F390524
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 168 | 281 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0024461|Ga0495606_0024461_2383_3267 |
| Length | 281 |
| Sequence | MIYTKRFIFDKKFGEQIIITNFMSIKLLINLANPNFMSTISQNIKFLRKKKGITQQQFADEVGIKRSLVGAYEEERAEPKYELLKALAIYFDITIDDFINETIDEKWAPKPKGNPANLRVLSISVDKEDNENIEMVPMKASAGYLNGYADPEYVSKLPKFYLPMFKQGTFRAFEIKGDSMLPIISGDIIIGEYLENWADLKSGETYIIISKNDGVVYKRVGNKFKENKKLKLISDNPVYEPYEINGEDVLEIWKAKGYISTQLPQPTQMQRSISNLQQSNN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 5 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 8 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 9 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 10 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 11 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 104 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 107 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 108 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 119 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 128 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 165 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 166 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 168 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.22 |
| Metatranscriptomes | 0 |
| Isolates | 3.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.9 |
| Nodule | 0 |
| Rhizoplane | 0.69 |
| Rhizosphere | 81.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003555 | 3300001904 | Bacteria | 2696 |
| 2 | JGI24736J21556_1007427 | 3300001904 | Bacteria | 1842 |
| 3 | JGI24740J21852_10078723 | 3300001979 | Bacteria | 868 |
| 4 | JGI24737J22298_10000227 | 3300001990 | Bacteria | 18576 |
| 5 | JGI24737J22298_10014282 | 3300001990 | Bacteria | 2579 |
| 6 | JGI24737J22298_10016419 | 3300001990 | Bacteria | 2390 |
| 7 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 8 | JGI24735J21928_10011866 | 3300002067 | Bacteria | 2757 |
| 9 | JGI25162J39368_1000022 | 3300002737 | Bacteria | 239510 |
| 10 | JGI25162J39368_1000961 | 3300002737 | Bacteria | 18378 |
| 11 | JGI25157J39369_1008227 | 3300002741 | Bacteria | 1460 |
| 12 | JGI25164J39214_1001399 | 3300002772 | Bacteria | 5723 |
| 13 | JGI25165J46597_1001179 | 3300003214 | Bacteria | 16018 |
| 14 | JGI25165J46597_1001485 | 3300003214 | Bacteria | 12076 |
| 15 | JGI25165J46597_1006465 | 3300003214 | Bacteria | 2076 |
| 16 | rootH1_10083870 | 3300003316 | Bacteria | 1822 |
| 17 | rootH2_10004415 | 3300003320 | Bacteria | 27098 |
| 18 | rootH2_10057092 | 3300003320 | Bacteria | 3648 |
| 19 | rootH2_10096525 | 3300003320 | Bacteria | 5981 |
| 20 | rootL2_10127356 | 3300003322 | Bacteria | 3288 |
| 21 | rootL2_10205062 | 3300003322 | Bacteria | 1940 |
| 22 | rootL2_10270125 | 3300003322 | Bacteria | 3756 |
| 23 | rootL2_10280638 | 3300003322 | Unclassified | 1486 |
| 24 | rootH1_10006785 | 3300003323 | Bacteria | 51850 |
| 25 | rootH1_10028473 | 3300003323 | Bacteria | 8789 |
| 26 | rootH1_10036067 | 3300003323 | Bacteria | 14639 |
| 27 | rootH1_10165154 | 3300003316 | Bacteria | 1265 |
| 28 | rootH1_10165154 | 3300003323 | Bacteria | 3764 |
| 29 | Ga0055531_10004256 | 3300003794 | Bacteria | 8796 |
| 30 | Ga0065714_10078008 | 3300005288 | Bacteria | 2625 |
| 31 | Ga0065715_10089444 | 3300005293 | Bacteria | 10138 |
| 32 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 33 | Ga0070658_10070798 | 3300005327 | Bacteria | 2856 |
| 34 | Ga0070658_10190768 | 3300005327 | Bacteria | 1727 |
| 35 | Ga0070658_10306903 | 3300005327 | Bacteria | 1354 |
| 36 | Ga0070658_10366936 | 3300005327 | Bacteria | 1234 |
| 37 | Ga0070676_10000165 | 3300005328 | Bacteria | 26705 |
| 38 | Ga0070683_100006104 | 3300005329 | Bacteria | 10102 |
| 39 | Ga0070683_100542528 | 3300005329 | Bacteria | 1112 |
| 40 | Ga0068869_100207390 | 3300005334 | Bacteria | 1548 |
| 41 | Ga0070680_100001197 | 3300005336 | Bacteria | 18706 |
| 42 | Ga0070660_100024845 | 3300005339 | Bacteria | 4450 |
| 43 | Ga0070671_100007630 | 3300005355 | Bacteria | 8653 |
| 44 | Ga0070673_100026243 | 3300005364 | Bacteria | 4301 |
| 45 | Ga0070659_100000854 | 3300005366 | Bacteria | 22245 |
| 46 | Ga0070659_100013570 | 3300005366 | Bacteria | 6068 |
| 47 | Ga0070663_100096113 | 3300005455 | Bacteria | 2203 |
| 48 | Ga0070678_100015400 | 3300005456 | Bacteria | 4861 |
| 49 | Ga0070662_100000185 | 3300005457 | Bacteria | 36147 |
| 50 | Ga0068867_100000116 | 3300005459 | Bacteria | 50447 |
| 51 | Ga0070679_100001998 | 3300005530 | Bacteria | 18314 |
| 52 | Ga0070684_100051250 | 3300005535 | Bacteria | 3585 |
| 53 | Ga0068853_100084815 | 3300005539 | Bacteria | 2776 |
| 54 | Ga0068853_100524220 | 3300005539 | Bacteria | 1120 |
| 55 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 56 | Ga0068855_100000196 | 3300005563 | Bacteria | 78135 |
| 57 | Ga0068855_100000519 | 3300005563 | Bacteria | 47297 |
| 58 | Ga0068855_100004987 | 3300005563 | Bacteria | 16203 |
| 59 | Ga0068855_100084823 | 3300005563 | Bacteria | 3666 |
| 60 | Ga0068855_100992604 | 3300005563 | Bacteria | 882 |
| 61 | Ga0068854_100120936 | 3300005578 | Bacteria | 1988 |
| 62 | Ga0068856_100000092 | 3300005614 | Bacteria | 84781 |
| 63 | Ga0068856_100002099 | 3300005614 | Bacteria | 20660 |
| 64 | Ga0068852_100961013 | 3300005616 | Bacteria | 872 |
| 65 | Ga0068864_100435737 | 3300005618 | Bacteria | 1251 |
| 66 | Ga0068866_10028350 | 3300005718 | Bacteria | 2667 |
| 67 | Ga0068863_100581647 | 3300005841 | Bacteria | 1107 |
| 68 | Ga0068863_100615990 | 3300005841 | Bacteria | 1075 |
| 69 | Ga0075366_10000849 | 3300006195 | Bacteria | 14722 |
| 70 | Ga0075366_10108077 | 3300006195 | Bacteria | 1673 |
| 71 | Ga0097621_100000054 | 3300006237 | Bacteria | 59756 |
| 72 | Ga0068871_100000145 | 3300006358 | Bacteria | 46320 |
| 73 | Ga0068865_100000051 | 3300006881 | Bacteria | 65346 |
| 74 | Ga0105240_10000722 | 3300009093 | Bacteria | 60400 |
| 75 | Ga0105240_10373614 | 3300009093 | Bacteria | 1611 |
| 76 | Ga0105240_10483746 | 3300009093 | Bacteria | 1379 |
| 77 | Ga0105241_10010287 | 3300009174 | Bacteria | 6871 |
| 78 | Ga0105241_10023476 | 3300009174 | Bacteria | 4574 |
| 79 | Ga0105237_10000818 | 3300009545 | Bacteria | 42552 |
| 80 | Ga0105237_10002246 | 3300009545 | Bacteria | 24061 |
| 81 | Ga0105237_10003874 | 3300009545 | Bacteria | 17567 |
| 82 | Ga0105237_10026966 | 3300009545 | Bacteria | 5869 |
| 83 | Ga0105237_10371117 | 3300009545 | Bacteria | 1436 |
| 84 | Ga0105238_10183082 | 3300009551 | Bacteria | 2071 |
| 85 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 86 | Ga0105239_10000074 | 3300010375 | Bacteria | 140673 |
| 87 | Ga0105239_10009550 | 3300010375 | Bacteria | 10916 |
| 88 | Ga0105239_10011559 | 3300010375 | Bacteria | 9848 |
| 89 | Ga0105239_10013160 | 3300010375 | Bacteria | 9192 |
| 90 | Ga0105239_10075730 | 3300010375 | Bacteria | 3701 |
| 91 | Ga0157373_10000161 | 3300013100 | Bacteria | 54194 |
| 92 | Ga0157373_10001209 | 3300013100 | Bacteria | 19722 |
| 93 | Ga0157373_10054471 | 3300013100 | Bacteria | 2842 |
| 94 | Ga0157371_10003015 | 3300013102 | Bacteria | 15633 |
| 95 | Ga0157371_10009880 | 3300013102 | Bacteria | 7472 |
| 96 | Ga0157371_10027525 | 3300013102 | Bacteria | 4123 |
| 97 | Ga0157371_10502573 | 3300013102 | Bacteria | 895 |
| 98 | Ga0157370_10021688 | 3300013104 | Bacteria | 6399 |
| 99 | Ga0157370_10335649 | 3300013104 | Bacteria | 1393 |
| 100 | Ga0157369_10003273 | 3300013105 | Bacteria | 19291 |
| 101 | Ga0157369_10390345 | 3300013105 | Bacteria | 1444 |
| 102 | Ga0157369_10434498 | 3300013105 | Bacteria | 1360 |
| 103 | Ga0157374_10001618 | 3300013296 | Bacteria | 18887 |
| 104 | Ga0157374_10036041 | 3300013296 | Bacteria | 4530 |
| 105 | Ga0157374_10131550 | 3300013296 | Bacteria | 2422 |
| 106 | Ga0157378_10049108 | 3300013297 | Bacteria | 3753 |
| 107 | Ga0157378_10257456 | 3300013297 | Bacteria | 1673 |
| 108 | Ga0157378_10258675 | 3300013297 | Bacteria | 1669 |
| 109 | Ga0163162_10000064 | 3300013306 | Bacteria | 103542 |
| 110 | Ga0163162_10015522 | 3300013306 | Bacteria | 7444 |
| 111 | Ga0163162_10135765 | 3300013306 | Bacteria | 2571 |
| 112 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 113 | Ga0157372_10000883 | 3300013307 | Bacteria | 32570 |
| 114 | Ga0157372_10002309 | 3300013307 | Bacteria | 20685 |
| 115 | Ga0157372_10003368 | 3300013307 | Bacteria | 17241 |
| 116 | Ga0157372_10013159 | 3300013307 | Bacteria | 8828 |
| 117 | Ga0157377_10008517 | 3300014745 | Bacteria | 5005 |
| 118 | Ga0157377_10307265 | 3300014745 | Bacteria | 1049 |
| 119 | Ga0157376_10212487 | 3300014969 | Bacteria | 1787 |
| 120 | Ga0207427_100171 | 3300025231 | Bacteria | 71988 |
| 121 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 122 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 123 | Ga0209026_1000351 | 3300025250 | Bacteria | 43657 |
| 124 | Ga0209026_1004283 | 3300025250 | Bacteria | 4308 |
| 125 | Ga0209026_1004483 | 3300025250 | Bacteria | 4122 |
| 126 | Ga0209129_1008760 | 3300025258 | Bacteria | 2765 |
| 127 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 128 | Ga0209233_1001459 | 3300025261 | Bacteria | 9332 |
| 129 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 130 | Ga0207647_10000030 | 3300025904 | Bacteria | 106974 |
| 131 | Ga0207647_10000093 | 3300025904 | Bacteria | 68094 |
| 132 | Ga0207647_10048827 | 3300025904 | Bacteria | 2627 |
| 133 | Ga0207645_10000652 | 3300025907 | Bacteria | 28838 |
| 134 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 135 | Ga0207705_10101766 | 3300025909 | Bacteria | 2114 |
| 136 | Ga0207705_10109604 | 3300025909 | Bacteria | 2039 |
| 137 | Ga0207705_10430582 | 3300025909 | Bacteria | 1022 |
| 138 | Ga0207654_10003795 | 3300025911 | Bacteria | 7619 |
| 139 | Ga0207654_10068073 | 3300025911 | Bacteria | 2106 |
| 140 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 141 | Ga0207695_10003137 | 3300025913 | Bacteria | 23613 |
| 142 | Ga0207695_10029276 | 3300025913 | Bacteria | 6090 |
| 143 | Ga0207695_10142065 | 3300025913 | Bacteria | 2348 |
| 144 | Ga0207695_10167983 | 3300025913 | Bacteria | 2121 |
| 145 | Ga0207695_10176141 | 3300025913 | Bacteria | 2061 |
| 146 | Ga0207671_10000542 | 3300025914 | Bacteria | 50975 |
| 147 | Ga0207671_10001726 | 3300025914 | Bacteria | 24605 |
| 148 | Ga0207671_10002982 | 3300025914 | Bacteria | 17364 |
| 149 | Ga0207671_10015797 | 3300025914 | Bacteria | 5892 |
| 150 | Ga0207671_10016854 | 3300025914 | Bacteria | 5659 |
| 151 | Ga0207671_10043295 | 3300025914 | Bacteria | 3329 |
| 152 | Ga0207671_10161909 | 3300025914 | Bacteria | 1733 |
| 153 | Ga0207660_10003635 | 3300025917 | Bacteria | 10051 |
| 154 | Ga0207657_10037451 | 3300025919 | Bacteria | 4330 |
| 155 | Ga0207652_10010172 | 3300025921 | Bacteria | 7572 |
| 156 | Ga0207652_10204951 | 3300025921 | Bacteria | 1775 |
| 157 | Ga0207644_10365575 | 3300025931 | Bacteria | 1174 |
| 158 | Ga0207690_10003762 | 3300025932 | Bacteria | 8994 |
| 159 | Ga0207706_10000243 | 3300025933 | Bacteria | 59842 |
| 160 | Ga0207669_10311201 | 3300025937 | Bacteria | 1201 |
| 161 | Ga0207704_10000046 | 3300025938 | Bacteria | 86187 |
| 162 | Ga0207689_10168493 | 3300025942 | Bacteria | 1805 |
| 163 | Ga0207661_10013224 | 3300025944 | Bacteria | 6027 |
| 164 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 165 | Ga0207667_10009468 | 3300025949 | Bacteria | 11471 |
| 166 | Ga0207667_10013674 | 3300025949 | Bacteria | 9276 |
| 167 | Ga0207667_10048950 | 3300025949 | Bacteria | 4467 |
| 168 | Ga0207651_10169022 | 3300025960 | Bacteria | 1722 |
| 169 | Ga0207677_10014630 | 3300026023 | Bacteria | 4589 |
| 170 | Ga0207639_10040324 | 3300026041 | Bacteria | 3484 |
| 171 | Ga0207678_10059222 | 3300026067 | Bacteria | 3295 |
| 172 | Ga0207702_10001849 | 3300026078 | Bacteria | 20848 |
| 173 | Ga0207702_10050709 | 3300026078 | Bacteria | 3504 |
| 174 | Ga0207641_10558088 | 3300026088 | Bacteria | 1117 |
| 175 | Ga0207648_10000257 | 3300026089 | Bacteria | 57438 |
| 176 | Ga0207683_10027024 | 3300026121 | Bacteria | 4959 |
| 177 | Ga0207698_10016186 | 3300026142 | Bacteria | 5019 |
| 178 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 179 | Ga0307517_10010505 | 3300028786 | Bacteria | 12953 |
| 180 | Ga0307515_10000778 | 3300028794 | Bacteria | 73451 |
| 181 | Ga0307515_10003029 | 3300028794 | Bacteria | 35637 |
| 182 | Ga0307515_10202796 | 3300028794 | Bacteria | 1853 |
| 183 | Ga0265338_10443849 | 3300028800 | Bacteria | 919 |
| 184 | Ga0316176_1114662 | 3300030732 | Bacteria | 1729 |
| 185 | Ga0316183_1174733 | 3300030742 | Bacteria | 32145 |
| 186 | Ga0316181_1092606 | 3300030744 | Bacteria | 18862 |
| 187 | Ga0307509_10091587 | 3300031507 | Bacteria | 3111 |
| 188 | Ga0307509_10176174 | 3300031507 | Unclassified | 2011 |
| 189 | Ga0307408_100025496 | 3300031548 | Bacteria | 4051 |
| 190 | Ga0307405_10015602 | 3300031731 | Bacteria | 4120 |
| 191 | Ga0307412_10010470 | 3300031911 | Bacteria | 5342 |
| 192 | Ga0307414_10000124 | 3300032004 | Bacteria | 53995 |
| 193 | Ga0307414_10007631 | 3300032004 | Bacteria | 6087 |
| 194 | Ga0307414_10080850 | 3300032004 | Bacteria | 2378 |
| 195 | Ga0307411_10018820 | 3300032005 | Bacteria | 3973 |
| 196 | Ga0307507_10002030 | 3300033179 | Bacteria | 43887 |
| 197 | Ga0307510_10001211 | 3300033180 | Bacteria | 27977 |
| 198 | Ga0373941_0035706 | 3300035115 | Bacteria | 1507 |
| 199 | Ga0316582_0312882 | 3300036647 | Bacteria | 1079 |
| 200 | Ga0316584_0213861 | 3300036712 | Bacteria | 1418 |
| 201 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 202 | Ga0395899_0000950 | 3300037312 | Bacteria | 27103 |
| 203 | Ga0395899_0108054 | 3300037312 | Bacteria | 2002 |
| 204 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 205 | Ga0395900_0002099 | 3300037418 | Bacteria | 22311 |
| 206 | Ga0395900_0069197 | 3300037418 | Bacteria | 3628 |
| 207 | Ga0395898_0005668 | 3300037466 | Bacteria | 13461 |
| 208 | Ga0395898_0085793 | 3300037466 | Bacteria | 3035 |
| 209 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 210 | Ga0395905_0000807 | 3300037471 | Bacteria | 41139 |
| 211 | Ga0395901_0000117 | 3300038443 | Bacteria | 105071 |
| 212 | Ga0395901_0004286 | 3300038443 | Bacteria | 14391 |
| 213 | Ga0451793_0921627 | 3300041452 | Bacteria | 1559 |
| 214 | