373923_0001718 3300035111 Bacteria 6437
139 Ga0373923_0001991 3300035111 Bacteria 6138
140 Ga0373923_0060918 3300035111 Bacteria 1603
141 Ga0373954_0026654 3300035118 Bacteria 2650
142 Ga0373956_0011138 3300035119 Bacteria 3703
143 Ga0373943_0041657 3300035170 Bacteria 2221
144 Ga0373955_0030389 3300035172 Bacteria 2820
145 Ga0373924_0000685 3300035410 Bacteria 10538
146 Ga0373924_0050930 3300035410 Bacteria 1716
147 Ga0373935_0002525 3300035692 Bacteria 10489
148 Ga0373935_0065520 3300035692 Bacteria 2332
149 Ga0373935_0129245 3300035692 Bacteria 1696
150 Ga0373927_0006276 3300035695 Bacteria 8114
151 Ga0373927_0010413 3300035695 Bacteria 6201
152 Ga0373927_0028819 3300035695 Bacteria 3620
153 Ga0373933_0002589 3300035724 Bacteria 10133
154 Ga0373947_0015657 3300035725 Bacteria 4356
155 Ga0373947_0026325 3300035725 Bacteria 3398
156 Ga0373947_0092777 3300035725 Bacteria 1886
157 Ga0373937_0000455 3300036401 Bacteria 37834
158 Ga0373937_0007049 3300036401 Bacteria 9704
159 Ga0373937_0031061 3300036401 Bacteria 4837
160 Ga0373937_0045723 3300036401 Bacteria 4001
161 Ga0373937_0110362 3300036401 Bacteria 2558
162 Ga0373937_0172252 3300036401 Bacteria 2031
163 Ga0373925_0137734 3300037068 Bacteria 1908
164 Ga0373925_0142307 3300037068 Bacteria 1878
165 Ga0436364_0068293 3300037853 Bacteria 8533
166 Ga0436364_0096402 3300037853 Bacteria 1106
167 Ga0436364_0189121 3300037853 Bacteria 8663
168 Ga0436364_0270892 3300037853 Bacteria 2372
169 Ga0436364_0278774 3300037853 Bacteria 400541
170 Ga0436364_0637671 3300037853 Bacteria 8793
171 Ga0436364_0717441 3300037853 Bacteria 2461
172 Ga0436364_0806561 3300037853 Bacteria 5696
173 Ga0436364_0936160 3300037853 Bacteria 3665
174 Ga0436364_0991058 3300037853 Bacteria 2433
175 Ga0436364_1097977 3300037853 Bacteria 5776
176 Ga0436364_1229753 3300037853 Bacteria 2082
177 Ga0436364_1236746 3300037853 Bacteria 5553
178 Ga0436365_0150596 3300039437 Bacteria 5128
179 Ga0436365_0160175 3300039437 Bacteria 1679
180 Ga0436365_0290876 3300039437 Bacteria 3891
181 Ga0436365_1076875 3300039437 Bacteria 1302
182 Ga0436360_0267370 3300039438 Bacteria 6322
183 Ga0436361_0754359 3300039447 Bacteria 78520
184 Ga0436363_0942473 3300039450 Bacteria 3579
185 Ga0436362_0165050 3300039453 Bacteria 7517
186 Ga0436362_0338802 3300039453 Bacteria 1830
187 Ga0439448_0060146 3300042005 Bacteria 1255
188 Ga0439432_053736 3300042006 Bacteria 1252
189 Ga0466967_0183468 3300045976 Bacteria 1975
190 Ga0495592_0014284 3300046454 Bacteria 6030
191 Ga0495592_0093439 3300046454 Bacteria 2154
192 Ga0495592_0155605 3300046454 Bacteria 1577
193 Ga0495651_0000658 3300046462 Bacteria 26766
194 Ga0495651_0002665 3300046462 Bacteria 13856
195 Ga0495651_0009507 3300046462 Bacteria 7466
196 Ga0495651_0009786 3300046462 Bacteria 7371
197 Ga0495653_0051010 3300046463 Bacteria 3179
198 Ga0495653_0098922 3300046463 Bacteria 2117
199 Ga0495653_0194618 3300046463 Bacteria 1381
200 Ga0495580_0001300 3300046472 Bacteria 22053
201 Ga0495580_0016614 3300046472 Bacteria 5520
202 Ga0495580_0044102 3300046472 Bacteria 3173
203 Ga0495639_0094821 3300046475 Bacteria 1403
204 Ga0495664_0004939 3300046477 Bacteria 7300
205 Ga0495664_0040418 3300046477 Bacteria 2758
206 Ga0495664_0075211 3300046477 Bacteria 2021
207 Ga0495594_0208453 3300046499 Bacteria 1114
208 Ga0495608_0034514 3300046511 Bacteria 3414
209 Ga0495608_0046817 3300046511 Bacteria 2877
210 Ga0495618_0018600 3300046514 Bacteria 4267
211 Ga0495628_0007267 3300046516 Bacteria 9595
212 Ga0495628_0047161 3300046516 Bacteria 3420
213 Ga0495630_0023307 3300046517 Bacteria 4576
214 Ga0495666_0024466 3300046526 Bacteria 2983
215 Ga0495652_0006757 3300046529 Bacteria 10640
216 Ga0495652_0017258 3300046529 Bacteria 6445
217 Ga0495665_0134990 3300046531 Bacteria 1291
218 Ga0495640_0055685 3300046533 Bacteria 2705
219 Ga0495586_0003279 3300046535 Bacteria 8695
220 Ga0495587_0001444 3300046536 Bacteria 15837
221 Ga0495587_0007202 3300046536 Bacteria 7218
222 Ga0495587_0143255 3300046536 Bacteria 1363
223 Ga0495645_0013444 3300046543 Bacteria 5787
224 Ga0495645_0097162 3300046543 Bacteria 2098
225 Ga0495645_0129269 3300046543 Bacteria 1772
226 Ga0495667_0000984 3300046559 Bacteria 18434
227 Ga0495667_0006113 3300046559 Bacteria 8151
228 Ga0495667_0093979 3300046559 Bacteria 1942
229 Ga0495667_0118807 3300046559 Bacteria 1707
230 Ga0495667_0183932 3300046559 Bacteria 1340
231 Ga0495635_0014044 3300046663 Bacteria 5604
232 Ga0495657_0070330 3300046675 Bacteria 2287
233 Ga0495657_0104587 3300046675 Bacteria 1800
234 Ga0495599_0042713 3300046678 Bacteria 2845
235 Ga0495599_0078608 3300046678 Bacteria 2060
236 Ga0495623_0002886 3300046679 Bacteria 11319
237 Ga0495623_0027882 3300046679 Bacteria 3635
238 Ga0495646_0008802 3300046680 Bacteria 6410
239 Ga0495646_0091499 3300046680 Bacteria 1755
240 Ga0495647_0115444 3300046681 Bacteria 1124
241 Ga0495658_0041772 3300046683 Bacteria 2557
242 Ga0495613_0067946 3300046689 Bacteria 2600
243 Ga0495624_0011959 3300046690 Bacteria 5949
244 Ga0495600_0016949 3300046809 Bacteria 4631
245 Ga0495604_0016254 3300047317 Bacteria 5947
246 Ga0495604_0027222 3300047317 Bacteria 4548
247 Ga0495674_0004515 3300047319 Bacteria 13386
248 Ga0495674_0010861 3300047319 Bacteria 8609
249 Ga0495674_0160662 3300047319 Bacteria 1880
250 Ga0495674_0317350 3300047319 Bacteria 1270
251 Ga0495674_0343217 3300047319 Bacteria 1213
252 Ga0495680_0001862 3300047322 Bacteria 22190
253 Ga0495680_0006218 3300047322 Bacteria 11131
254 Ga0495675_0000556 3300047444 Bacteria 24036
255 Ga0495675_0000600 3300047444 Bacteria 23240
256 Ga0495675_0041270 3300047444 Bacteria 2941
257 Ga0495684_0000847 3300047471 Bacteria 24711
258 Ga0495684_0002663 3300047471 Bacteria 14151
259 Ga0495684_0010993 3300047471 Bacteria 6999
260 Ga0495684_0048956 3300047471 Bacteria 3231
261 Ga0495684_0146299 3300047471 Bacteria 1770
262 Ga0495593_0020230 3300047673 Bacteria 3727
263 Ga0495602_0000191 3300048088 Bacteria 58052
264 Ga0495602_0014556 3300048088 Bacteria 7981
265 Ga0495602_0027297 3300048088 Bacteria 5488
266 Ga0495602_0229766 3300048088 Bacteria 1395
267 Ga0495602_0242721 3300048088 Bacteria 1347
268 Ga0495614_0007188 3300048089 Bacteria 4965
269 Ga0495614_0078936 3300048089 Bacteria 1425
270 Ga0496102_0092134 3300048905 Bacteria 2806
271 Ga0496104_0016984 3300048907 Bacteria 6621
272 Ga0496104_0044980 3300048907 Bacteria 4150
273 Ga0496108_0099768 3300048911 Bacteria 2476
274 Ga0496110_0253257 3300048913 Bacteria 1602
275 Ga0496111_0008605 3300048914 Bacteria 6766
276 Ga0496112_0004242 3300048915 Bacteria 12099
277 Ga0496112_0051295 3300048915 Bacteria 4047
278 Ga0496112_0136713 3300048915 Bacteria 2421
279 Ga0496112_0448095 3300048915 Bacteria 1229
280 Ga0496113_0000704 3300048916 Bacteria 17112
281 Ga0496113_0440773 3300048916 Bacteria 1046
282 Ga0496115_0213020 3300048918 Bacteria 1596
283 Ga0501034_0038424 3300049571 Bacteria 4847
284 Ga0501034_0548764 3300049571 Bacteria 1065
285 Ga0501044_0007001 3300049823 Bacteria 12407
286 Ga0501044_0408068 3300049823 Bacteria 1270
287 nmdc:mga06r32_413484_c1 3300050510 Bacteria 1330
288 nmdc:mga08y16_2454_c1 3300050511 Bacteria 19034
289 nmdc:mga0n895_98749_c1 3300050512 Bacteria 2927
290 Ga0495612_0006331 3300053078 Bacteria 4880
291 Ga0495619_0066529 3300053085 Bacteria 2405
292 Ga0496111_0099867
293 Ga0058862_10113360
294 Ga0070680_100076024
295 Ga0070682_100018573
296 Ga0070709_10006772
297 Ga0070714_100004359
298 Ga0070714_100154761
299 Ga0070713_100016093
300 Ga0070713_100069261
301 Ga0070713_100075914
302 Ga0070711_100050759
303 Ga0070663_100020777
304 Ga0070679_100285842
305 Ga0068853_100185917
306 Ga0070665_100230227
307 Ga0070665_100457074
308 Ga0068855_100005760
309 Ga0068855_100373761
310 Ga0068856_100011509
311 Ga0068856_100095869
312 Ga0068856_100594156
313 Ga0068858_100090341
314 Ga0070717_10001670
315 Ga0070717_10148671
316 Ga0070716_100169040
317 Ga0070712_100046454
318 Ga0097621_100067145
319 Ga0075434_100029411
320 Ga0099795_10023585
321 Ga0105240_10034698
322 Ga0105240_10082853
323 Ga0105240_10221667
324 Ga0105240_10380051
325 Ga0105240_10402289
326 Ga0111539_10031361
327 Ga0111539_10445948
328 Ga0105242_10204783
329 Ga0105238_10217941
330 Ga0105238_10219171
331 Ga0105238_10240078
332 Ga0105238_10319976
333 Ga0099796_10004449
334 Ga0105239_10324200
335 Ga0105239_10524600
336 Ga0105239_10590013
337 Ga0157370_10247185
338 Ga0157369_10000396
339 Ga0157369_10001357
340 Ga0157369_10158460
341 Ga0157378_10005072
342 Ga0163162_10160159
343 Ga0157375_10702651
344 Ga0163163_10614088
345 Ga0157379_10063568
346 Ga0157379_10069237
347 Ga0157376_10238944
348 Ga0163161_10058394
349 Ga0197907_10119347
350 Ga0206356_11244728
351 Ga0206349_1123456
352 Ga0206351_10813248
353 Ga0206352_10864160
354 Ga0206354_11678114
355 Ga0213872_10000579
356 Ga0213875_10000109
357 Ga0213875_10003916
358 Ga0213875_10011003
359 Ga0213875_10014724
360 Ga0224712_10001627
361 Ga0228598_1000773
362 Ga0228598_1006370
363 Ga0207699_10080251
364 Ga0207654_10056086
365 Ga0207707_10278347
366 Ga0207695_10061049
367 Ga0207695_10160926
368 Ga0207695_10175503
369 Ga0207693_10022608
370 Ga0207657_10148312
371 Ga0207646_10153372
372 Ga0207694_10132263
373 Ga0207694_10179812
374 Ga0207687_10003871
375 Ga0207687_10121590
376 Ga0207700_10060802
377 Ga0207700_10330413
378 Ga0207664_10002689
379 Ga0207686_10137824
380 Ga0207667_10005956
381 Ga0207667_10325718
382 Ga0207703_10009916
383 Ga0207639_10154376
384 Ga0207678_10096025
385 Ga0207702_10043946
386 Ga0207702_10180922
387 Ga0207702_10628937
388 Ga0207428_10037521
389 Ga0268266_10190372
390 Ga0268266_10381641
391 Ga0268266_10607014
392 Ga0265319_1001048
393 Ga0265319_1010784
394 Ga0265338_10055789
395 Ga0265338_10062343
396 Ga0265760_10006446
397 Ga0265332_10049282
398 Ga0265320_10000061
399 Ga0265325_10006793
400 Ga0265325_10008409
401 Ga0265325_10012887
402 Ga0265325_10105357
403 Ga0265329_10000191
404 Ga0265339_10001171
405 Ga0265331_10000192
406 Ga0265331_10014655
407 Ga0265331_10068945
408 Ga0265316_10000637
409 Ga0265316_10002209
410 Ga0265316_10022364
411 Ga0265316_10023476
412 Ga0265316_10035744
413 Ga0307408_100069133
414 Ga0307408_100222469
415 Ga0265313_10008052
416 Ga0265313_10088509
417 Ga0265314_10004772
418 Ga0265342_10000566
419 Ga0307413_10197146
420 Ga0307410_10002284
421 Ga0307410_10345498
422 Ga0307409_100002401
423 Ga0307414_10235565
424 Ga0307411_10150680
425 Ga0307415_100010641
426 Ga0373926_0003787
427 Ga0373926_0052249
428 Ga0373944_0027134
429 Ga0373923_0001718
430 Ga0373923_0001991
431 Ga0373923_0060918
432 Ga0373954_0026654
433 Ga0373956_0011138
434 Ga0373943_0041657
435 Ga0373955_0030389
436 Ga0373924_0000685
437 Ga0373924_0050930
438 Ga0373935_0002525
439 Ga0373935_0065520
440 Ga0373935_0129245
441 Ga0373927_0006276
442 Ga0373927_0010413
443 Ga0373927_0028819
444 Ga0373933_0002589
445 Ga0373947_0015657
446 Ga0373947_0026325
447 Ga0373947_0092777
448 Ga0373937_0000455
449 Ga0373937_0007049
450 Ga0373937_0031061
451 Ga0373937_0045723
452 Ga0373937_0110362
453 Ga0373937_0172252
454 Ga0373925_0137734
455 Ga0373925_0142307
456 Ga0436364_0068293
457 Ga0436364_0096402
458 Ga0436364_0189121
459 Ga0436364_0270892
460 Ga0436364_0278774
461 Ga0436364_0637671
462 Ga0436364_0717441
463 Ga0436364_0806561
464 Ga0436364_0936160
465 Ga0436364_0991058
466 Ga0436364_1097977
467 Ga0436364_1229753
468 Ga0436364_1236746
469 Ga0436365_0150596
470 Ga0436365_0160175
471 Ga0436365_0290876
472 Ga0436365_1076875
473 Ga0436360_0267370
474 Ga0436361_0754359
475 Ga0436363_0942473
476 Ga0436362_0165050
477 Ga0436362_0338802
478 Ga0439448_0060146
479 Ga0439432_053736
480 Ga0466967_0183468
481 Ga0495592_0014284
482 Ga0495592_0093439
483 Ga0495592_0155605
484 Ga0495651_0000658
485 Ga0495651_0002665
486 Ga0495651_0009507
487 Ga0495651_0009786
488 Ga0495653_0051010
489 Ga0495653_0098922
490 Ga0495653_0194618
491 Ga0495580_0001300
492 Ga0495580_0016614
493 Ga0495580_0044102
494 Ga0495639_0094821
495 Ga0495664_0004939
496 Ga0495664_0040418
497 Ga0495664_0075211
498 Ga0495594_0208453
499 Ga0495608_0034514
500 Ga0495608_0046817
501 Ga0495618_0018600
502 Ga0495628_0007267
503 Ga0495628_0047161
504 Ga0495630_0023307
505 Ga0495666_0024466
506 Ga0495652_0006757
507 Ga0495652_0017258
508 Ga0495665_0134990
509 Ga0495640_0055685
510 Ga0495586_0003279
511 Ga0495587_0001444
512 Ga0495587_0007202
513 Ga0495587_0143255
514 Ga0495645_0013444
515 Ga0495645_0097162
516 Ga0495645_0129269
517 Ga0495667_0000984
518 Ga0495667_0006113
519 Ga0495667_0093979
520 Ga0495667_0118807
521 Ga0495667_0183932
522 Ga0495635_0014044
523 Ga0495657_0070330
524 Ga0495657_0104587
525 Ga0495599_0042713
526 Ga0495599_0078608
527 Ga0495623_0002886
528 Ga0495623_0027882
529 Ga0495646_0008802
530 Ga0495646_0091499
531 Ga0495647_0115444
532 Ga0495658_0041772
533 Ga0495613_0067946
534 Ga0495624_0011959
535 Ga0495600_0016949
536 Ga0495604_0016254
537 Ga0495604_0027222
538 Ga0495674_0004515
539 Ga0495674_0010861
540 Ga0495674_0160662
541 Ga0495674_0317350
542 Ga0495674_0343217
543 Ga0495680_0001862
544 Ga0495680_0006218
545 Ga0495675_0000556
546 Ga0495675_0000600
547 Ga0495675_0041270
548 Ga0495684_0000847
549 Ga0495684_0002663
550 Ga0495684_0010993
551 Ga0495684_0048956
552 Ga0495684_0146299
553 Ga0495593_0020230
554 Ga0495602_0000191
555 Ga0495602_0014556
556 Ga0495602_0027297
557 Ga0495602_0229766
558 Ga0495602_0242721
559 Ga0495614_0007188
560 Ga0495614_0078936
561 Ga0496102_0092134
562 Ga0496104_0016984
563 Ga0496104_0044980
564 Ga0496108_0099768
565 Ga0496110_0253257
566 Ga0496111_0008605
567 Ga0496112_0004242
568 Ga0496112_0051295
569 Ga0496112_0136713
570 Ga0496112_0448095
571 Ga0496113_0000704
572 Ga0496113_0440773
573 Ga0496115_0213020
574 Ga0501034_0038424
575 Ga0501034_0548764
576 Ga0501044_0007001
577 Ga0501044_0408068
578 nmdc:mga06r32_413484_c1
579 nmdc:mga08y16_2454_c1
580 nmdc:mga0n895_98749_c1
581 Ga0495612_0006331
582 Ga0495619_0066529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

71

298

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8176 4 208
4bwv-assembly1.cif.gz_B structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens 0.798 2 206
2oq2-assembly2.cif.gz_D crystal structure of yeast paps reductase with pap, a product complex 0.7934 12 204
2dpl-assembly1.cif.gz_A crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.7685 5 200
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.7638 4 208
ID Description Score Start End Superfamily
af_Q9VJY1_8_244_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8073 1 205 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8068 4 208 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7985 4 208 3.40.50.620
4bwvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.798 2 206 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7934 12 204 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3S0F5T9-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 1.002 4 85 GO:0004781
AF-A0A4Q5YQJ4-F1-model_v4 Sulfate adenylyltransferase small subunit 1 4 84 GO:0016779
AF-A0A2V9H327-F1-model_v4 Sulfate adenylyltransferase subunit CysD 0.999 4 91 GO:0016779
AF-A0A7V8NUL1-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9979 3 86 GO:0003824
AF-A0A2R7IS70-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9972 4 83 GO:0016779

Map