F390539

General Info

Members Datasets Scaffolds Average Seq Length
291 195 284 393

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0008969|Ga0495625_0008969_434_1807
Length 457
Sequence MGFDDAIHVKLLESFELAQSAVCVAAESLSHAGRIRKAWHTAARPRAATFHERSDHATMSTTEIFLIAMLIIFSVPYVIWRLGRTDYFAPLVVVQTVAGILLGPGILGAALPEFHRFVFNAPVIQALNGIAWWAVMLFVWIAGVELDLRKAWEHRRESGITAGLALGVPLLLGSAVAAVMVASPGWIGAKAESWQFVVGVGMACAVTALPVLILLMEKLDVLRQPIGQRILRYSSVDDIAIWAVLAAILMDWSRVGKQVAFLAAFTVLGWAFRKLMQRIPERDRWYASLIWLAACGLGADWSGLHFIVGAFLAGAIIDAHWFDQKQLDSLRHNVLLVVAPVYFLSTGLRTNWQLGGASVLIAAGALLLAAVXXKLIGVHIAGRVLKWQPGESSLIGWFLQTKGLVMIIFANVLLDKAMITDETFTALLLMAVGSTMLTTPMVAPRLAKMKEIVFRST

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
3 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
4 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
5 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
6 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
7 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
190 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.56
Nodule 1.03
Rhizoplane 2.06
Rhizosphere 67.7
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000523 3300002075 Bacteria 10942
2 rootH1_10021569 3300003323 Bacteria 7210
3 Ga0055526_1000424 3300003771 Bacteria 33964
4 Ga0055537_1000330 3300003773 Bacteria 32350
5 Ga0055524_1000417 3300003775 Bacteria 35861
6 Ga0055524_1002724 3300003775 Bacteria 8922
7 Ga0055534_1000147 3300003784 Bacteria 52707
8 Ga0055528_1000364 3300003790 Bacteria 36795
9 Ga0055531_10007102 3300003794 Bacteria 6186
10 Ga0055531_10020359 3300003794 Bacteria 2626
11 Ga0055543_1002802 3300004625 Bacteria 5509
12 Ga0065165_1000193 3300005262 Bacteria 106706
13 Ga0065165_1000726 3300005262 Bacteria 46055
14 Ga0070676_10002766 3300005328 Bacteria 9061
15 Ga0070676_10027028 3300005328 Bacteria 3252
16 Ga0070670_100019587 3300005331 Bacteria 5808
17 Ga0068869_100001898 3300005334 Bacteria 12573
18 Ga0068868_100044354 3300005338 Bacteria 3477
19 Ga0068868_100110325 3300005338 Bacteria 2235
20 Ga0070669_100008469 3300005353 Bacteria 7343
21 Ga0070671_100006386 3300005355 Bacteria 9417
22 Ga0070659_100066805 3300005366 Bacteria 2850
23 Ga0070667_100152971 3300005367 Bacteria 2028
24 Ga0070701_10055990 3300005438 Bacteria 2062
25 Ga0070700_100000977 3300005441 Bacteria 14091
26 Ga0070678_100020398 3300005456 Bacteria 4348
27 Ga0070662_100017515 3300005457 Bacteria 4832
28 Ga0070662_100067012 3300005457 Bacteria 2636
29 Ga0068867_100000312 3300005459 Bacteria 32121
30 Ga0068867_100016562 3300005459 Bacteria 5235
31 Ga0070685_10000267 3300005466 Bacteria 33632
32 Ga0068853_100064426 3300005539 Bacteria 3178
33 Ga0068853_100141953 3300005539 Bacteria 2156
34 Ga0070672_100008775 3300005543 Bacteria 6939
35 Ga0070665_100000457 3300005548 Bacteria 59529
36 Ga0070665_100095817 3300005548 Bacteria 2973
37 Ga0068855_100022482 3300005563 Bacteria 7557
38 Ga0068855_100041616 3300005563 Bacteria 5445
39 Ga0070664_100073686 3300005564 Bacteria 2930
40 Ga0068857_100093309 3300005577 Bacteria 2696
41 Ga0068854_100005239 3300005578 Bacteria 8180
42 Ga0068854_100008899 3300005578 Bacteria 6465
43 Ga0068852_100046878 3300005616 Bacteria 3684
44 Ga0068852_100062775 3300005616 Bacteria 3233
45 Ga0068852_100079460 3300005616 Bacteria 2905
46 Ga0068866_10007385 3300005718 Bacteria 4598
47 Ga0068861_100009567 3300005719 Bacteria 6696
48 Ga0068851_10002524 3300005834 Bacteria 8054
49 Ga0068858_100002035 3300005842 Bacteria 20606
50 Ga0075368_10016504 3300006042 Bacteria 2753
51 Ga0075363_100006407 3300006048 Bacteria 5343
52 Ga0075432_10025665 3300006058 Bacteria 2022
53 Ga0075362_10010690 3300006177 Bacteria 3591
54 Ga0075367_10006922 3300006178 Bacteria 5772
55 Ga0075370_10000219 3300006353 Bacteria 20410
56 Ga0075370_10004974 3300006353 Bacteria 6535
57 Ga0075370_10011585 3300006353 Bacteria 4637
58 Ga0068865_100005000 3300006881 Bacteria 8018
59 Ga0068865_100044670 3300006881 Bacteria 3034
60 Ga0068865_100229705 3300006881 Bacteria 1455
61 Ga0099823_1000023 3300006944 Bacteria 75509
62 Ga0079104_1002727 3300006946 Bacteria 9024
63 Ga0105240_10002034 3300009093 Bacteria 33318
64 Ga0105240_10003888 3300009093 Bacteria 23070
65 Ga0105240_10010242 3300009093 Bacteria 13195
66 Ga0105243_10002420 3300009148 Bacteria 15632
