F390539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 195 | 284 | 393 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0008969|Ga0495625_0008969_434_1807 |
| Length | 457 |
| Sequence | MGFDDAIHVKLLESFELAQSAVCVAAESLSHAGRIRKAWHTAARPRAATFHERSDHATMSTTEIFLIAMLIIFSVPYVIWRLGRTDYFAPLVVVQTVAGILLGPGILGAALPEFHRFVFNAPVIQALNGIAWWAVMLFVWIAGVELDLRKAWEHRRESGITAGLALGVPLLLGSAVAAVMVASPGWIGAKAESWQFVVGVGMACAVTALPVLILLMEKLDVLRQPIGQRILRYSSVDDIAIWAVLAAILMDWSRVGKQVAFLAAFTVLGWAFRKLMQRIPERDRWYASLIWLAACGLGADWSGLHFIVGAFLAGAIIDAHWFDQKQLDSLRHNVLLVVAPVYFLSTGLRTNWQLGGASVLIAAGALLLAAVXXKLIGVHIAGRVLKWQPGESSLIGWFLQTKGLVMIIFANVLLDKAMITDETFTALLLMAVGSTMLTTPMVAPRLAKMKEIVFRST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 3 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 4 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 5 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 6 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 7 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 52 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 121 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 130 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 179 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 181 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 182 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 184 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 185 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 186 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 187 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 189 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 193 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 194 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0 |
| Isolates | 2.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.56 |
| Nodule | 1.03 |
| Rhizoplane | 2.06 |
| Rhizosphere | 67.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10000523 | 3300002075 | Bacteria | 10942 |
| 2 | rootH1_10021569 | 3300003323 | Bacteria | 7210 |
| 3 | Ga0055526_1000424 | 3300003771 | Bacteria | 33964 |
| 4 | Ga0055537_1000330 | 3300003773 | Bacteria | 32350 |
| 5 | Ga0055524_1000417 | 3300003775 | Bacteria | 35861 |
| 6 | Ga0055524_1002724 | 3300003775 | Bacteria | 8922 |
| 7 | Ga0055534_1000147 | 3300003784 | Bacteria | 52707 |
| 8 | Ga0055528_1000364 | 3300003790 | Bacteria | 36795 |
| 9 | Ga0055531_10007102 | 3300003794 | Bacteria | 6186 |
| 10 | Ga0055531_10020359 | 3300003794 | Bacteria | 2626 |
| 11 | Ga0055543_1002802 | 3300004625 | Bacteria | 5509 |
| 12 | Ga0065165_1000193 | 3300005262 | Bacteria | 106706 |
| 13 | Ga0065165_1000726 | 3300005262 | Bacteria | 46055 |
| 14 | Ga0070676_10002766 | 3300005328 | Bacteria | 9061 |
| 15 | Ga0070676_10027028 | 3300005328 | Bacteria | 3252 |
| 16 | Ga0070670_100019587 | 3300005331 | Bacteria | 5808 |
| 17 | Ga0068869_100001898 | 3300005334 | Bacteria | 12573 |
| 18 | Ga0068868_100044354 | 3300005338 | Bacteria | 3477 |
| 19 | Ga0068868_100110325 | 3300005338 | Bacteria | 2235 |
| 20 | Ga0070669_100008469 | 3300005353 | Bacteria | 7343 |
| 21 | Ga0070671_100006386 | 3300005355 | Bacteria | 9417 |
| 22 | Ga0070659_100066805 | 3300005366 | Bacteria | 2850 |
| 23 | Ga0070667_100152971 | 3300005367 | Bacteria | 2028 |
| 24 | Ga0070701_10055990 | 3300005438 | Bacteria | 2062 |
| 25 | Ga0070700_100000977 | 3300005441 | Bacteria | 14091 |
| 26 | Ga0070678_100020398 | 3300005456 | Bacteria | 4348 |
| 27 | Ga0070662_100017515 | 3300005457 | Bacteria | 4832 |
| 28 | Ga0070662_100067012 | 3300005457 | Bacteria | 2636 |
| 29 | Ga0068867_100000312 | 3300005459 | Bacteria | 32121 |
| 30 | Ga0068867_100016562 | 3300005459 | Bacteria | 5235 |
| 31 | Ga0070685_10000267 | 3300005466 | Bacteria | 33632 |
| 32 | Ga0068853_100064426 | 3300005539 | Bacteria | 3178 |
| 33 | Ga0068853_100141953 | 3300005539 | Bacteria | 2156 |
| 34 | Ga0070672_100008775 | 3300005543 | Bacteria | 6939 |
| 35 | Ga0070665_100000457 | 3300005548 | Bacteria | 59529 |
| 36 | Ga0070665_100095817 | 3300005548 | Bacteria | 2973 |
| 37 | Ga0068855_100022482 | 3300005563 | Bacteria | 7557 |
| 38 | Ga0068855_100041616 | 3300005563 | Bacteria | 5445 |
| 39 | Ga0070664_100073686 | 3300005564 | Bacteria | 2930 |
| 40 | Ga0068857_100093309 | 3300005577 | Bacteria | 2696 |
| 41 | Ga0068854_100005239 | 3300005578 | Bacteria | 8180 |
| 42 | Ga0068854_100008899 | 3300005578 | Bacteria | 6465 |
| 43 | Ga0068852_100046878 | 3300005616 | Bacteria | 3684 |
| 44 | Ga0068852_100062775 | 3300005616 | Bacteria | 3233 |
| 45 | Ga0068852_100079460 | 3300005616 | Bacteria | 2905 |
| 46 | Ga0068866_10007385 | 3300005718 | Bacteria | 4598 |
| 47 | Ga0068861_100009567 | 3300005719 | Bacteria | 6696 |
| 48 | Ga0068851_10002524 | 3300005834 | Bacteria | 8054 |
| 49 | Ga0068858_100002035 | 3300005842 | Bacteria | 20606 |
| 50 | Ga0075368_10016504 | 3300006042 | Bacteria | 2753 |
| 51 | Ga0075363_100006407 | 3300006048 | Bacteria | 5343 |
| 52 | Ga0075432_10025665 | 3300006058 | Bacteria | 2022 |
| 53 | Ga0075362_10010690 | 3300006177 | Bacteria | 3591 |
| 54 | Ga0075367_10006922 | 3300006178 | Bacteria | 5772 |
| 55 | Ga0075370_10000219 | 3300006353 | Bacteria | 20410 |
| 56 | Ga0075370_10004974 | 3300006353 | Bacteria | 6535 |
