F390543

General Info

Members Datasets Scaffolds Average Seq Length
291 212 582 193

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0089085|Ga0495658_0089085_690_1394
Length 234
Sequence MSKAVSAATDGAIERIDGDSGSWGRGSRLVLGGSPQPVREEDEVAEVLLFHHALGRTAGIEAFADELRRAGHVVHVPDLFDGRTFATIDEGVAYAETLGFGEVIERGVRVADQLPAELVYAGFSLGVVPAQKLAQTRSGARGALLFYSCVPTSEFGSAWPAEVPVQIHGMDADPIFVGEGDIDAARALVESAPHAELFLYPGDQHYFADSTLPSYDADATALLTRRVLDFLATR

Samples

Sample ID Description Type Environment
1 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
96 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.37
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 3.09
Rhizosphere 92.44
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495658_0089085 3300046683 Bacteria 1825
2 JGI25406J46586_10003574 3300003203 Bacteria 7288
3 Ga0070658_10000052 3300005327 Bacteria 116625
4 Ga0070658_10079205 3300005327 Bacteria 2698
5 Ga0070658_10882944 3300005327 Unclassified 777
6 Ga0070692_10582019 3300005345 Unclassified 738
7 Ga0070714_100130712 3300005435 Bacteria 2244
8 Ga0070714_100236873 3300005435 Bacteria 1683
9 Ga0070714_100286598 3300005435 Bacteria 1532
10 Ga0070710_10062776 3300005437 Bacteria 2120
11 Ga0070705_100405266 3300005440 Bacteria 1011
12 Ga0070694_100150533 3300005444 Bacteria 1699
13 Ga0070694_100595698 3300005444 Bacteria 890
14 Ga0070708_100210483 3300005445 Bacteria 1822
15 Ga0070663_100560555 3300005455 Bacteria 956
16 Ga0070663_100880847 3300005455 Bacteria 772
17 Ga0068867_100188119 3300005459 Bacteria 1646
18 Ga0070685_10177062 3300005466 Bacteria 1370
19 Ga0070706_100094333 3300005467 Bacteria 2777
20 Ga0070706_100399695 3300005467 Unclassified 1279
21 Ga0070707_100024079 3300005468 Bacteria 5762
22 Ga0070698_100008232 3300005471 Bacteria 11279
23 Ga0070698_100134128 3300005471 Bacteria 2430
24 Ga0070698_100581380 3300005471 Unclassified 1060
25 Ga0070698_100706047 3300005471 Unclassified 951
26 Ga0070699_100660647 3300005518 Bacteria 954
27 Ga0070679_100031985 3300005530 Bacteria 5203
28 Ga0070679_100259177 3300005530 Bacteria 1694
29 Ga0070679_100475925 3300005530 Bacteria 1193
30 Ga0070697_100064684 3300005536 Bacteria 2987
31 Ga0070695_100033216 3300005545 Bacteria 3228
32 Ga0070696_100031849 3300005546 Bacteria 3616
33 Ga0070693_100647135 3300005547 Bacteria 768
34 Ga0070704_100069545 3300005549 Unclassified 2551
35 Ga0068857_100094202 3300005577 Bacteria 2681
36 Ga0068859_100974408 3300005617 Bacteria 931
37 Ga0068862_100040109 3300005844 Unclassified 3979
38 Ga0081455_10008135 3300005937 Bacteria 10940
39 Ga0081455_10376734 3300005937 Bacteria 993
40 Ga0081539_10001485 3300005985 Bacteria 39732
41 Ga0070715_10051810 3300006163 Bacteria 1768
42 Ga0097621_100510683 3300006237 Bacteria 1090
43 Ga0068871_100064041 3300006358 Bacteria 3009
44 Ga0075428_100452715 3300006844 Unclassified 1375
45 Ga0075428_100679063 3300006844 Bacteria 1098
46 Ga0075431_100216320 3300006847 Bacteria 1955
47 Ga0075433_10146358 3300006852 Unclassified 2100
48 Ga0075433_10766293 3300006852 Bacteria 844
49 Ga0075429_100435909 3300006880 Unclassified 1148
50 Ga0097620_100974427 3300006931 Bacteria 931
51 Ga0111539_10013431 3300009094 Bacteria 10237
52 Ga0111539_10810070 3300009094 Bacteria 1090
53 Ga0105245_10124370 3300009098 Bacteria 2412
54 Ga0105245_10392871 3300009098 Bacteria 1384
55 Ga0114129_10121678 3300009147 Bacteria 3591
56 Ga0114129_10295859 3300009147 Bacteria 2159
57 Ga0105243_10650696 3300009148 Unclassified 1021
58 Ga0105243_11473009 3300009148 Unclassified 704
59 Ga0105248_10109543 3300009177 Bacteria 3114
60 Ga0105237_10349610 3300009545 Bacteria 1483
61 Ga0105237_10466716 3300009545 Bacteria 1268
62 Ga0105249_10017859 3300009553 Bacteria 6303
63 Ga0105249_10038863 3300009553 Unclassified 4319
64 Ga0157374_10319313 3300013296 Bacteria 1539
65 Ga0163162_10271888 3300013306 Bacteria 1826
66 Ga0157375_10071635 3300013308 Bacteria 3480
67 Ga0157380_10063691 3300014326 Bacteria 2957
68 Ga0163161_10498670 3300017792 Bacteria 991
69 Ga0197907_11356430 3300020069 Bacteria 1579
70 Ga0206356_10153200 3300020070 Bacteria 1571
71 Ga0206354_10473410 3300020081 Bacteria 1887
72 Ga0206353_10699629 3300020082 Bacteria 1067
73 Ga0213874_10038753 3300021377 Bacteria 1416
74 Ga0213876_10009917 3300021384 Bacteria 5120
75 Ga0207642_10058963 3300025899 Bacteria 1773
76 Ga0207688_10024313 3300025901 Bacteria 3321
77 Ga0207705_10000774 3300025909 Bacteria 26300
78 Ga0207684_10127707 3300025910 Bacteria 2182
79 Ga0207707_10087513 3300025912 Bacteria 2722
80 Ga0207671_10097096 3300025914 Bacteria 2227
81 Ga0207660_10393375 3300025917 Unclassified 1115
82 Ga0207652_10142606 3300025921 Bacteria 2143
83 Ga0207652_10283061 3300025921 Bacteria 1496
84 Ga0207652_10553352 3300025921 Bacteria 1034
85 Ga0207664_10077546 3300025929 Bacteria 2692
86 Ga0207664_10146524 3300025929 Bacteria 2002
87 Ga0207664_10432399 3300025929 Bacteria 1173
88 Ga0207669_10569247 3300025937 Bacteria 917
89 Ga0207661_10071645 3300025944 Bacteria 2833
90 Ga0207712_10560626 3300025961 Bacteria 984
91 Ga0207658_10561959 3300025986 Bacteria 1022
92 Ga0207678_10283289 3300026067 Bacteria 1423
93 Ga0207708_10291203 3300026075 Bacteria 1325
94 Ga0207675_100381888 3300026118 Bacteria 1385
95 Ga0207675_100429072 3300026118 Unclassified 1306
96 Ga0207428_10242573 3300027907 Bacteria 1346
97 Ga0207428_10818575 3300027907 Bacteria 661
98 Ga0268265_10266309 3300028380 Bacteria 1526
99 Ga0265334_10014612 3300028573 Bacteria 3271
100 Ga0265323_10073794 3300028653 Bacteria 1162
101 Ga0265322_10077032 3300028654 Bacteria 946
102 Ga0265320_10100694 3300031240 Bacteria 1331
103 Ga0265325_10174606 3300031241 Bacteria 1004
104 Ga0265327_10018388 3300031251 Unclassified 4335
105 Ga0265316_10112722 3300031344 Bacteria 2058
106 Ga0316575_10017874 3300031665 Unclassified 2698
107 Ga0316575_10035626 3300031665 Bacteria 1957
108 Ga0316575_10039577 3300031665 Unclassified 1861
109 Ga0316575_10203420 3300031665 Bacteria 825
110 Ga0316579_10146276 3300031691 Bacteria 1139
111 Ga0316578_10045554 3300031728 Unclassified 2553
112 Ga0307516_10014235 3300031730 Bacteria 8425
113 Ga0307405_10004937 3300031731 Bacteria 6369
114 Ga0316577_10073685 3300031733 Unclassified 1906
115 Ga0307413_10001064 3300031824 Bacteria 9988
116 Ga0307413_10561470 3300031824 Bacteria 928
117 Ga0307410_10001068 3300031852 Bacteria 11917
118 Ga0307406_10009948 3300031901 Bacteria 5351
119 Ga0307407_10000174 3300031903 Bacteria 19491
120 Ga0307412_10035458 3300031911 Bacteria 3188
121 Ga0307409_100001869 3300031995 Bacteria 10722
122 Ga0307416_100016041 3300032002 Bacteria 5192
123 Ga0307414_10002782 3300032004 Bacteria 9215
124 Ga0307411_10000584 3300032005 Bacteria 13037
125 Ga0307415_100018388 3300032126 Bacteria 4219
126 Ga0307415_100381940 3300032126 Bacteria 1196
127 Ga0307415_101569713 3300032126 Bacteria 631
128 Ga0316583_10150193 3300032133 Bacteria 811
129 Ga0316585_10061025 3300032137 Bacteria 1218
130 Ga0373943_0018126 3300035170 Bacteria 3231
131 Ga0316574_0137288 3300035398 Unclassified 1574
132 Ga0316574_0363469 3300035398 Unclassified 915
133 Ga0316582_0095364 3300036647 Unclassified 1963
134 Ga0316584_0012727 3300036712 Bacteria 5938
135 Ga0316584_0264991 3300036712 Bacteria 1252
136 Ga0316584_0281324 3300036712 Bacteria 1208
137 Ga0395899_0011549 3300037312 Bacteria 6761
138 Ga0395900_0010689 3300037418 Bacteria 9387
139 Ga0395900_0197973 3300037418 Bacteria 2034
140 Ga0395900_0207364 3300037418 Bacteria 1980
141 Ga0395900_0589614 3300037418 Bacteria 1053
142 Ga0395898_0042452 3300037466 Bacteria 4486
143 Ga0395898_0090115 3300037466 Bacteria 2951
144 Ga0395898_0693384 3300037466 Bacteria 960
145 Ga0395905_0083394 3300037471 Bacteria 2994
146 Ga0395905_0256686 3300037471 Bacteria 1632
147 Ga0395905_0614576 3300037471 Bacteria 989
148 Ga0395901_0014606 3300038443 Bacteria 7981
149 Ga0395901_0354403 3300038443 Bacteria 1514
150 Ga0436365_1875488 3300039437 Bacteria 9891
151 Ga0436365_1908015 3300039437 Bacteria 6065
152 Ga0436363_1180337 3300039450 Bacteria 1583
153 Ga0436363_1263974 3300039450 Bacteria 1027
154 Ga0439459_0036792 3300042438 Bacteria 1023
155 Ga0466963_0003090 3300044694 Bacteria 9438
156 Ga0466963_0022928 3300044694 Bacteria 3958
157 Ga0466959_0578254 3300045049 Bacteria 756
158 Ga0451576_0136208 3300045051 Bacteria 2561
159 Ga0466958_0008174 3300045836 Bacteria 5792
160 Ga0466967_0032245 3300045976 Bacteria 4421
161 Ga0466967_0768555 3300045976 Bacteria 956
162 Ga0466967_0904925 3300045976 Bacteria 877
163 Ga0495603_0055078 3300046455 Bacteria 2356
164 Ga0495629_0061831 3300046459 Bacteria 2617
165 Ga0495629_0109612 3300046459 Bacteria 1925
166 Ga0495638_0065506 3300046460 Bacteria 2236
167 Ga0495641_0122204 3300046461 Bacteria 1162
168 Ga0495651_0096327 3300046462 Bacteria 2211
169 Ga0495580_0569672 3300046472 Bacteria 750
170 Ga0495605_0022230 3300046474 Bacteria 3351
171 Ga0495639_0338914 3300046475 Unclassified 754
172 Ga0495662_0118213 3300046476 Bacteria 1300
173 Ga0495584_0059029 3300046491 Bacteria 1930
174 Ga0495585_0224515 3300046492 Bacteria 946
175 Ga0495607_0028208 3300046501 Bacteria 3465
176 Ga0495583_0019497 3300046506 Bacteria 3539
177 Ga0495606_0064466 3300046507 Bacteria 2331
178 Ga0495610_0004437 3300046512 Bacteria 10378
179 Ga0495616_0003925 3300046513 Bacteria 9469
180 Ga0495618_0119746 3300046514 Bacteria 1686
181 Ga0495620_0011446 3300046515 Bacteria 4628
182 Ga0495620_0026857 3300046515 Bacteria 2702
183 Ga0495628_0080028 3300046516 Bacteria 2540
184 Ga0495630_0198318 3300046517 Bacteria 1532
185 Ga0495631_0003531 3300046518 Bacteria 8546
186 Ga0495643_0085921 3300046522 Bacteria 1630
187 Ga0495643_0346405 3300046522 Bacteria 666
188 Ga0495648_0052569 3300046524 Bacteria 2474
189 Ga0495648_0155417 3300046524 Bacteria 1188
190 Ga0495652_0105867 3300046529 Bacteria 2272
191 Ga0495640_0008364 3300046533 Bacteria 8117
192 Ga0495609_0277865 3300046538 Bacteria 685
193 Ga0495597_0018236 3300046542 Bacteria 3296
194 Ga0495597_0154319 3300046542 Bacteria 940
195 Ga0495622_0023168 3300046557 Bacteria 2894
196 Ga0495622_0125431 3300046557 Unclassified 1171
197 Ga0495633_0034088 3300046558 Bacteria 2450
198 Ga0495668_0009833 3300046616 Bacteria 5838
199 Ga0495634_0019602 3300046642 Bacteria 4805
200 Ga0495625_0046103 3300046660 Bacteria 3146
201 Ga0495625_0240042 3300046660 Bacteria 1180
202 Ga0495635_0054936 3300046663 Bacteria 2743
203 Ga0495657_0063307 3300046675 Bacteria 2440
204 Ga0495646_0173700 3300046680 Bacteria 1186
205 Ga0495658_0002093 3300046683 Bacteria 10134
206 Ga0495613_0009068 3300046689 Bacteria 7379
207 Ga0495613_0013104 3300046689 Bacteria 6160
208 Ga0495613_0015433 3300046689 Bacteria 5679
209 Ga0495624_0105580 3300046690 Bacteria 1733
210 Ga0495670_0288032 3300046691 Bacteria 879
211 Ga0495670_0416969 3300046691 Bacteria 726
212 Ga0495649_0045534 3300046694 Bacteria 2391
213 Ga0495589_0022837 3300046794 Bacteria 3189
214 Ga0495581_0102316 3300047315 Bacteria 1665
215 Ga0495604_0048474 3300047317 Bacteria 3304
216 Ga0495676_0015212 3300047321 Bacteria 6860
217 Ga0495680_0060048 3300047322 Bacteria 2933
218 Ga0495683_0072648 3300047323 Bacteria 1687
219 Ga0495677_0099727 3300047445 Bacteria 1099
220 Ga0495685_068438 3300047447 Bacteria 1191
221 Ga0495684_0120067 3300047471 Bacteria 1981
222 Ga0495686_0009393 3300047472 Bacteria 7049
223 Ga0495686_0076039 3300047472 Bacteria 2058
224 Ga0495593_0032934 3300047673 Bacteria 2823
225 Ga0495602_0235678 3300048088 Bacteria 1372
226 Ga0495602_0320597 3300048088 Bacteria 1128
227 Ga0495614_0041258 3300048089 Bacteria 1979
228 Ga0495626_0012598 3300048091 Bacteria 4424
229 Ga0496100_0332135 3300048903 Bacteria 1144
230 Ga0496105_0335402 3300048908 Bacteria 1210
231 Ga0496107_0101456 3300048910 Bacteria 2110
232 Ga0496107_0655632 3300048910 Bacteria 774
233 Ga0496109_0041856 3300048912 Bacteria 4150
234 Ga0496110_0070569 3300048913 Bacteria 3096
235 Ga0496111_0114198 3300048914 Bacteria 1991
236 Ga0496113_0348980 3300048916 Bacteria 1187
237 Ga0496114_0295976 3300048917 Bacteria 1429
238 Ga0496120_0023175 3300048923 Bacteria 3890
239 Ga0496124_0095721 3300048927 Bacteria 2413
240 Ga0495678_028746 3300049459 Bacteria 2342
241 Ga0495678_067974 3300049459 Bacteria 1315
242 Ga0495682_0045237 3300049460 Bacteria 1609
243 Ga0501033_0234730 3300049570 Bacteria 1302
244 Ga0501036_0099157 3300049572 Bacteria 2464
245 Ga0501038_0039101 3300049574 Bacteria 4151
246 Ga0501038_0122407 3300049574 Bacteria 2144
247 Ga0501039_0014488 3300049575 Bacteria 6037
248 Ga0501040_0147373 3300049576 Bacteria 1659
249 Ga0501041_0130624 3300049577 Bacteria 1564
250 Ga0501041_0546489 3300049577 Bacteria 738
251 Ga0501067_0133480 3300049583 Bacteria 1382
252 Ga0501067_0244414 3300049583 Bacteria 999
253 Ga0501067_0527745 3300049583 Bacteria 661
254 Ga0501068_0093580 3300049584 Bacteria 1857
255 Ga0501069_0075187 3300049585 Bacteria 1897
256 Ga0501069_0147689 3300049585 Bacteria 1350
257 Ga0501070_0166611 3300049586 Bacteria 1816
258 Ga0501070_0463445 3300049586 Bacteria 1021
259 Ga0501071_0061516 3300049587 Bacteria 2719
260 Ga0501072_0022469 3300049588 Bacteria 4893
261 Ga0501072_0029466 3300049588 Bacteria 4288
262 Ga0501074_0035500 3300049590 Bacteria 3612
263 Ga0501075_0003008 3300049591 Bacteria 11265
264 Ga0501076_0007147 3300049592 Bacteria 8113
265 Ga0501077_0046000 3300049593 Bacteria 2773
266 Ga0501035_0294046 3300049822 Bacteria 1370
267 Ga0501044_0234178 3300049823 Bacteria 1783
268 Ga0501045_0013044 3300049824 Bacteria 5859
269 Ga0501045_0319515 3300049824 Bacteria 1155
270 Ga0501045_0613944 3300049824 Bacteria 805
271 nmdc:mga05p37_45864_c1 3300050507 Bacteria 5376
272 nmdc:mga05p37_736171_c1 3300050507 Bacteria 1089
273 nmdc:mga05p37_780395_c1 3300050507 Bacteria 1049
274 nmdc:mga09592_303092_c1 3300050508 Bacteria 1385
275 nmdc:mga09592_891739_c1 3300050508 Unclassified 748
276 nmdc:mga0qj67_434203_c1 3300050509 Bacteria 1058
277 nmdc:mga06r32_1119160_c1 3300050510 Unclassified 736
278 nmdc:mga06r32_118458_c1 3300050510 Bacteria 2610
279 nmdc:mga06r32_497052_c1 3300050510 Bacteria 1197
280 nmdc:mga08y16_692645_c1 3300050511 Bacteria 1020
281 nmdc:mga08y16_766693_c1 3300050511 Bacteria 960
282 nmdc:mga0n895_261722_c1 3300050512 Unclassified 1755
283 nmdc:mga0a205_442364_c1 3300050515 Bacteria 1160
284 Ga0495619_0166393 3300053085 Bacteria 1524
285 Ga0500573_0183369 3300053140 Bacteria 1123
286 Ga0500636_0161920 3300053177 Bacteria 1218
287 Ga0500596_007411 3300053735 Bacteria 1799
288 Ga0501084_0081193 3300054114 Bacteria 2719
289 Ga0501082_0023604 3300060353 Bacteria 5305
290 Ga0530510_0024657 3300061734 Bacteria 4295
291 2891329354 2891326441 Bacteria 6439512
292 Ga0495658_0089085
293 JGI25406J46586_10003574
294 Ga0070658_10000052
295 Ga0070658_10079205
296 Ga0070658_10882944
297 Ga0070692_10582019
298 Ga0070714_100130712
299 Ga0070714_100236873
300 Ga0070714_100286598
301 Ga0070710_10062776
302 Ga0070705_100405266
303 Ga0070694_100150533
304 Ga0070694_100595698
305 Ga0070708_100210483
306 Ga0070663_100560555
307 Ga0070663_100880847
308 Ga0068867_100188119
309 Ga0070685_10177062
310 Ga0070706_100094333
311 Ga0070706_100399695
312 Ga0070707_100024079
313 Ga0070698_100008232
314 Ga0070698_100134128
315 Ga0070698_100581380
316 Ga0070698_100706047
317 Ga0070699_100660647
318 Ga0070679_100031985
319 Ga0070679_100259177
320 Ga0070679_100475925
321 Ga0070697_100064684
322 Ga0070695_100033216
323 Ga0070696_100031849
324 Ga0070693_100647135
325 Ga0070704_100069545
326 Ga0068857_100094202
327 Ga0068859_100974408
328 Ga0068862_100040109
329 Ga0081455_10008135
330 Ga0081455_10376734
331 Ga0081539_10001485
332 Ga0070715_10051810
333 Ga0097621_100510683
334 Ga0068871_100064041
335 Ga0075428_100452715
336 Ga0075428_100679063
337 Ga0075431_100216320
338 Ga0075433_10146358
339 Ga0075433_10766293
340 Ga0075429_100435909
341 Ga0097620_100974427
342 Ga0111539_10013431
343 Ga0111539_10810070
344 Ga0105245_10124370
345 Ga0105245_10392871
346 Ga0114129_10121678
347 Ga0114129_10295859
348 Ga0105243_10650696
349 Ga0105243_11473009
350 Ga0105248_10109543
351 Ga0105237_10349610
352 Ga0105237_10466716
353 Ga0105249_10017859
354 Ga0105249_10038863
355 Ga0157374_10319313
356 Ga0163162_10271888
357 Ga0157375_10071635
358 Ga0157380_10063691
359 Ga0163161_10498670
360 Ga0197907_11356430
361 Ga0206356_10153200
362 Ga0206354_10473410
363 Ga0206353_10699629
364 Ga0213874_10038753
365 Ga0213876_10009917
366 Ga0207642_10058963
367 Ga0207688_10024313
368 Ga0207705_10000774
369 Ga0207684_10127707
370 Ga0207707_10087513
371 Ga0207671_10097096
372 Ga0207660_10393375
373 Ga0207652_10142606
374 Ga0207652_10283061
375 Ga0207652_10553352
376 Ga0207664_10077546
377 Ga0207664_10146524
378 Ga0207664_10432399
379 Ga0207669_10569247
380 Ga0207661_10071645
381 Ga0207712_10560626
382 Ga0207658_10561959
383 Ga0207678_10283289
384 Ga0207708_10291203
385 Ga0207675_100381888
386 Ga0207675_100429072
387 Ga0207428_10242573
388 Ga0207428_10818575
389 Ga0268265_10266309
390 Ga0265334_10014612
391 Ga0265323_10073794
392 Ga0265322_10077032
393 Ga0265320_10100694
394 Ga0265325_10174606
395 Ga0265327_10018388
396 Ga0265316_10112722
397 Ga0316575_10017874
398 Ga0316575_10035626
399 Ga0316575_10039577
400 Ga0316575_10203420
401 Ga0316579_10146276
402 Ga0316578_10045554
403 Ga0307516_10014235
404 Ga0307405_10004937
405 Ga0316577_10073685
406 Ga0307413_10001064
407 Ga0307413_10561470
408 Ga0307410_10001068
409 Ga0307406_10009948
410 Ga0307407_10000174
411 Ga0307412_10035458
412 Ga0307409_100001869
413 Ga0307416_100016041
414 Ga0307414_10002782
415 Ga0307411_10000584
416 Ga0307415_100018388
417 Ga0307415_100381940
418 Ga0307415_101569713
419 Ga0316583_10150193
420 Ga0316585_10061025
421 Ga0373943_0018126
422 Ga0316574_0137288
423 Ga0316574_0363469
424 Ga0316582_0095364
425 Ga0316584_0012727
426 Ga0316584_0264991
427 Ga0316584_0281324
428 Ga0395899_0011549
429 Ga0395900_0010689
430 Ga0395900_0197973
431 Ga0395900_0207364
432 Ga0395900_0589614
433 Ga0395898_0042452
434 Ga0395898_0090115
435 Ga0395898_0693384
436 Ga0395905_0083394
437 Ga0395905_0256686
438 Ga0395905_0614576
439 Ga0395901_0014606
440 Ga0395901_0354403
441 Ga0436365_1875488
442 Ga0436365_1908015
443 Ga0436363_1180337
444 Ga0436363_1263974
445 Ga0439459_0036792
446 Ga0466963_0003090
447 Ga0466963_0022928
448 Ga0466959_0578254
449 Ga0451576_0136208
450 Ga0466958_0008174
451 Ga0466967_0032245
452 Ga0466967_0768555
453 Ga0466967_0904925
454 Ga0495603_0055078
455 Ga0495629_0061831
456 Ga0495629_0109612
457 Ga0495638_0065506
458 Ga0495641_0122204
459 Ga0495651_0096327
460 Ga0495580_0569672
461 Ga0495605_0022230
462 Ga0495639_0338914
463 Ga0495662_0118213
464 Ga0495584_0059029
465 Ga0495585_0224515
466 Ga0495607_0028208
467 Ga0495583_0019497
468 Ga0495606_0064466
469 Ga0495610_0004437
470 Ga0495616_0003925
471 Ga0495618_0119746
472 Ga0495620_0011446
473 Ga0495620_0026857
474 Ga0495628_0080028
475 Ga0495630_0198318
476 Ga0495631_0003531
477 Ga0495643_0085921
478 Ga0495643_0346405
479 Ga0495648_0052569
480 Ga0495648_0155417
481 Ga0495652_0105867
482 Ga0495640_0008364
483 Ga0495609_0277865
484 Ga0495597_0018236
485 Ga0495597_0154319
486 Ga0495622_0023168
487 Ga0495622_0125431
488 Ga0495633_0034088
489 Ga0495668_0009833
490 Ga0495634_0019602
491 Ga0495625_0046103
492 Ga0495625_0240042
493 Ga0495635_0054936
494 Ga0495657_0063307
495 Ga0495646_0173700
496 Ga0495658_0002093
497 Ga0495613_0009068
498 Ga0495613_0013104
499 Ga0495613_0015433
500 Ga0495624_0105580
501 Ga0495670_0288032
502 Ga0495670_0416969
503 Ga0495649_0045534
504 Ga0495589_0022837
505 Ga0495581_0102316
506 Ga0495604_0048474
507 Ga0495676_0015212
508 Ga0495680_0060048
509 Ga0495683_0072648
510 Ga0495677_0099727
511 Ga0495685_068438
512 Ga0495684_0120067
513 Ga0495686_0009393
514 Ga0495686_0076039
515 Ga0495593_0032934
516 Ga0495602_0235678
517 Ga0495602_0320597
518 Ga0495614_0041258
519 Ga0495626_0012598
520 Ga0496100_0332135
521 Ga0496105_0335402
522 Ga0496107_0101456
523 Ga0496107_0655632
524 Ga0496109_0041856
525 Ga0496110_0070569
526 Ga0496111_0114198
527 Ga0496113_0348980
528 Ga0496114_0295976
529 Ga0496120_0023175
530 Ga0496124_0095721
531 Ga0495678_028746
532 Ga0495678_067974
533 Ga0495682_0045237
534 Ga0501033_0234730
535 Ga0501036_0099157
536 Ga0501038_0039101
537 Ga0501038_0122407
538 Ga0501039_0014488
539 Ga0501040_0147373
540 Ga0501041_0130624
541 Ga0501041_0546489
542 Ga0501067_0133480
543 Ga0501067_0244414
544 Ga0501067_0527745
545 Ga0501068_0093580
546 Ga0501069_0075187
547 Ga0501069_0147689
548 Ga0501070_0166611
549 Ga0501070_0463445
550 Ga0501071_0061516
551 Ga0501072_0022469
552 Ga0501072_0029466
553 Ga0501074_0035500
554 Ga0501075_0003008
555 Ga0501076_0007147
556 Ga0501077_0046000
557 Ga0501035_0294046
558 Ga0501044_0234178
559 Ga0501045_0013044
560 Ga0501045_0319515
561 Ga0501045_0613944
562 nmdc:mga05p37_45864_c1
563 nmdc:mga05p37_736171_c1
564 nmdc:mga05p37_780395_c1
565 nmdc:mga09592_303092_c1
566 nmdc:mga09592_891739_c1
567 nmdc:mga0qj67_434203_c1
568 nmdc:mga06r32_1119160_c1
569 nmdc:mga06r32_118458_c1
570 nmdc:mga06r32_497052_c1
571 nmdc:mga08y16_692645_c1
572 nmdc:mga08y16_766693_c1
573 nmdc:mga0n895_261722_c1
574 nmdc:mga0a205_442364_c1
575 Ga0495619_0166393
576 Ga0500573_0183369
577 Ga0500636_0161920
578 Ga0500596_007411
579 Ga0501084_0081193
580 Ga0501082_0023604
581 Ga0530510_0024657
582 2891329354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

33

234

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8473 2 191
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8394 2 191
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.783 2 190
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.7826 1 190
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.7792 1 191
ID Description Score Start End Superfamily
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8145 1 190 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.807 1 190 3.40.50.1820
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8027 2 190 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7972 2 190 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7921 2 189 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V9RQQ8-F1-model_v4 Dienelactone hydrolase family protein 0.9996 1 191 GO:0016787
AF-A0A6A7MSW6-F1-model_v4 deleted 0.9996 1 98
AF-A0A838H7Y2-F1-model_v4 Dienelactone hydrolase family protein 0.9984 79 190 GO:0016787
AF-A0A7V9VIF3-F1-model_v4 DUF664 domain-containing protein 0.9983 1 188 GO:0016787
AF-A0A1Y0I075-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9972 1 190 GO:0016787

Map