67 Ga0105243_10183866 3300009148 Bacteria 1820
68 Ga0105242_10009371 3300009176 Bacteria 7513
69 Ga0105242_10013297 3300009176 Bacteria 6356
70 Ga0105242_10252527 3300009176 Bacteria 1590
71 Ga0105237_10001152 3300009545 Bacteria 35466
72 Ga0105237_10007790 3300009545 Bacteria 11681
73 Ga0105237_10011824 3300009545 Bacteria 9231
74 Ga0105237_10344488 3300009545 Bacteria 1494
75 Ga0105238_10004734 3300009551 Bacteria 13459
76 Ga0105238_10006894 3300009551 Bacteria 11343
77 Ga0105238_10070555 3300009551 Bacteria 3492
78 Ga0105249_10008361 3300009553 Bacteria 9013
79 Ga0105239_10000248 3300010375 Bacteria 80738
80 Ga0105239_10076246 3300010375 Bacteria 3687
81 Ga0157319_1000001 3300012497 Bacteria 423237
82 Ga0157380_10000562 3300014326 Bacteria 22814
83 Ga0182008_10024867 3300014497 Bacteria 3045
84 Ga0157376_10148592 3300014969 Bacteria 2111
85 Ga0182006_1000042 3300015261 Bacteria 202969
86 Ga0182006_1000161 3300015261 Bacteria 71421
87 Ga0182005_1000008 3300015265 Bacteria 471394
88 Ga0163161_10023727 3300017792 Bacteria 4329
89 Ga0209233_1000691 3300025261 Bacteria 15972
90 Ga0209565_1000003 3300025263 Bacteria 1099648
91 Ga0209673_1000017 3300025273 Bacteria 492994
92 Ga0209130_1000561 3300025284 Bacteria 36894
93 Ga0209675_1000119 3300025291 Bacteria 110218
94 Ga0209564_1000010 3300025295 Bacteria 885399
95 Ga0209564_1000016 3300025295 Bacteria 613131
96 Ga0209050_1009971 3300025298 Bacteria 4761
97 Ga0209256_1000078 3300025299 Bacteria 225992
98 Ga0209256_1000210 3300025299 Bacteria 110217
99 Ga0209256_1000630 3300025299 Bacteria 48400
100 Ga0209051_1000855 3300025303 Bacteria 31073
101 Ga0209257_1000358 3300025304 Bacteria 93161
102 Ga0209257_1011080 3300025304 Bacteria 4417
103 Ga0207656_10000329 3300025321 Bacteria 16208
104 Ga0207682_10010641 3300025893 Bacteria 3599
105 Ga0207647_10000823 3300025904 Bacteria 24101
106 Ga0207645_10018037 3300025907 Bacteria 4652
107 Ga0207645_10029392 3300025907 Bacteria 3544
108 Ga0207643_10043096 3300025908 Bacteria 2545
109 Ga0207705_10083759 3300025909 Bacteria 2327
110 Ga0207654_10026229 3300025911 Bacteria 3153
111 Ga0207695_10000219 3300025913 Bacteria 153492
112 Ga0207695_10013371 3300025913 Bacteria 9795
113 Ga0207695_10014742 3300025913 Bacteria 9241
114 Ga0207695_10020615 3300025913 Bacteria 7546
115 Ga0207671_10001582 3300025914 Bacteria 25864
116 Ga0207671_10006828 3300025914 Bacteria 10079
117 Ga0207671_10015749 3300025914 Bacteria 5906
118 Ga0207671_10019730 3300025914 Bacteria 5148
119 Ga0207657_10072773 3300025919 Bacteria 2906
120 Ga0207681_10012505 3300025923 Bacteria 5237
121 Ga0207694_10001086 3300025924 Bacteria 23562
122 Ga0207694_10006174 3300025924 Bacteria 9158
123 Ga0207644_10226024 3300025931 Bacteria 1485
124 Ga0207706_10003047 3300025933 Bacteria 16150
125 Ga0207686_10002911 3300025934 Bacteria 9227
126 Ga0207709_10003721 3300025935 Bacteria 8983
127 Ga0207704_10002691 3300025938 Bacteria 8018
128 Ga0207704_10039903 3300025938 Bacteria 2739
129 Ga0207689_10001135 3300025942 Bacteria 25679
130 Ga0207667_10018376 3300025949 Bacteria 7842
131 Ga0207651_10020697 3300025960 Bacteria 3977
132 Ga0207651_10149220 3300025960 Bacteria 1817
133 Ga0207712_10000743 3300025961 Bacteria 24676
134 Ga0207640_10004599 3300025981 Bacteria 7487
135 Ga0207658_10042765 3300025986 Bacteria 3289
136 Ga0207677_10018196 3300026023 Bacteria 4213
137 Ga0207677_10094703 3300026023 Bacteria 2180
138 Ga0207703_10003166 3300026035 Bacteria 13878
139 Ga0207639_10000397 3300026041 Bacteria 29988
140 Ga0207639_10333118 3300026041 Bacteria 1351
141 Ga0207678_10000962 3300026067 Bacteria 26339
142 Ga0207678_10037557 3300026067 Bacteria 4212
143 Ga0207678_10044018 3300026067 Bacteria 3863
144 Ga0207708_10003213 3300026075 Bacteria 12037
145 Ga0207648_10000093 3300026089 Bacteria 84666
146 Ga0207648_10011334 3300026089 Bacteria 8403
147 Ga0207674_10239091 3300026116 Bacteria 1763
148 Ga0207675_100073784 3300026118 Bacteria 3192
149 Ga0207683_10044650 3300026121 Bacteria 3874
150 Ga0207698_10016815 3300026142 Bacteria 4943
151 Ga0207698_10019577 3300026142 Bacteria 4637
152 Ga0209389_1006076 3300027296 Bacteria 10431
153 Ga0209813_10008118 3300027866 Bacteria 2641
154 Ga0209974_10001616 3300027876 Bacteria 8153
155 Ga0209974_10005255 3300027876 Bacteria 4570
156 Ga0268266_10000008 3300028379 Bacteria 1161875
157 Ga0268266_10085124 3300028379 Bacteria 2762
158 Ga0265337_1006595 3300028556 Bacteria 4452
159 Ga0307517_10000228 3300028786 Bacteria 94852
160 Ga0307515_10000131 3300028794 Bacteria 178919
161 Ga0307515_10000347 3300028794 Bacteria 114603
162 Ga0307515_10002435 3300028794 Bacteria 40544
163 Ga0307515_10012248 3300028794 Bacteria 16152
164 Ga0307515_10094220 3300028794 Bacteria 3701
165 Ga0307515_10158661 3300028794 Bacteria 2320
166 Ga0307515_10183978 3300028794 Bacteria 2027
167 Ga0265327_10000722 3300031251 Bacteria 51801
168 Ga0265316_10034007 3300031344 Bacteria 4145
169 Ga0265316_10053040 3300031344 Bacteria 3179
170 Ga0307513_10001541 3300031456 Bacteria 33038
171 Ga0307509_10000426 3300031507 Bacteria 70899
172 Ga0307509_10049140 3300031507 Bacteria 4525
173 Ga0307509_10188839 3300031507 Bacteria 1914
174 Ga0307509_10299827 3300031507 Bacteria 1356
175 Ga0307508_10000392 3300031616 Bacteria 52650
176 Ga0307508_10195302 3300031616 Bacteria 1625
177 Ga0307516_10000941 3300031730 Bacteria 40131
178 Ga0307516_10213836 3300031730 Bacteria 1641
179 Ga0307516_10216122 3300031730 Bacteria 1629
180 Ga0307412_10068490 3300031911 Bacteria 2413
181 Ga0307510_10000088 3300033180 Bacteria 69071
182 Ga0307510_10028520 3300033180 Bacteria 6373
183 Ga0395899_0019067 3300037312 Bacteria 5213
184 Ga0395898_0046617 3300037466 Bacteria 4257
185 Ga0395905_0277966 3300037471 Bacteria 1560
186 Ga0395905_0381873 3300037471 Bacteria 1302
187 Ga0395901_0236638 3300038443 Bacteria 1905
188 Ga0439436_0000023 3300041404 Bacteria 58899
189 Ga0451789_0154623 3300041443 Bacteria 2107
190 Ga0451853_0991833 3300041512 Bacteria 3187
191 Ga0439459_0000290 3300042438 Bacteria 5980
192 Ga0451577_0002793 3300042876 Bacteria 20145
193 Ga0451577_0005485 3300042876 Bacteria 12987
194 Ga0451577_0011010 3300042876 Bacteria 8589
195 Ga0451577_0034084 3300042876 Bacteria 4591
196 Ga0451577_0116853 3300042876 Bacteria 2389
197 Ga0466963_0063163 3300044694 Bacteria 2478
198 Ga0466963_0103867 3300044694 Bacteria 1947
199 Ga0453684_0000159 3300044712 Bacteria 300297
200 Ga0453684_0024365 3300044712 Bacteria 8846
201 Ga0453684_0073421 3300044712 Bacteria 4312
202 Ga0453684_0080005 3300044712 Bacteria 4083
203 Ga0451576_0000120 3300045051 Bacteria 199365
204 Ga0451576_0229161 3300045051 Bacteria 1940
205 Ga0466967_0026217 3300045976 Bacteria 4823
206 Ga0495627_000875 3300046453 Bacteria 21309
207 Ga0495592_0000307 3300046454 Bacteria 41229
208 Ga0495650_0000185 3300046471 Bacteria 136913
209 Ga0495605_0000083 3300046474 Bacteria 124953
210 Ga0495605_0003688 3300046474 Bacteria 9091
211 Ga0495584_0001446 3300046491 Bacteria 14301
212 Ga0495585_0074616 3300046492 Bacteria 1845
213 Ga0495596_0005684 3300046500 Bacteria 5853
214 Ga0495607_0000485 3300046501 Bacteria 39753
215 Ga0495607_0003020 3300046501 Bacteria 13134
216 Ga0495606_0000049 3300046507 Bacteria 204038
217 Ga0495606_0000626 3300046507 Bacteria 55762
218 Ga0495606_0003142 3300046507 Bacteria 17900
219 Ga0495610_0000999 3300046512 Bacteria 26087
220 Ga0495610_0001255 3300046512 Bacteria 22785
221 Ga0495616_0000492 3300046513 Bacteria 30078
222 Ga0495631_0013023 3300046518 Bacteria 4047
223 Ga0495632_0006354 3300046519 Bacteria 7622
224 Ga0495632_0014399 3300046519 Bacteria 4477
225 Ga0495643_0076644 3300046522 Bacteria 1748
226 Ga0495648_0002247 3300046524 Bacteria 18047
227 Ga0495642_0000666 3300046528 Bacteria 17171
228 Ga0495642_0021813 3300046528 Bacteria 2521
229 Ga0495609_0000019 3300046538 Bacteria 297777
230 Ga0495609_0001513 3300046538 Bacteria 15315
231 Ga0495609_0009731 3300046538 Bacteria 4637
232 Ga0495622_0000007 3300046557 Bacteria 239352
233 Ga0495633_0033342 3300046558 Bacteria 2483
234 Ga0495668_0000077 3300046616 Bacteria 159120
235 Ga0495668_0002470 3300046616 Bacteria 15205
236 Ga0495625_0004189 3300046660 Bacteria 13737
237 Ga0495625_0008969 3300046660 Bacteria 8447
238 Ga0495661_0000012 3300046665 Bacteria 276804
239 Ga0495658_0069459 3300046683 Bacteria 2042
240 Ga0495670_0011455 3300046691 Bacteria 4362
241 Ga0495671_0001415 3300046692 Bacteria 16132
242 Ga0495649_0004352 3300046694 Bacteria 9283
243 Ga0495589_0000007 3300046794 Bacteria 276444
244 Ga0495687_000003 3300047443 Bacteria 859509
245 Ga0495687_017436 3300047443 Bacteria 3583
246 Ga0495677_0000005 3300047445 Bacteria 243336
247 Ga0495677_0004860 3300047445 Bacteria 5124
248 Ga0495673_0000003 3300047469 Bacteria 1491337
249 Ga0495686_0023545 3300047472 Bacteria 4061
250 Ga0495686_0100901 3300047472 Bacteria 1741
251 Ga0495626_0000428 3300048091 Bacteria 43156
252 Ga0496101_0008640 3300048904 Bacteria 6659
253 Ga0496102_0000645 3300048905 Bacteria 35369
254 Ga0496102_0001150 3300048905 Bacteria 24162
255 Ga0496102_0021590 3300048905 Bacteria 5694
256 Ga0496114_0373031 3300048917 Bacteria 1263
257 Ga0496121_0113536 3300048924 Bacteria 2061
258 Ga0496122_0047476 3300048925 Bacteria 3315
259 Ga0496123_0023039 3300048926 Bacteria 4780
260 Ga0496124_0011236 3300048927 Bacteria 8972
261 Ga0496124_0077428 3300048927 Bacteria 2743
262 Ga0496126_0009749 3300048929 Bacteria 10170
263 Ga0501275_000431 3300049772 Bacteria 4772
264 nmdc:mga03683_19208_c1 3300050489 Bacteria 2607
265 nmdc:mga03683_2135_c1 3300050489 Bacteria 6098
266 nmdc:mga0k408_35858_c1 3300050493 Bacteria 2845
267 nmdc:mga0k408_38089_c1 3300050493 Bacteria 2761
268 nmdc:mga06z11_6141_c1 3300050494 Bacteria 4864
269 nmdc:mga07m45_138401_c1 3300050496 Bacteria 1410
270 nmdc:mga07m45_14299_c1 3300050496 Bacteria 4225
271 nmdc:mga07m45_7115_c1 3300050496 Bacteria 5699
272 nmdc:mga0sz30_6373_c1 3300050516 Bacteria 3914
273 Ga0500635_0000003 3300053080 Bacteria 216927
274 Ga0500578_0066868 3300053086 Bacteria 2292
275 Ga0500643_005405 3300053087 Bacteria 5511
276 Ga0500644_0067511 3300053088 Bacteria 1279
277 Ga0500641_0015865 3300053096 Bacteria 2801
278 Ga0500593_032084 3300053117 Bacteria 2350
279 Ga0500594_0004012 3300053118 Bacteria 3242
280 Ga0500559_0001106 3300053136 Bacteria 16255
281 Ga0500622_0003653 3300053156 Bacteria 10112
282 Ga0500634_0000337 3300053161 Bacteria 14953
283 Ga0500636_0127377 3300053177 Bacteria 1422
284 Ga0500645_000529 3300053730 Bacteria 25577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0373031 Ga0496114_0373031_195_1253 346
2 3300025960 Ga0207651_10149220 Ga0207651_101492201 359
3 3300046519 Ga0495632_0014399 Ga0495632_0014399_1138_2337 359
4 3300046558 Ga0495633_0033342 Ga0495633_0033342_130_1329 359
5 3300053088 Ga0500644_0067511 Ga0500644_0067511_18_1217 359
6 3300053161 Ga0500634_0000337 Ga0500634_0000337_10292_11491 359
7 3300044712 Ga0453684_0080005 Ga0453684_0080005_1289_2509 367
8 3300028786 Ga0307517_10000228 Ga0307517_1000022826 368
9 3300028794 Ga0307515_10000347 Ga0307515_1000034791 368
10 3300005466 Ga0070685_10000267 Ga0070685_1000026715 369
11 3300009093 Ga0105240_10002034 Ga0105240_100020349 369
12 3300009545 Ga0105237_10007790 Ga0105237_100077904 369
13 3300009551 Ga0105238_10006894 Ga0105238_100068944 369
14 3300025261 Ga0209233_1000691 Ga0209233_10006919 369
15 3300025913 Ga0207695_10000219 Ga0207695_1000021918 369
16 3300025914 Ga0207671_10006828 Ga0207671_100068283 369
17 3300025924 Ga0207694_10006174 Ga0207694_100061744 369
18 3300026067 Ga0207678_10044018 Ga0207678_100440182 369
19 3300046660 Ga0495625_0004189 Ga0495625_0004189_2044_3243 369
20 3300005262 Ga0065165_1000193 Ga0065165_100019318 370
21 3300009093 Ga0105240_10010242 Ga0105240_100102425 370
22 3300025913 Ga0207695_10014742 Ga0207695_100147423 370
23 3300042876 Ga0451577_0002793 Ga0451577_0002793_14875_16113 370
24 3300006048 Ga0075363_100006407 Ga0075363_1000064075 371
25 3300006178 Ga0075367_10006922 Ga0075367_100069224 371
26 3300006353 Ga0075370_10004974 Ga0075370_100049745 371
27 3300027866 Ga0209813_10008118 Ga0209813_100081183 371
28 3300050489 nmdc:mga03683_2135_c1 nmdc:mga03683_2135_c1_4030_5229 371
29 3300050494 nmdc:mga06z11_6141_c1 nmdc:mga06z11_6141_c1_1238_2437 371
30 3300050496 nmdc:mga07m45_14299_c1 nmdc:mga07m45_14299_c1_2330_3529 371
31 3300050516 nmdc:mga0sz30_6373_c1 nmdc:mga0sz30_6373_c1_1220_2419 371
32 3300028794 Ga0307515_10158661 Ga0307515_101586612 372
33 3300031251 Ga0265327_10000722 Ga0265327_1000072224 372
34 3300044712 Ga0453684_0024365 Ga0453684_0024365_970_2169 372
35 3300005331 Ga0070670_100019587 Ga0070670_1000195872 374
36 3300005338 Ga0068868_100110325 Ga0068868_1001103252 374
37 3300005457 Ga0070662_100017515 Ga0070662_1000175151 374
38 3300005539 Ga0068853_100064426 Ga0068853_1000644264 374
39 3300005548 Ga0070665_100000457 Ga0070665_10000045726 374
40 3300005563 Ga0068855_100041616 Ga0068855_1000416165 374
41 3300005577 Ga0068857_100093309 Ga0068857_1000933092 374
42 3300005578 Ga0068854_100005239 Ga0068854_1000052394 374
43 3300005616 Ga0068852_100079460 Ga0068852_1000794603 374
44 3300005834 Ga0068851_10002524 Ga0068851_100025245 374
45 3300005842 Ga0068858_100002035 Ga0068858_1000020359 374
46 3300009551 Ga0105238_10070555 Ga0105238_100705552 374
47 3300009553 Ga0105249_10008361 Ga0105249_100083613 374
48 3300014969 Ga0157376_10148592 Ga0157376_101485922 374
49 3300025321 Ga0207656_10000329 Ga0207656_100003295 374
50 3300025904 Ga0207647_10000823 Ga0207647_100008237 374
51 3300025913 Ga0207695_10013371 Ga0207695_100133713 374
52 3300025914 Ga0207671_10019730 Ga0207671_100197302 374
53 3300025924 Ga0207694_10001086 Ga0207694_100010865 374
54 3300025938 Ga0207704_10039903 Ga0207704_100399032 374
55 3300025961 Ga0207712_10000743 Ga0207712_1000074316 374
56 3300025981 Ga0207640_10004599 Ga0207640_100045994 374
57 3300026023 Ga0207677_10094703 Ga0207677_100947032 374
58 3300026035 Ga0207703_10003166 Ga0207703_100031666 374
59 3300026041 Ga0207639_10000397 Ga0207639_1000039711 374
60 3300026067 Ga0207678_10000962 Ga0207678_1000096217 374
61 3300026142 Ga0207698_10019577 Ga0207698_100195772 374
62 3300028379 Ga0268266_10000008 Ga0268266_10000008511 374
63 3300053080 Ga0500635_0000003 Ga0500635_0000003_151566_152768 374
64 3300006353 Ga0075370_10011585 Ga0075370_100115855 375
65 3300005328 Ga0070676_10027028 Ga0070676_100270283 376
66 3300005459 Ga0068867_100016562 Ga0068867_1000165624 376
67 3300006881 Ga0068865_100044670 Ga0068865_1000446704 376
68 3300009176 Ga0105242_10252527 Ga0105242_102525272 376
69 3300025907 Ga0207645_10029392 Ga0207645_100293923 376
70 3300026089 Ga0207648_10011334 Ga0207648_100113346 376
71 3300050493 nmdc:mga0k408_38089_c1 nmdc:mga0k408_38089_c1_495_1694 376
72 3300053096 Ga0500641_0015865 Ga0500641_0015865_1529_2725 376
73 3300005616 Ga0068852_100046878 Ga0068852_1000468783 377
74 3300005718 Ga0068866_10007385 Ga0068866_100073851 377
75 3300026142 Ga0207698_10016815 Ga0207698_100168154 377
76 3300048927 Ga0496124_0077428 Ga0496124_0077428_286_1485 377
77 3300006946 Ga0079104_1002727 Ga0079104_10027273 378
78 3300014326 Ga0157380_10000562 Ga0157380_1000056223 378
79 3300015261 Ga0182006_1000042 Ga0182006_100004263 378
80 3300015265 Ga0182005_1000008 Ga0182005_100000844 378
81 3300046454 Ga0495592_0000307 Ga0495592_0000307_4796_5995 378
82 3300048927 Ga0496124_0011236 Ga0496124_0011236_1510_2718 378
83 3300049772 Ga0501275_000431 Ga0501275_000431_1511_2722 378
84 3300046471 Ga0495650_0000185 Ga0495650_0000185_41611_42810 379
85 3300046557 Ga0495622_0000007 Ga0495622_0000007_124286_125497 379
86 3300047469 Ga0495673_0000003 Ga0495673_0000003_231420_232628 379
87 3300048924 Ga0496121_0113536 Ga0496121_0113536_240_1445 379
88 3300048929 Ga0496126_0009749 Ga0496126_0009749_3901_5109 379
89 3300003323 rootH1_10021569 rootH1_100215693 380
90 3300003794 Ga0055531_10007102 Ga0055531_100071022 380
91 3300006944 Ga0099823_1000023 Ga0099823_10000234 380
92 3300025298 Ga0209050_1009971 Ga0209050_10099714 380
93 3300025299 Ga0209256_1000630 Ga0209256_100063022 380
94 3300025303 Ga0209051_1000855 Ga0209051_100085518 380
95 3300025304 Ga0209257_1011080 Ga0209257_10110803 380
96 3300027296 Ga0209389_1006076 Ga0209389_10060764 380
97 3300044694 Ga0466963_0103867 Ga0466963_0103867_558_1760 380
98 3300046453 Ga0495627_000875 Ga0495627_000875_10526_11734 380
99 3300046474 Ga0495605_0000083 Ga0495605_0000083_32317_33525 380
100 3300046492 Ga0495585_0074616 Ga0495585_0074616_441_1649 380
101 3300046500 Ga0495596_0005684 Ga0495596_0005684_4129_5337 380
102 3300046501 Ga0495607_0003020 Ga0495607_0003020_9324_10532 380
103 3300046507 Ga0495606_0000626 Ga0495606_0000626_47732_48940 380
104 3300046518 Ga0495631_0013023 Ga0495631_0013023_2193_3401 380
105 3300046524 Ga0495648_0002247 Ga0495648_0002247_9088_10296 380
106 3300046528 Ga0495642_0000666 Ga0495642_0000666_5190_6398 380
107 3300046538 Ga0495609_0009731 Ga0495609_0009731_2033_3241 380
108 3300046616 Ga0495668_0002470 Ga0495668_0002470_8179_9387 380
109 3300046692 Ga0495671_0001415 Ga0495671_0001415_12905_14113 380
110 3300047445 Ga0495677_0004860 Ga0495677_0004860_2187_3395 380
111 3300048905 Ga0496102_0000645 Ga0496102_0000645_11503_12711 380
112 3300006353 Ga0075370_10000219 Ga0075370_100002194 381
113 3300028794 Ga0307515_10094220 Ga0307515_100942202 381
114 3300031344 Ga0265316_10034007 Ga0265316_100340072 381
115 3300031456 Ga0307513_10001541 Ga0307513_1000154117 381
116 3300046519 Ga0495632_0006354 Ga0495632_0006354_1561_2760 381
117 3300046694 Ga0495649_0004352 Ga0495649_0004352_146_1345 381
118 3300047443 Ga0495687_017436 Ga0495687_017436_203_1402 381
119 3300003775 Ga0055524_1000417 Ga0055524_100041724 382
120 3300003794 Ga0055531_10020359 Ga0055531_100203592 382
121 3300012497 Ga0157319_1000001 Ga0157319_1000001313 382
122 3300025299 Ga0209256_1000078 Ga0209256_100007845 382
123 3300025304 Ga0209257_1000358 Ga0209257_100035858 382
124 3300042438 Ga0439459_0000290 Ga0439459_0000290_4559_5809 382
125 3300044712 Ga0453684_0000159 Ga0453684_0000159_23697_24914 382
126 3300045051 Ga0451576_0000120 Ga0451576_0000120_23697_24914 382
127 3300053730 Ga0500645_000529 Ga0500645_000529_21380_22597 384
128 3300028794 Ga0307515_10000131 Ga0307515_1000013142 385
129 3300044694 Ga0466963_0063163 Ga0466963_0063163_793_2001 385
130 3300045976 Ga0466967_0026217 Ga0466967_0026217_2648_3856 385
131 iso_pu_bacteria 2928115317 2928117677 388
132 iso_pu_bacteria 2585428062 2587758871 389
133 iso_pu_bacteria 2842918807 2842922459 390
134 iso_pu_bacteria 2886848708 2886853174 390
135 iso_pu_bacteria 2919704043 2919708487 390
136 3300031344 Ga0265316_10053040 Ga0265316_100530402 391
137 3300005328 Ga0070676_10002766 Ga0070676_100027666 392
138 3300005334 Ga0068869_100001898 Ga0068869_1000018989 392
139 3300005338 Ga0068868_100044354 Ga0068868_1000443542 392
140 3300005353 Ga0070669_100008469 Ga0070669_1000084692 392
141 3300005355 Ga0070671_100006386 Ga0070671_1000063868 392
142 3300005438 Ga0070701_10055990 Ga0070701_100559902 392
143 3300005441 Ga0070700_100000977 Ga0070700_1000009777 392
144 3300005456 Ga0070678_100020398 Ga0070678_1000203984 392
145 3300005459 Ga0068867_100000312 Ga0068867_1000003128 392
146 3300005543 Ga0070672_100008775 Ga0070672_1000087753 392
147 3300005719 Ga0068861_100009567 Ga0068861_1000095675 392
148 3300006881 Ga0068865_100005000 Ga0068865_1000050005 392
149 3300009148 Ga0105243_10002420 Ga0105243_100024206 392
150 3300009176 Ga0105242_10013297 Ga0105242_100132974 392
151 3300025893 Ga0207682_10010641 Ga0207682_100106412 392
152 3300025907 Ga0207645_10018037 Ga0207645_100180373 392
153 3300025908 Ga0207643_10043096 Ga0207643_100430962 392
154 3300025923 Ga0207681_10012505 Ga0207681_100125054 392
155 3300025931 Ga0207644_10226024 Ga0207644_102260242 392
156 3300025934 Ga0207686_10002911 Ga0207686_100029116 392
157 3300025935 Ga0207709_10003721 Ga0207709_100037212 392
158 3300025938 Ga0207704_10002691 Ga0207704_100026912 392
159 3300025942 Ga0207689_10001135 Ga0207689_1000113515 392
160 3300025960 Ga0207651_10020697 Ga0207651_100206972 392
161 3300026023 Ga0207677_10018196 Ga0207677_100181963 392
162 3300026075 Ga0207708_10003213 Ga0207708_100032134 392
163 3300026089 Ga0207648_10000093 Ga0207648_1000009348 392
164 3300026118 Ga0207675_100073784 Ga0207675_1000737842 392
165 3300026121 Ga0207683_10044650 Ga0207683_100446502 392
166 3300028556 Ga0265337_1006595 Ga0265337_10065952 392
167 3300042876 Ga0451577_0034084 Ga0451577_0034084_2702_3904 392
168 iso_pu_bacteria 2687453130 2687582186 392
169 iso_pu_bacteria 2946787523 2946788927 392
170 3300003771 Ga0055526_1000424 Ga0055526_100042411 393
171 3300003773 Ga0055537_1000330 Ga0055537_10003309 393
172 3300003775 Ga0055524_1002724 Ga0055524_10027246 393
173 3300003784 Ga0055534_1000147 Ga0055534_10001477 393
174 3300003790 Ga0055528_1000364 Ga0055528_100036412 393
175 3300004625 Ga0055543_1002802 Ga0055543_10028025 393
176 3300005262 Ga0065165_1000726 Ga0065165_100072633 393
177 3300005366 Ga0070659_100066805 Ga0070659_1000668053 393
178 3300005367 Ga0070667_100152971 Ga0070667_1001529712 393
179 3300005457 Ga0070662_100067012 Ga0070662_1000670123 393
180 3300005539 Ga0068853_100141953 Ga0068853_1001419531 393
181 3300005548 Ga0070665_100095817 Ga0070665_1000958172 393
182 3300005563 Ga0068855_100022482 Ga0068855_1000224822 393
183 3300005564 Ga0070664_100073686 Ga0070664_1000736862 393
184 3300005578 Ga0068854_100008899 Ga0068854_1000088996 393
185 3300005616 Ga0068852_100062775 Ga0068852_1000627753 393
186 3300006042 Ga0075368_10016504 Ga0075368_100165043 393
187 3300006058 Ga0075432_10025665 Ga0075432_100256653 393
188 3300006177 Ga0075362_10010690 Ga0075362_100106903 393
189 3300006881 Ga0068865_100229705 Ga0068865_1002297051 393
190 3300009093 Ga0105240_10003888 Ga0105240_1000388813 393
191 3300009148 Ga0105243_10183866 Ga0105243_101838662 393
192 3300009176 Ga0105242_10009371 Ga0105242_100093716 393
193 3300009545 Ga0105237_10001152 Ga0105237_100011527 393
194 3300009545 Ga0105237_10011824 Ga0105237_100118245 393
195 3300009545 Ga0105237_10344488 Ga0105237_103444881 393
196 3300009551 Ga0105238_10004734 Ga0105238_100047343 393
197 3300010375 Ga0105239_10000248 Ga0105239_100002487 393
198 3300010375 Ga0105239_10076246 Ga0105239_100762463 393
199 3300025263 Ga0209565_1000003 Ga0209565_100000319 393
200 3300025273 Ga0209673_1000017 Ga0209673_1000017390 393
201 3300025284 Ga0209130_1000561 Ga0209130_10005614 393
202 3300025291 Ga0209675_1000119 Ga0209675_100011919 393
203 3300025295 Ga0209564_1000010 Ga0209564_1000010619 393
204 3300025295 Ga0209564_1000016 Ga0209564_100001696 393
205 3300025299 Ga0209256_1000210 Ga0209256_100021019 393
206 3300025909 Ga0207705_10083759 Ga0207705_100837592 393
207 3300025911 Ga0207654_10026229 Ga0207654_100262293 393
208 3300025913 Ga0207695_10020615 Ga0207695_100206154 393
209 3300025914 Ga0207671_10001582 Ga0207671_1000158223 393
210 3300025914 Ga0207671_10015749 Ga0207671_100157494 393
211 3300025919 Ga0207657_10072773 Ga0207657_100727733 393
212 3300025933 Ga0207706_10003047 Ga0207706_100030473 393
213 3300025949 Ga0207667_10018376 Ga0207667_100183763 393
214 3300025986 Ga0207658_10042765 Ga0207658_100427652 393
215 3300026041 Ga0207639_10333118 Ga0207639_103331181 393
216 3300026067 Ga0207678_10037557 Ga0207678_100375572 393
217 3300026116 Ga0207674_10239091 Ga0207674_102390912 393
218 3300027876 Ga0209974_10001616 Ga0209974_100016168 393
219 3300027876 Ga0209974_10005255 Ga0209974_100052552 393
220 3300028379 Ga0268266_10085124 Ga0268266_100851243 393
221 3300028794 Ga0307515_10002435 Ga0307515_1000243512 393
222 3300028794 Ga0307515_10012248 Ga0307515_100122483 393
223 3300028794 Ga0307515_10183978 Ga0307515_101839783 393
224 3300031507 Ga0307509_10000426 Ga0307509_1000042616 393
225 3300031507 Ga0307509_10049140 Ga0307509_100491404 393
226 3300031507 Ga0307509_10188839 Ga0307509_101888392 393
227 3300031507 Ga0307509_10299827 Ga0307509_102998271 393
228 3300031616 Ga0307508_10000392 Ga0307508_1000039227 393
229 3300031616 Ga0307508_10195302 Ga0307508_101953022 393
230 3300031730 Ga0307516_10000941 Ga0307516_100009417 393
231 3300031730 Ga0307516_10213836 Ga0307516_102138362 393
232 3300031730 Ga0307516_10216122 Ga0307516_102161222 393
233 3300033180 Ga0307510_10000088 Ga0307510_1000008819 393
234 3300033180 Ga0307510_10028520 Ga0307510_100285205 393
235 3300037312 Ga0395899_0019067 Ga0395899_0019067_2924_4132 393
236 3300037466 Ga0395898_0046617 Ga0395898_0046617_2972_4180 393
237 3300037471 Ga0395905_0277966 Ga0395905_0277966_272_1480 393
238 3300037471 Ga0395905_0381873 Ga0395905_0381873_78_1286 393
239 3300038443 Ga0395901_0236638 Ga0395901_0236638_286_1494 393
240 3300041443 Ga0451789_0154623 Ga0451789_0154623_771_1988 393
241 3300041512 Ga0451853_0991833 Ga0451853_0991833_1265_2464 393
242 3300042876 Ga0451577_0005485 Ga0451577_0005485_4123_5334 393
243 3300042876 Ga0451577_0011010 Ga0451577_0011010_2229_3461 393
244 3300042876 Ga0451577_0116853 Ga0451577_0116853_723_1955 393
245 3300044712 Ga0453684_0073421 Ga0453684_0073421_1016_2248 393
246 3300045051 Ga0451576_0229161 Ga0451576_0229161_273_1505 393
247 3300046474 Ga0495605_0003688 Ga0495605_0003688_4769_5977 393
248 3300046491 Ga0495584_0001446 Ga0495584_0001446_9110_10318 393
249 3300046501 Ga0495607_0000485 Ga0495607_0000485_6269_7477 393
250 3300046507 Ga0495606_0000049 Ga0495606_0000049_60066_61274 393
251 3300046512 Ga0495610_0000999 Ga0495610_0000999_21164_22372 393
252 3300046513 Ga0495616_0000492 Ga0495616_0000492_25102_26310 393
253 3300046522 Ga0495643_0076644 Ga0495643_0076644_55_1263 393
254 3300046528 Ga0495642_0021813 Ga0495642_0021813_603_1811 393
255 3300046538 Ga0495609_0000019 Ga0495609_0000019_182892_184100 393
256 3300046616 Ga0495668_0000077 Ga0495668_0000077_60018_61226 393
257 3300046660 Ga0495625_0008969 Ga0495625_0008969_434_1807 393
258 3300046665 Ga0495661_0000012 Ga0495661_0000012_57239_58447 393
259 3300046683 Ga0495658_0069459 Ga0495658_0069459_613_1812 393
260 3300046794 Ga0495589_0000007 Ga0495589_0000007_56879_58087 393
261 3300047443 Ga0495687_000003 Ga0495687_000003_182919_184127 393
262 3300047445 Ga0495677_0000005 Ga0495677_0000005_218580_219788 393
263 3300047472 Ga0495686_0023545 Ga0495686_0023545_946_2154 393
264 3300047472 Ga0495686_0100901 Ga0495686_0100901_232_1605 393
265 3300048091 Ga0495626_0000428 Ga0495626_0000428_37081_38289 393
266 3300048905 Ga0496102_0001150 Ga0496102_0001150_2972_4171 393
267 3300048905 Ga0496102_0021590 Ga0496102_0021590_962_2161 393
268 3300050489 nmdc:mga03683_19208_c1 nmdc:mga03683_19208_c1_407_1606 393
269 3300050493 nmdc:mga0k408_35858_c1 nmdc:mga0k408_35858_c1_1387_2586 393
270 3300050496 nmdc:mga07m45_138401_c1 nmdc:mga07m45_138401_c1_100_1299 393
271 3300050496 nmdc:mga07m45_7115_c1 nmdc:mga07m45_7115_c1_2536_3735 393
272 3300053086 Ga0500578_0066868 Ga0500578_0066868_1000_2199 393
273 3300053087 Ga0500643_005405 Ga0500643_005405_2648_3865 393
274 3300053117 Ga0500593_032084 Ga0500593_032084_271_1470 393
275 3300053118 Ga0500594_0004012 Ga0500594_0004012_1269_2468 393
276 3300053136 Ga0500559_0001106 Ga0500559_0001106_9913_11112 393
277 3300053156 Ga0500622_0003653 Ga0500622_0003653_1811_3010 393
278 3300053177 Ga0500636_0127377 Ga0500636_0127377_188_1387 393
279 3300002075 JGI24738J21930_10000523 JGI24738J21930_100005232 394
280 3300014497 Ga0182008_10024867 Ga0182008_100248672 394
281 3300015261 Ga0182006_1000161 Ga0182006_100016156 394
282 3300017792 Ga0163161_10023727 Ga0163161_100237272 394
283 3300031911 Ga0307412_10068490 Ga0307412_100684902 394
284 3300041404 Ga0439436_0000023 Ga0439436_0000023_11951_13135 394
285 3300046507 Ga0495606_0003142 Ga0495606_0003142_694_1878 394
286 3300046512 Ga0495610_0001255 Ga0495610_0001255_14301_15485 394
287 3300046538 Ga0495609_0001513 Ga0495609_0001513_14033_15253 394
288 3300046691 Ga0495670_0011455 Ga0495670_0011455_2324_3508 394
289 3300048904 Ga0496101_0008640 Ga0496101_0008640_2588_3775 394
290 3300048925 Ga0496122_0047476 Ga0496122_0047476_1434_2621 394
291 3300048926 Ga0496123_0023039 Ga0496123_0023039_1768_2955 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

67

448

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.7907 7 392
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.7535 7 392
8otx-assembly1.cif.gz_B cryo-em structure of strongylocentrotus purpuratus sperm-specific na+/h+ exchanger slc9c1 in nanodisc 0.7152 1 393
8otx-assembly1.cif.gz_B cryo-em structure of strongylocentrotus purpuratus sperm-specific na+/h+ exchanger slc9c1 in nanodisc 0.7121 1 393
8by2-assembly1.cif.gz_A structure of the k+/h+ exchanger kefc with gsh. 0.7068 4 394
ID Description Score Start End Superfamily
af_I1LYU2_28_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8918 7 391 1.20.1530.20
af_I1LMR0_38_443_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8785 7 391 1.20.1530.20
af_A0A0P0YC61_1_270_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8779 144 385 1.20.1530.20
af_Q54GC7_13_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8764 7 387 1.20.1530.20
af_I1ME88_42_441_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.875 7 385 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A0M2LPS6-F1-model_v4 Sodium:proton exchanger 0.997 1 392 GO:0015297
GO:0016020
GO:1902600
AF-A0A4Y5Z6F4-F1-model_v4 Cation:proton antiporter 0.9963 1 392 GO:0015297
GO:0016020
GO:1902600
AF-A0A0Q4KIM7-F1-model_v4 Sodium:proton exchanger 0.9956 1 392 GO:0015297
GO:0016020
GO:1902600
AF-A0A1W9IZM2-F1-model_v4 Cation/H(+) antiporter 0.9947 1 393 GO:0015297
GO:0016020
GO:1902600
AF-A0A6L8KVK4-F1-model_v4 Cation:proton antiporter 0.9943 1 391 GO:0015297
GO:0016020
GO:1902600

Feature Viewer

pLDDT pTM Quality
86.07 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map