| 57 | Ga0075370_10011585 | 3300006353 | Bacteria | 4637 |
| 58 | Ga0068865_100005000 | 3300006881 | Bacteria | 8018 |
| 59 | Ga0068865_100044670 | 3300006881 | Bacteria | 3034 |
| 60 | Ga0068865_100229705 | 3300006881 | Bacteria | 1455 |
| 61 | Ga0099823_1000023 | 3300006944 | Bacteria | 75509 |
| 62 | Ga0079104_1002727 | 3300006946 | Bacteria | 9024 |
| 63 | Ga0105240_10002034 | 3300009093 | Bacteria | 33318 |
| 64 | Ga0105240_10003888 | 3300009093 | Bacteria | 23070 |
| 65 | Ga0105240_10010242 | 3300009093 | Bacteria | 13195 |
| 66 | Ga0105243_10002420 | 3300009148 | Bacteria | 15632 |
| 67 | Ga0105243_10183866 | 3300009148 | Bacteria | 1820 |
| 68 | Ga0105242_10009371 | 3300009176 | Bacteria | 7513 |
| 69 | Ga0105242_10013297 | 3300009176 | Bacteria | 6356 |
| 70 | Ga0105242_10252527 | 3300009176 | Bacteria | 1590 |
| 71 | Ga0105237_10001152 | 3300009545 | Bacteria | 35466 |
| 72 | Ga0105237_10007790 | 3300009545 | Bacteria | 11681 |
| 73 | Ga0105237_10011824 | 3300009545 | Bacteria | 9231 |
| 74 | Ga0105237_10344488 | 3300009545 | Bacteria | 1494 |
| 75 | Ga0105238_10004734 | 3300009551 | Bacteria | 13459 |
| 76 | Ga0105238_10006894 | 3300009551 | Bacteria | 11343 |
| 77 | Ga0105238_10070555 | 3300009551 | Bacteria | 3492 |
| 78 | Ga0105249_10008361 | 3300009553 | Bacteria | 9013 |
| 79 | Ga0105239_10000248 | 3300010375 | Bacteria | 80738 |
| 80 | Ga0105239_10076246 | 3300010375 | Bacteria | 3687 |
| 81 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 82 | Ga0157380_10000562 | 3300014326 | Bacteria | 22814 |
| 83 | Ga0182008_10024867 | 3300014497 | Bacteria | 3045 |
| 84 | Ga0157376_10148592 | 3300014969 | Bacteria | 2111 |
| 85 | Ga0182006_1000042 | 3300015261 | Bacteria | 202969 |
| 86 | Ga0182006_1000161 | 3300015261 | Bacteria | 71421 |
| 87 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 88 | Ga0163161_10023727 | 3300017792 | Bacteria | 4329 |
| 89 | Ga0209233_1000691 | 3300025261 | Bacteria | 15972 |
| 90 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 91 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 92 | Ga0209130_1000561 | 3300025284 | Bacteria | 36894 |
| 93 | Ga0209675_1000119 | 3300025291 | Bacteria | 110218 |
| 94 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 95 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 96 | Ga0209050_1009971 | 3300025298 | Bacteria | 4761 |
| 97 | Ga0209256_1000078 | 3300025299 | Bacteria | 225992 |
| 98 | Ga0209256_1000210 | 3300025299 | Bacteria | 110217 |
| 99 | Ga0209256_1000630 | 3300025299 | Bacteria | 48400 |
| 100 | Ga0209051_1000855 | 3300025303 | Bacteria | 31073 |
| 101 | Ga0209257_1000358 | 3300025304 | Bacteria | 93161 |
| 102 | Ga0209257_1011080 | 3300025304 | Bacteria | 4417 |
| 103 | Ga0207656_10000329 | 3300025321 | Bacteria | 16208 |
| 104 | Ga0207682_10010641 | 3300025893 | Bacteria | 3599 |
| 105 | Ga0207647_10000823 | 3300025904 | Bacteria | 24101 |
| 106 | Ga0207645_10018037 | 3300025907 | Bacteria | 4652 |
| 107 | Ga0207645_10029392 | 3300025907 | Bacteria | 3544 |
| 108 | Ga0207643_10043096 | 3300025908 | Bacteria | 2545 |
| 109 | Ga0207705_10083759 | 3300025909 | Bacteria | 2327 |
| 110 | Ga0207654_10026229 | 3300025911 | Bacteria | 3153 |
| 111 | Ga0207695_10000219 | 3300025913 | Bacteria | 153492 |
| 112 | Ga0207695_10013371 | 3300025913 | Bacteria | 9795 |
| 113 | Ga0207695_10014742 | 3300025913 | Bacteria | 9241 |
| 114 | Ga0207695_10020615 | 3300025913 | Bacteria | 7546 |
| 115 | Ga0207671_10001582 | 3300025914 | Bacteria | 25864 |
| 116 | Ga0207671_10006828 | 3300025914 | Bacteria | 10079 |
| 117 | Ga0207671_10015749 | 3300025914 | Bacteria | 5906 |
| 118 | Ga0207671_10019730 | 3300025914 | Bacteria | 5148 |
| 119 | Ga0207657_10072773 | 3300025919 | Bacteria | 2906 |
| 120 | Ga0207681_10012505 | 3300025923 | Bacteria | 5237 |
| 121 | Ga0207694_10001086 | 3300025924 | Bacteria | 23562 |
| 122 | Ga0207694_10006174 | 3300025924 | Bacteria | 9158 |
| 123 | Ga0207644_10226024 | 3300025931 | Bacteria | 1485 |
| 124 | Ga0207706_10003047 | 3300025933 | Bacteria | 16150 |
| 125 | Ga0207686_10002911 | 3300025934 | Bacteria | 9227 |
| 126 | Ga0207709_10003721 | 3300025935 | Bacteria | 8983 |
| 127 | Ga0207704_10002691 | 3300025938 | Bacteria | 8018 |
| 128 | Ga0207704_10039903 | 3300025938 | Bacteria | 2739 |
| 129 | Ga0207689_10001135 | 3300025942 | Bacteria | 25679 |
| 130 | Ga0207667_10018376 | 3300025949 | Bacteria | 7842 |
| 131 | Ga0207651_10020697 | 3300025960 | Bacteria | 3977 |
| 132 | Ga0207651_10149220 | 3300025960 | Bacteria | 1817 |
| 133 | Ga0207712_10000743 | 3300025961 | Bacteria | 24676 |
| 134 | Ga0207640_10004599 | 3300025981 | Bacteria | 7487 |
| 135 | Ga0207658_10042765 | 3300025986 | Bacteria | 3289 |
| 136 | Ga0207677_10018196 | 3300026023 | Bacteria | 4213 |
| 137 | Ga0207677_10094703 | 3300026023 | Bacteria | 2180 |
| 138 | Ga0207703_10003166 | 3300026035 | Bacteria | 13878 |
| 139 | Ga0207639_10000397 | 3300026041 | Bacteria | 29988 |
| 140 | Ga0207639_10333118 | 3300026041 | Bacteria | 1351 |
| 141 | Ga0207678_10000962 | 3300026067 | Bacteria | 26339 |
| 142 | Ga0207678_10037557 | 3300026067 | Bacteria | 4212 |
| 143 | Ga0207678_10044018 | 3300026067 | Bacteria | 3863 |
| 144 | Ga0207708_10003213 | 3300026075 | Bacteria | 12037 |
| 145 | Ga0207648_10000093 | 3300026089 | Bacteria | 84666 |
| 146 | Ga0207648_10011334 | 3300026089 | Bacteria | 8403 |
| 147 | Ga0207674_10239091 | 3300026116 | Bacteria | 1763 |
| 148 | Ga0207675_100073784 | 3300026118 | Bacteria | 3192 |
| 149 | Ga0207683_10044650 | 3300026121 | Bacteria | 3874 |
| 150 | Ga0207698_10016815 | 3300026142 | Bacteria | 4943 |
| 151 | Ga0207698_10019577 | 3300026142 | Bacteria | 4637 |
| 152 | Ga0209389_1006076 | 3300027296 | Bacteria | 10431 |
| 153 | Ga0209813_10008118 | 3300027866 | Bacteria | 2641 |
| 154 | Ga0209974_10001616 | 3300027876 | Bacteria | 8153 |
| 155 | Ga0209974_10005255 | 3300027876 | Bacteria | 4570 |
| 156 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 157 | Ga0268266_10085124 | 3300028379 | Bacteria | 2762 |
| 158 | Ga0265337_1006595 | 3300028556 | Bacteria | 4452 |
| 159 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 160 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 161 | Ga0307515_10000347 | 3300028794 | Bacteria | 114603 |
| 162 | Ga0307515_10002435 | 3300028794 | Bacteria | 40544 |
| 163 | Ga0307515_10012248 | 3300028794 | Bacteria | 16152 |
| 164 | Ga0307515_10094220 | 3300028794 | Bacteria | 3701 |
| 165 | Ga0307515_10158661 | 3300028794 | Bacteria | 2320 |
| 166 | Ga0307515_10183978 | 3300028794 | Bacteria | 2027 |
| 167 | Ga0265327_10000722 | 3300031251 | Bacteria | 51801 |
| 168 | Ga0265316_10034007 | 3300031344 | Bacteria | 4145 |
| 169 | Ga0265316_10053040 | 3300031344 | Bacteria | 3179 |
| 170 | Ga0307513_10001541 | 3300031456 | Bacteria | 33038 |
| 171 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 172 | Ga0307509_10049140 | 3300031507 | Bacteria | 4525 |
| 173 | Ga0307509_10188839 | 3300031507 | Bacteria | 1914 |
| 174 | Ga0307509_10299827 | 3300031507 | Bacteria | 1356 |
| 175 | Ga0307508_10000392 | 3300031616 | Bacteria | 52650 |
| 176 | Ga0307508_10195302 | 3300031616 | Bacteria | 1625 |
| 177 | Ga0307516_10000941 | 3300031730 | Bacteria | 40131 |
| 178 | Ga0307516_10213836 | 3300031730 | Bacteria | 1641 |
| 179 | Ga0307516_10216122 | 3300031730 | Bacteria | 1629 |
| 180 | Ga0307412_10068490 | 3300031911 | Bacteria | 2413 |
| 181 | Ga0307510_10000088 | 3300033180 | Bacteria | 69071 |
| 182 | Ga0307510_10028520 | 3300033180 | Bacteria | 6373 |
| 183 | Ga0395899_0019067 | 3300037312 | Bacteria | 5213 |
| 184 | Ga0395898_0046617 | 3300037466 | Bacteria | 4257 |
| 185 | Ga0395905_0277966 | 3300037471 | Bacteria | 1560 |
| 186 | Ga0395905_0381873 | 3300037471 | Bacteria | 1302 |
| 187 | Ga0395901_0236638 | 3300038443 | Bacteria | 1905 |
| 188 | Ga0439436_0000023 | 3300041404 | Bacteria | 58899 |
| 189 | Ga0451789_0154623 | 3300041443 | Bacteria | 2107 |
| 190 | Ga0451853_0991833 | 3300041512 | Bacteria | 3187 |
| 191 | Ga0439459_0000290 | 3300042438 | Bacteria | 5980 |
| 192 | Ga0451577_0002793 | 3300042876 | Bacteria | 20145 |
| 193 | Ga0451577_0005485 | 3300042876 | Bacteria | 12987 |
| 194 | Ga0451577_0011010 | 3300042876 | Bacteria | 8589 |
| 195 | Ga0451577_0034084 | 3300042876 | Bacteria | 4591 |
| 196 | Ga0451577_0116853 | 3300042876 | Bacteria | 2389 |
| 197 | Ga0466963_0063163 | 3300044694 | Bacteria | 2478 |
| 198 | Ga0466963_0103867 | 3300044694 | Bacteria | 1947 |
| 199 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 200 | Ga0453684_0024365 | 3300044712 | Bacteria | 8846 |
| 201 | Ga0453684_0073421 | 3300044712 | Bacteria | 4312 |
| 202 | Ga0453684_0080005 | 3300044712 | Bacteria | 4083 |
| 203 | Ga0451576_0000120 | 3300045051 | Bacteria | 199365 |
| 204 | Ga0451576_0229161 | 3300045051 | Bacteria | 1940 |
| 205 | Ga0466967_0026217 | 3300045976 | Bacteria | 4823 |
| 206 | Ga0495627_000875 | 3300046453 | Bacteria | 21309 |
| 207 | Ga0495592_0000307 | 3300046454 | Bacteria | 41229 |
| 208 | Ga0495650_0000185 | 3300046471 | Bacteria | 136913 |
| 209 | Ga0495605_0000083 | 3300046474 | Bacteria | 124953 |
| 210 | Ga0495605_0003688 | 3300046474 | Bacteria | 9091 |
| 211 | Ga0495584_0001446 | 3300046491 | Bacteria | 14301 |
| 212 | Ga0495585_0074616 | 3300046492 | Bacteria | 1845 |
| 213 | Ga0495596_0005684 | 3300046500 | Bacteria | 5853 |
| 214 | Ga0495607_0000485 | 3300046501 | Bacteria | 39753 |
| 215 | Ga0495607_0003020 | 3300046501 | Bacteria | 13134 |
| 216 | Ga0495606_0000049 | 3300046507 | Bacteria | 204038 |
| 217 | Ga0495606_0000626 | 3300046507 | Bacteria | 55762 |
| 218 | Ga0495606_0003142 | 3300046507 | Bacteria | 17900 |
| 219 | Ga0495610_0000999 | 3300046512 | Bacteria | 26087 |
| 220 | Ga0495610_0001255 | 3300046512 | Bacteria | 22785 |
| 221 | Ga0495616_0000492 | 3300046513 | Bacteria | 30078 |
| 222 | Ga0495631_0013023 | 3300046518 | Bacteria | 4047 |
| 223 | Ga0495632_0006354 | 3300046519 | Bacteria | 7622 |
| 224 | Ga0495632_0014399 | 3300046519 | Bacteria | 4477 |
| 225 | Ga0495643_0076644 | 3300046522 | Bacteria | 1748 |
| 226 | Ga0495648_0002247 | 3300046524 | Bacteria | 18047 |
| 227 | Ga0495642_0000666 | 3300046528 | Bacteria | 17171 |
| 228 | Ga0495642_0021813 | 3300046528 | Bacteria | 2521 |
| 229 | Ga0495609_0000019 | 3300046538 | Bacteria | 297777 |
| 230 | Ga0495609_0001513 | 3300046538 | Bacteria | 15315 |
| 231 | Ga0495609_0009731 | 3300046538 | Bacteria | 4637 |
| 232 | Ga0495622_0000007 | 3300046557 | Bacteria | 239352 |
| 233 | Ga0495633_0033342 | 3300046558 | Bacteria | 2483 |
| 234 | Ga0495668_0000077 | 3300046616 | Bacteria | 159120 |
| 235 | Ga0495668_0002470 | 3300046616 | Bacteria | 15205 |
| 236 | Ga0495625_0004189 | 3300046660 | Bacteria | 13737 |
| 237 | Ga0495625_0008969 | 3300046660 | Bacteria | 8447 |
| 238 | Ga0495661_0000012 | 3300046665 | Bacteria | 276804 |
| 239 | Ga0495658_0069459 | 3300046683 | Bacteria | 2042 |
| 240 | Ga0495670_0011455 | 3300046691 | Bacteria | 4362 |
| 241 | Ga0495671_0001415 | 3300046692 | Bacteria | 16132 |
| 242 | Ga0495649_0004352 | 3300046694 | Bacteria | 9283 |
| 243 | Ga0495589_0000007 | 3300046794 | Bacteria | 276444 |
| 244 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 245 | Ga0495687_017436 | 3300047443 | Bacteria | 3583 |
| 246 | Ga0495677_0000005 | 3300047445 | Bacteria | 243336 |
| 247 | Ga0495677_0004860 | 3300047445 | Bacteria | 5124 |
| 248 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 249 | Ga0495686_0023545 | 3300047472 | Bacteria | 4061 |
| 250 | Ga0495686_0100901 | 3300047472 | Bacteria | 1741 |
| 251 | Ga0495626_0000428 | 3300048091 | Bacteria | 43156 |
| 252 | Ga0496101_0008640 | 3300048904 | Bacteria | 6659 |
| 253 | Ga0496102_0000645 | 3300048905 | Bacteria | 35369 |
| 254 | Ga0496102_0001150 | 3300048905 | Bacteria | 24162 |
| 255 | Ga0496102_0021590 | 3300048905 | Bacteria | 5694 |
| 256 | Ga0496114_0373031 | 3300048917 | Bacteria | 1263 |
| 257 | Ga0496121_0113536 | 3300048924 | Bacteria | 2061 |
| 258 | Ga0496122_0047476 | 3300048925 | Bacteria | 3315 |
| 259 | Ga0496123_0023039 | 3300048926 | Bacteria | 4780 |
| 260 | Ga0496124_0011236 | 3300048927 | Bacteria | 8972 |
| 261 | Ga0496124_0077428 | 3300048927 | Bacteria | 2743 |
| 262 | Ga0496126_0009749 | 3300048929 | Bacteria | 10170 |
| 263 | Ga0501275_000431 | 3300049772 | Bacteria | 4772 |
| 264 | nmdc:mga03683_19208_c1 | 3300050489 | Bacteria | 2607 |
| 265 | nmdc:mga03683_2135_c1 | 3300050489 | Bacteria | 6098 |
| 266 | nmdc:mga0k408_35858_c1 | 3300050493 | Bacteria | 2845 |
| 267 | nmdc:mga0k408_38089_c1 | 3300050493 | Bacteria | 2761 |
| 268 | nmdc:mga06z11_6141_c1 | 3300050494 | Bacteria | 4864 |
| 269 | nmdc:mga07m45_138401_c1 | 3300050496 | Bacteria | 1410 |
| 270 | nmdc:mga07m45_14299_c1 | 3300050496 | Bacteria | 4225 |
| 271 | nmdc:mga07m45_7115_c1 | 3300050496 | Bacteria | 5699 |
| 272 | nmdc:mga0sz30_6373_c1 | 3300050516 | Bacteria | 3914 |
| 273 | Ga0500635_0000003 | 3300053080 | Bacteria | 216927 |
| 274 | Ga0500578_0066868 | 3300053086 | Bacteria | 2292 |
| 275 | Ga0500643_005405 | 3300053087 | Bacteria | 5511 |
| 276 | Ga0500644_0067511 | 3300053088 | Bacteria | 1279 |
| 277 | Ga0500641_0015865 | 3300053096 | Bacteria | 2801 |
| 278 | Ga0500593_032084 | 3300053117 | Bacteria | 2350 |
| 279 | Ga0500594_0004012 | 3300053118 | Bacteria | 3242 |
| 280 | Ga0500559_0001106 | 3300053136 | Bacteria | 16255 |
| 281 | Ga0500622_0003653 | 3300053156 | Bacteria | 10112 |
| 282 | Ga0500634_0000337 | 3300053161 | Bacteria | 14953 |
| 283 | Ga0500636_0127377 | 3300053177 | Bacteria | 1422 |
| 284 | Ga0500645_000529 | 3300053730 | Bacteria | 25577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0373031 | Ga0496114_0373031_195_1253 | 346 |
| 2 | 3300025960 | Ga0207651_10149220 | Ga0207651_101492201 | 359 |
| 3 | 3300046519 | Ga0495632_0014399 | Ga0495632_0014399_1138_2337 | 359 |
| 4 | 3300046558 | Ga0495633_0033342 | Ga0495633_0033342_130_1329 | 359 |
| 5 | 3300053088 | Ga0500644_0067511 | Ga0500644_0067511_18_1217 | 359 |
| 6 | 3300053161 | Ga0500634_0000337 | Ga0500634_0000337_10292_11491 | 359 |
| 7 | 3300044712 | Ga0453684_0080005 | Ga0453684_0080005_1289_2509 | 367 |
| 8 | 3300028786 | Ga0307517_10000228 | Ga0307517_1000022826 | 368 |
| 9 | 3300028794 | Ga0307515_10000347 | Ga0307515_1000034791 | 368 |
| 10 | 3300005466 | Ga0070685_10000267 | Ga0070685_1000026715 | 369 |
| 11 | 3300009093 | Ga0105240_10002034 | Ga0105240_100020349 | 369 |
| 12 | 3300009545 | Ga0105237_10007790 | Ga0105237_100077904 | 369 |
| 13 | 3300009551 | Ga0105238_10006894 | Ga0105238_100068944 | 369 |
| 14 | 3300025261 | Ga0209233_1000691 | Ga0209233_10006919 | 369 |
| 15 | 3300025913 | Ga0207695_10000219 | Ga0207695_1000021918 | 369 |
| 16 | 3300025914 | Ga0207671_10006828 | Ga0207671_100068283 | 369 |
| 17 | 3300025924 | Ga0207694_10006174 | Ga0207694_100061744 | 369 |
| 18 | 3300026067 | Ga0207678_10044018 | Ga0207678_100440182 | 369 |
| 19 | 3300046660 | Ga0495625_0004189 | Ga0495625_0004189_2044_3243 | 369 |
| 20 | 3300005262 | Ga0065165_1000193 | Ga0065165_100019318 | 370 |
| 21 | 3300009093 | Ga0105240_10010242 | Ga0105240_100102425 | 370 |
| 22 | 3300025913 | Ga0207695_10014742 | Ga0207695_100147423 | 370 |
| 23 | 3300042876 | Ga0451577_0002793 | Ga0451577_0002793_14875_16113 | 370 |
| 24 | 3300006048 | Ga0075363_100006407 | Ga0075363_1000064075 | 371 |
| 25 | 3300006178 | Ga0075367_10006922 | Ga0075367_100069224 | 371 |
| 26 | 3300006353 | Ga0075370_10004974 | Ga0075370_100049745 | 371 |
| 27 | 3300027866 | Ga0209813_10008118 | Ga0209813_100081183 | 371 |
| 28 | 3300050489 | nmdc:mga03683_2135_c1 | nmdc:mga03683_2135_c1_4030_5229 | 371 |
| 29 | 3300050494 | nmdc:mga06z11_6141_c1 | nmdc:mga06z11_6141_c1_1238_2437 | 371 |
| 30 | 3300050496 | nmdc:mga07m45_14299_c1 | nmdc:mga07m45_14299_c1_2330_3529 | 371 |
| 31 | 3300050516 | nmdc:mga0sz30_6373_c1 | nmdc:mga0sz30_6373_c1_1220_2419 | 371 |
| 32 | 3300028794 | Ga0307515_10158661 | Ga0307515_101586612 | 372 |
| 33 | 3300031251 | Ga0265327_10000722 | Ga0265327_1000072224 | 372 |
| 34 | 3300044712 | Ga0453684_0024365 | Ga0453684_0024365_970_2169 | 372 |
| 35 | 3300005331 | Ga0070670_100019587 | Ga0070670_1000195872 | 374 |
| 36 | 3300005338 | Ga0068868_100110325 | Ga0068868_1001103252 | 374 |
| 37 | 3300005457 | Ga0070662_100017515 | Ga0070662_1000175151 | 374 |
| 38 | 3300005539 | Ga0068853_100064426 | Ga0068853_1000644264 | 374 |
| 39 | 3300005548 | Ga0070665_100000457 | Ga0070665_10000045726 | 374 |
| 40 | 3300005563 | Ga0068855_100041616 | Ga0068855_1000416165 | 374 |
| 41 | 3300005577 | Ga0068857_100093309 | Ga0068857_1000933092 | 374 |
| 42 | 3300005578 | Ga0068854_100005239 | Ga0068854_1000052394 | 374 |
| 43 | 3300005616 | Ga0068852_100079460 | Ga0068852_1000794603 | 374 |
| 44 | 3300005834 | Ga0068851_10002524 | Ga0068851_100025245 | 374 |
| 45 | 3300005842 | Ga0068858_100002035 | Ga0068858_1000020359 | 374 |
| 46 | 3300009551 | Ga0105238_10070555 | Ga0105238_100705552 | 374 |
| 47 | 3300009553 | Ga0105249_10008361 | Ga0105249_100083613 | 374 |
| 48 | 3300014969 | Ga0157376_10148592 | Ga0157376_101485922 | 374 |
| 49 | 3300025321 | Ga0207656_10000329 | Ga0207656_100003295 | 374 |
| 50 | 3300025904 | Ga0207647_10000823 | Ga0207647_100008237 | 374 |
| 51 | 3300025913 | Ga0207695_10013371 | Ga0207695_100133713 | 374 |
| 52 | 3300025914 | Ga0207671_10019730 | Ga0207671_100197302 | 374 |
| 53 | 3300025924 | Ga0207694_10001086 | Ga0207694_100010865 | 374 |
| 54 | 3300025938 | Ga0207704_10039903 | Ga0207704_100399032 | 374 |
| 55 | 3300025961 | Ga0207712_10000743 | Ga0207712_1000074316 | 374 |
| 56 | 3300025981 | Ga0207640_10004599 | Ga0207640_100045994 | 374 |
| 57 | 3300026023 | Ga0207677_10094703 | Ga0207677_100947032 | 374 |
| 58 | 3300026035 | Ga0207703_10003166 | Ga0207703_100031666 | 374 |
| 59 | 3300026041 | Ga0207639_10000397 | Ga0207639_1000039711 | 374 |
| 60 | 3300026067 | Ga0207678_10000962 | Ga0207678_1000096217 | 374 |
| 61 | 3300026142 | Ga0207698_10019577 | Ga0207698_100195772 | 374 |
| 62 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008511 | 374 |
| 63 | 3300053080 | Ga0500635_0000003 | Ga0500635_0000003_151566_152768 | 374 |
| 64 | 3300006353 | Ga0075370_10011585 | Ga0075370_100115855 | 375 |
| 65 | 3300005328 | Ga0070676_10027028 | Ga0070676_100270283 | 376 |
| 66 | 3300005459 | Ga0068867_100016562 | Ga0068867_1000165624 | 376 |
| 67 | 3300006881 | Ga0068865_100044670 | Ga0068865_1000446704 | 376 |
| 68 | 3300009176 | Ga0105242_10252527 | Ga0105242_102525272 | 376 |
| 69 | 3300025907 | Ga0207645_10029392 | Ga0207645_100293923 | 376 |
| 70 | 3300026089 | Ga0207648_10011334 | Ga0207648_100113346 | 376 |
| 71 | 3300050493 | nmdc:mga0k408_38089_c1 | nmdc:mga0k408_38089_c1_495_1694 | 376 |
| 72 | 3300053096 | Ga0500641_0015865 | Ga0500641_0015865_1529_2725 | 376 |
| 73 | 3300005616 | Ga0068852_100046878 | Ga0068852_1000468783 | 377 |
| 74 | 3300005718 | Ga0068866_10007385 | Ga0068866_100073851 | 377 |
| 75 | 3300026142 | Ga0207698_10016815 | Ga0207698_100168154 | 377 |
| 76 | 3300048927 | Ga0496124_0077428 | Ga0496124_0077428_286_1485 | 377 |
| 77 | 3300006946 | Ga0079104_1002727 | Ga0079104_10027273 | 378 |
| 78 | 3300014326 | Ga0157380_10000562 | Ga0157380_1000056223 | 378 |
| 79 | 3300015261 | Ga0182006_1000042 | Ga0182006_100004263 | 378 |
| 80 | 3300015265 | Ga0182005_1000008 | Ga0182005_100000844 | 378 |
| 81 | 3300046454 | Ga0495592_0000307 | Ga0495592_0000307_4796_5995 | 378 |
| 82 | 3300048927 | Ga0496124_0011236 | Ga0496124_0011236_1510_2718 | 378 |
| 83 | 3300049772 | Ga0501275_000431 | Ga0501275_000431_1511_2722 | 378 |
| 84 | 3300046471 | Ga0495650_0000185 | Ga0495650_0000185_41611_42810 | 379 |
| 85 | 3300046557 | Ga0495622_0000007 | Ga0495622_0000007_124286_125497 | 379 |
| 86 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_231420_232628 | 379 |
| 87 | 3300048924 | Ga0496121_0113536 | Ga0496121_0113536_240_1445 | 379 |
| 88 | 3300048929 | Ga0496126_0009749 | Ga0496126_0009749_3901_5109 | 379 |
| 89 | 3300003323 | rootH1_10021569 | rootH1_100215693 | 380 |
| 90 | 3300003794 | Ga0055531_10007102 | Ga0055531_100071022 | 380 |
| 91 | 3300006944 | Ga0099823_1000023 | Ga0099823_10000234 | 380 |
| 92 | 3300025298 | Ga0209050_1009971 | Ga0209050_10099714 | 380 |
| 93 | 3300025299 | Ga0209256_1000630 | Ga0209256_100063022 | 380 |
| 94 | 3300025303 | Ga0209051_1000855 | Ga0209051_100085518 | 380 |
| 95 | 3300025304 | Ga0209257_1011080 | Ga0209257_10110803 | 380 |
| 96 | 3300027296 | Ga0209389_1006076 | Ga0209389_10060764 | 380 |
| 97 | 3300044694 | Ga0466963_0103867 | Ga0466963_0103867_558_1760 | 380 |
| 98 | 3300046453 | Ga0495627_000875 | Ga0495627_000875_10526_11734 | 380 |
| 99 | 3300046474 | Ga0495605_0000083 | Ga0495605_0000083_32317_33525 | 380 |
| 100 | 3300046492 | Ga0495585_0074616 | Ga0495585_0074616_441_1649 | 380 |
| 101 | 3300046500 | Ga0495596_0005684 | Ga0495596_0005684_4129_5337 | 380 |
| 102 | 3300046501 | Ga0495607_0003020 | Ga0495607_0003020_9324_10532 | 380 |
| 103 | 3300046507 | Ga0495606_0000626 | Ga0495606_0000626_47732_48940 | 380 |
| 104 | 3300046518 | Ga0495631_0013023 | Ga0495631_0013023_2193_3401 | 380 |
| 105 | 3300046524 | Ga0495648_0002247 | Ga0495648_0002247_9088_10296 | 380 |
| 106 | 3300046528 | Ga0495642_0000666 | Ga0495642_0000666_5190_6398 | 380 |
| 107 | 3300046538 | Ga0495609_0009731 | Ga0495609_0009731_2033_3241 | 380 |
| 108 | 3300046616 | Ga0495668_0002470 | Ga0495668_0002470_8179_9387 | 380 |
| 109 | 3300046692 | Ga0495671_0001415 | Ga0495671_0001415_12905_14113 | 380 |
| 110 | 3300047445 | Ga0495677_0004860 | Ga0495677_0004860_2187_3395 | 380 |
| 111 | 3300048905 | Ga0496102_0000645 | Ga0496102_0000645_11503_12711 | 380 |
| 112 | 3300006353 | Ga0075370_10000219 | Ga0075370_100002194 | 381 |
| 113 | 3300028794 | Ga0307515_10094220 | Ga0307515_100942202 | 381 |
| 114 | 3300031344 | Ga0265316_10034007 | Ga0265316_100340072 | 381 |
| 115 | 3300031456 | Ga0307513_10001541 | Ga0307513_1000154117 | 381 |
| 116 | 3300046519 | Ga0495632_0006354 | Ga0495632_0006354_1561_2760 | 381 |
| 117 | 3300046694 | Ga0495649_0004352 | Ga0495649_0004352_146_1345 | 381 |
| 118 | 3300047443 | Ga0495687_017436 | Ga0495687_017436_203_1402 | 381 |
| 119 | 3300003775 | Ga0055524_1000417 | Ga0055524_100041724 | 382 |
| 120 | 3300003794 | Ga0055531_10020359 | Ga0055531_100203592 | 382 |
| 121 | 3300012497 | Ga0157319_1000001 | Ga0157319_1000001313 | 382 |
| 122 | 3300025299 | Ga0209256_1000078 | Ga0209256_100007845 | 382 |
| 123 | 3300025304 | Ga0209257_1000358 | Ga0209257_100035858 | 382 |
| 124 | 3300042438 | Ga0439459_0000290 | Ga0439459_0000290_4559_5809 | 382 |
| 125 | 3300044712 | Ga0453684_0000159 | Ga0453684_0000159_23697_24914 | 382 |
| 126 | 3300045051 | Ga0451576_0000120 | Ga0451576_0000120_23697_24914 | 382 |
| 127 | 3300053730 | Ga0500645_000529 | Ga0500645_000529_21380_22597 | 384 |
| 128 | 3300028794 | Ga0307515_10000131 | Ga0307515_1000013142 | 385 |
| 129 | 3300044694 | Ga0466963_0063163 | Ga0466963_0063163_793_2001 | 385 |
| 130 | 3300045976 | Ga0466967_0026217 | Ga0466967_0026217_2648_3856 | 385 |
| 131 | iso_pu_bacteria | 2928115317 | 2928117677 | 388 |
| 132 | iso_pu_bacteria | 2585428062 | 2587758871 | 389 |
| 133 | iso_pu_bacteria | 2842918807 | 2842922459 | 390 |
| 134 | iso_pu_bacteria | 2886848708 | 2886853174 | 390 |
| 135 | iso_pu_bacteria | 2919704043 | 2919708487 | 390 |
| 136 | 3300031344 | Ga0265316_10053040 | Ga0265316_100530402 | 391 |
| 137 | 3300005328 | Ga0070676_10002766 | Ga0070676_100027666 | 392 |
| 138 | 3300005334 | Ga0068869_100001898 | Ga0068869_1000018989 | 392 |
| 139 | 3300005338 | Ga0068868_100044354 | Ga0068868_1000443542 | 392 |
| 140 | 3300005353 | Ga0070669_100008469 | Ga0070669_1000084692 | 392 |
| 141 | 3300005355 | Ga0070671_100006386 | Ga0070671_1000063868 | 392 |
| 142 | 3300005438 | Ga0070701_10055990 | Ga0070701_100559902 | 392 |
| 143 | 3300005441 | Ga0070700_100000977 | Ga0070700_1000009777 | 392 |
| 144 | 3300005456 | Ga0070678_100020398 | Ga0070678_1000203984 | 392 |
| 145 | 3300005459 | Ga0068867_100000312 | Ga0068867_1000003128 | 392 |
| 146 | 3300005543 | Ga0070672_100008775 | Ga0070672_1000087753 | 392 |
| 147 | 3300005719 | Ga0068861_100009567 | Ga0068861_1000095675 | 392 |
| 148 | 3300006881 | Ga0068865_100005000 | Ga0068865_1000050005 | 392 |
| 149 | 3300009148 | Ga0105243_10002420 | Ga0105243_100024206 | 392 |
| 150 | 3300009176 | Ga0105242_10013297 | Ga0105242_100132974 | 392 |
| 151 | 3300025893 | Ga0207682_10010641 | Ga0207682_100106412 | 392 |
| 152 | 3300025907 | Ga0207645_10018037 | Ga0207645_100180373 | 392 |
| 153 | 3300025908 | Ga0207643_10043096 | Ga0207643_100430962 | 392 |
| 154 | 3300025923 | Ga0207681_10012505 | Ga0207681_100125054 | 392 |
| 155 | 3300025931 | Ga0207644_10226024 | Ga0207644_102260242 | 392 |
| 156 | 3300025934 | Ga0207686_10002911 | Ga0207686_100029116 | 392 |
| 157 | 3300025935 | Ga0207709_10003721 | Ga0207709_100037212 | 392 |
| 158 | 3300025938 | Ga0207704_10002691 | Ga0207704_100026912 | 392 |
| 159 | 3300025942 | Ga0207689_10001135 | Ga0207689_1000113515 | 392 |
| 160 | 3300025960 | Ga0207651_10020697 | Ga0207651_100206972 | 392 |
| 161 | 3300026023 | Ga0207677_10018196 | Ga0207677_100181963 | 392 |
| 162 | 3300026075 | Ga0207708_10003213 | Ga0207708_100032134 | 392 |
| 163 | 3300026089 | Ga0207648_10000093 | Ga0207648_1000009348 | 392 |
| 164 | 3300026118 | Ga0207675_100073784 | Ga0207675_1000737842 | 392 |
| 165 | 3300026121 | Ga0207683_10044650 | Ga0207683_100446502 | 392 |
| 166 | 3300028556 | Ga0265337_1006595 | Ga0265337_10065952 | 392 |
| 167 | 3300042876 | Ga0451577_0034084 | Ga0451577_0034084_2702_3904 | 392 |
| 168 | iso_pu_bacteria | 2687453130 | 2687582186 | 392 |
| 169 | iso_pu_bacteria | 2946787523 | 2946788927 | 392 |
| 170 | 3300003771 | Ga0055526_1000424 | Ga0055526_100042411 | 393 |
| 171 | 3300003773 | Ga0055537_1000330 | Ga0055537_10003309 | 393 |
| 172 | 3300003775 | Ga0055524_1002724 | Ga0055524_10027246 | 393 |
| 173 | 3300003784 | Ga0055534_1000147 | Ga0055534_10001477 | 393 |
| 174 | 3300003790 | Ga0055528_1000364 | Ga0055528_100036412 | 393 |
| 175 | 3300004625 | Ga0055543_1002802 | Ga0055543_10028025 | 393 |
| 176 | 3300005262 | Ga0065165_1000726 | Ga0065165_100072633 | 393 |
| 177 | 3300005366 | Ga0070659_100066805 | Ga0070659_1000668053 | 393 |
| 178 | 3300005367 | Ga0070667_100152971 | Ga0070667_1001529712 | 393 |
| 179 | 3300005457 | Ga0070662_100067012 | Ga0070662_1000670123 | 393 |
| 180 | 3300005539 | Ga0068853_100141953 | Ga0068853_1001419531 | 393 |
| 181 | 3300005548 | Ga0070665_100095817 | Ga0070665_1000958172 | 393 |
| 182 | 3300005563 | Ga0068855_100022482 | Ga0068855_1000224822 | 393 |
| 183 | 3300005564 | Ga0070664_100073686 | Ga0070664_1000736862 | 393 |
| 184 | 3300005578 | Ga0068854_100008899 | Ga0068854_1000088996 | 393 |
| 185 | 3300005616 | Ga0068852_100062775 | Ga0068852_1000627753 | 393 |
| 186 | 3300006042 | Ga0075368_10016504 | Ga0075368_100165043 | 393 |
| 187 | 3300006058 | Ga0075432_10025665 | Ga0075432_100256653 | 393 |
| 188 | 3300006177 | Ga0075362_10010690 | Ga0075362_100106903 | 393 |
| 189 | 3300006881 | Ga0068865_100229705 | Ga0068865_1002297051 | 393 |
| 190 | 3300009093 | Ga0105240_10003888 | Ga0105240_1000388813 | 393 |
| 191 | 3300009148 | Ga0105243_10183866 | Ga0105243_101838662 | 393 |
| 192 | 3300009176 | Ga0105242_10009371 | Ga0105242_100093716 | 393 |
| 193 | 3300009545 | Ga0105237_10001152 | Ga0105237_100011527 | 393 |
| 194 | 3300009545 | Ga0105237_10011824 | Ga0105237_100118245 | 393 |
| 195 | 3300009545 | Ga0105237_10344488 | Ga0105237_103444881 | 393 |
| 196 | 3300009551 | Ga0105238_10004734 | Ga0105238_100047343 | 393 |
| 197 | 3300010375 | Ga0105239_10000248 | Ga0105239_100002487 | 393 |
| 198 | 3300010375 | Ga0105239_10076246 | Ga0105239_100762463 | 393 |
| 199 | 3300025263 | Ga0209565_1000003 | Ga0209565_100000319 | 393 |
| 200 | 3300025273 | Ga0209673_1000017 | Ga0209673_1000017390 | 393 |
| 201 | 3300025284 | Ga0209130_1000561 | Ga0209130_10005614 | 393 |
| 202 | 3300025291 | Ga0209675_1000119 | Ga0209675_100011919 | 393 |
| 203 | 3300025295 | Ga0209564_1000010 | Ga0209564_1000010619 | 393 |
| 204 | 3300025295 | Ga0209564_1000016 | Ga0209564_100001696 | 393 |
| 205 | 3300025299 | Ga0209256_1000210 | Ga0209256_100021019 | 393 |
| 206 | 3300025909 | Ga0207705_10083759 | Ga0207705_100837592 | 393 |
| 207 | 3300025911 | Ga0207654_10026229 | Ga0207654_100262293 | 393 |
| 208 | 3300025913 | Ga0207695_10020615 | Ga0207695_100206154 | 393 |
| 209 | 3300025914 | Ga0207671_10001582 | Ga0207671_1000158223 | 393 |
| 210 | 3300025914 | Ga0207671_10015749 | Ga0207671_100157494 | 393 |
| 211 | 3300025919 | Ga0207657_10072773 | Ga0207657_100727733 | 393 |
| 212 | 3300025933 | Ga0207706_10003047 | Ga0207706_100030473 | 393 |
| 213 | 3300025949 | Ga0207667_10018376 | Ga0207667_100183763 | 393 |
| 214 | 3300025986 | Ga0207658_10042765 | Ga0207658_100427652 | 393 |
| 215 | 3300026041 | Ga0207639_10333118 | Ga0207639_103331181 | 393 |
| 216 | 3300026067 | Ga0207678_10037557 | Ga0207678_100375572 | 393 |
| 217 | 3300026116 | Ga0207674_10239091 | Ga0207674_102390912 | 393 |
| 218 | 3300027876 | Ga0209974_10001616 | Ga0209974_100016168 | 393 |
| 219 | 3300027876 | Ga0209974_10005255 | Ga0209974_100052552 | 393 |
| 220 | 3300028379 | Ga0268266_10085124 | Ga0268266_100851243 | 393 |
| 221 | 3300028794 | Ga0307515_10002435 | Ga0307515_1000243512 | 393 |
| 222 | 3300028794 | Ga0307515_10012248 | Ga0307515_100122483 | 393 |
| 223 | 3300028794 | Ga0307515_10183978 | Ga0307515_101839783 | 393 |
| 224 | 3300031507 | Ga0307509_10000426 | Ga0307509_1000042616 | 393 |
| 225 | 3300031507 | Ga0307509_10049140 | Ga0307509_100491404 | 393 |
| 226 | 3300031507 | Ga0307509_10188839 | Ga0307509_101888392 | 393 |
| 227 | 3300031507 | Ga0307509_10299827 | Ga0307509_102998271 | 393 |
| 228 | 3300031616 | Ga0307508_10000392 | Ga0307508_1000039227 | 393 |
| 229 | 3300031616 | Ga0307508_10195302 | Ga0307508_101953022 | 393 |
| 230 | 3300031730 | Ga0307516_10000941 | Ga0307516_100009417 | 393 |
| 231 | 3300031730 | Ga0307516_10213836 | Ga0307516_102138362 | 393 |
| 232 | 3300031730 | Ga0307516_10216122 | Ga0307516_102161222 | 393 |
| 233 | 3300033180 | Ga0307510_10000088 | Ga0307510_1000008819 | 393 |
| 234 | 3300033180 | Ga0307510_10028520 | Ga0307510_100285205 | 393 |
| 235 | 3300037312 | Ga0395899_0019067 | Ga0395899_0019067_2924_4132 | 393 |
| 236 | 3300037466 | Ga0395898_0046617 | Ga0395898_0046617_2972_4180 | 393 |
| 237 | 3300037471 | Ga0395905_0277966 | Ga0395905_0277966_272_1480 | 393 |
| 238 | 3300037471 | Ga0395905_0381873 | Ga0395905_0381873_78_1286 | 393 |
| 239 | 3300038443 | Ga0395901_0236638 | Ga0395901_0236638_286_1494 | 393 |
| 240 | 3300041443 | Ga0451789_0154623 | Ga0451789_0154623_771_1988 | 393 |
| 241 | 3300041512 | Ga0451853_0991833 | Ga0451853_0991833_1265_2464 | 393 |
| 242 | 3300042876 | Ga0451577_0005485 | Ga0451577_0005485_4123_5334 | 393 |
| 243 | 3300042876 | Ga0451577_0011010 | Ga0451577_0011010_2229_3461 | 393 |
| 244 | 3300042876 | Ga0451577_0116853 | Ga0451577_0116853_723_1955 | 393 |
| 245 | 3300044712 | Ga0453684_0073421 | Ga0453684_0073421_1016_2248 | 393 |
| 246 | 3300045051 | Ga0451576_0229161 | Ga0451576_0229161_273_1505 | 393 |
| 247 | 3300046474 | Ga0495605_0003688 | Ga0495605_0003688_4769_5977 | 393 |
| 248 | 3300046491 | Ga0495584_0001446 | Ga0495584_0001446_9110_10318 | 393 |
| 249 | 3300046501 | Ga0495607_0000485 | Ga0495607_0000485_6269_7477 | 393 |
| 250 | 3300046507 | Ga0495606_0000049 | Ga0495606_0000049_60066_61274 | 393 |
| 251 | 3300046512 | Ga0495610_0000999 | Ga0495610_0000999_21164_22372 | 393 |
| 252 | 3300046513 | Ga0495616_0000492 | Ga0495616_0000492_25102_26310 | 393 |
| 253 | 3300046522 | Ga0495643_0076644 | Ga0495643_0076644_55_1263 | 393 |
| 254 | 3300046528 | Ga0495642_0021813 | Ga0495642_0021813_603_1811 | 393 |
| 255 | 3300046538 | Ga0495609_0000019 | Ga0495609_0000019_182892_184100 | 393 |
| 256 | 3300046616 | Ga0495668_0000077 | Ga0495668_0000077_60018_61226 | 393 |
| 257 | 3300046660 | Ga0495625_0008969 | Ga0495625_0008969_434_1807 | 393 |
| 258 | 3300046665 | Ga0495661_0000012 | Ga0495661_0000012_57239_58447 | 393 |
| 259 | 3300046683 | Ga0495658_0069459 | Ga0495658_0069459_613_1812 | 393 |
| 260 | 3300046794 | Ga0495589_0000007 | Ga0495589_0000007_56879_58087 | 393 |
| 261 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_182919_184127 | 393 |
| 262 | 3300047445 | Ga0495677_0000005 | Ga0495677_0000005_218580_219788 | 393 |
| 263 | 3300047472 | Ga0495686_0023545 | Ga0495686_0023545_946_2154 | 393 |
| 264 | 3300047472 | Ga0495686_0100901 | Ga0495686_0100901_232_1605 | 393 |
| 265 | 3300048091 | Ga0495626_0000428 | Ga0495626_0000428_37081_38289 | 393 |
| 266 | 3300048905 | Ga0496102_0001150 | Ga0496102_0001150_2972_4171 | 393 |
| 267 | 3300048905 | Ga0496102_0021590 | Ga0496102_0021590_962_2161 | 393 |
| 268 | 3300050489 | nmdc:mga03683_19208_c1 | nmdc:mga03683_19208_c1_407_1606 | 393 |
| 269 | 3300050493 | nmdc:mga0k408_35858_c1 | nmdc:mga0k408_35858_c1_1387_2586 | 393 |
| 270 | 3300050496 | nmdc:mga07m45_138401_c1 | nmdc:mga07m45_138401_c1_100_1299 | 393 |
| 271 | 3300050496 | nmdc:mga07m45_7115_c1 | nmdc:mga07m45_7115_c1_2536_3735 | 393 |
| 272 | 3300053086 | Ga0500578_0066868 | Ga0500578_0066868_1000_2199 | 393 |
| 273 | 3300053087 | Ga0500643_005405 | Ga0500643_005405_2648_3865 | 393 |
| 274 | 3300053117 | Ga0500593_032084 | Ga0500593_032084_271_1470 | 393 |
| 275 | 3300053118 | Ga0500594_0004012 | Ga0500594_0004012_1269_2468 | 393 |
| 276 | 3300053136 | Ga0500559_0001106 | Ga0500559_0001106_9913_11112 | 393 |
| 277 | 3300053156 | Ga0500622_0003653 | Ga0500622_0003653_1811_3010 | 393 |
| 278 | 3300053177 | Ga0500636_0127377 | Ga0500636_0127377_188_1387 | 393 |
| 279 | 3300002075 | JGI24738J21930_10000523 | JGI24738J21930_100005232 | 394 |
| 280 | 3300014497 | Ga0182008_10024867 | Ga0182008_100248672 | 394 |
| 281 | 3300015261 | Ga0182006_1000161 | Ga0182006_100016156 | 394 |
| 282 | 3300017792 | Ga0163161_10023727 | Ga0163161_100237272 | 394 |
| 283 | 3300031911 | Ga0307412_10068490 | Ga0307412_100684902 | 394 |
| 284 | 3300041404 | Ga0439436_0000023 | Ga0439436_0000023_11951_13135 | 394 |
| 285 | 3300046507 | Ga0495606_0003142 | Ga0495606_0003142_694_1878 | 394 |
| 286 | 3300046512 | Ga0495610_0001255 | Ga0495610_0001255_14301_15485 | 394 |
| 287 | 3300046538 | Ga0495609_0001513 | Ga0495609_0001513_14033_15253 | 394 |
| 288 | 3300046691 | Ga0495670_0011455 | Ga0495670_0011455_2324_3508 | 394 |
| 289 | 3300048904 | Ga0496101_0008640 | Ga0496101_0008640_2588_3775 | 394 |
| 290 | 3300048925 | Ga0496122_0047476 | Ga0496122_0047476_1434_2621 | 394 |
| 291 | 3300048926 | Ga0496123_0023039 | Ga0496123_0023039_1768_2955 | 394 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bz2-assembly1.cif.gz_A-2 | crystal structure of the sodium proton antiporter napa in inward-facing conformation | 0.7907 | 7 | 392 |
| 5bz2-assembly1.cif.gz_A-2 | crystal structure of the sodium proton antiporter napa in inward-facing conformation | 0.7535 | 7 | 392 |
| 8otx-assembly1.cif.gz_B | cryo-em structure of strongylocentrotus purpuratus sperm-specific na+/h+ exchanger slc9c1 in nanodisc | 0.7152 | 1 | 393 |
| 8otx-assembly1.cif.gz_B | cryo-em structure of strongylocentrotus purpuratus sperm-specific na+/h+ exchanger slc9c1 in nanodisc | 0.7121 | 1 | 393 |
| 8by2-assembly1.cif.gz_A | structure of the k+/h+ exchanger kefc with gsh. | 0.7068 | 4 | 394 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LYU2_28_437_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8918 | 7 | 391 | 1.20.1530.20 |
| af_I1LMR0_38_443_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8785 | 7 | 391 | 1.20.1530.20 |
| af_A0A0P0YC61_1_270_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8779 | 144 | 385 | 1.20.1530.20 |
| af_Q54GC7_13_418_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8764 | 7 | 387 | 1.20.1530.20 |
| af_I1ME88_42_441_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.875 | 7 | 385 | 1.20.1530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M2LPS6-F1-model_v4 | Sodium:proton exchanger | 0.997 | 1 | 392 |
GO:0015297
GO:0016020 GO:1902600 |
| AF-A0A4Y5Z6F4-F1-model_v4 | Cation:proton antiporter | 0.9963 | 1 | 392 |
GO:0015297
GO:0016020 GO:1902600 |
| AF-A0A0Q4KIM7-F1-model_v4 | Sodium:proton exchanger | 0.9956 | 1 | 392 |
GO:0015297
GO:0016020 GO:1902600 |
| AF-A0A1W9IZM2-F1-model_v4 | Cation/H(+) antiporter | 0.9947 | 1 | 393 |
GO:0015297
GO:0016020 GO:1902600 |
| AF-A0A6L8KVK4-F1-model_v4 | Cation:proton antiporter | 0.9943 | 1 | 391 |
GO:0015297
GO:0016020 GO:1902600 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar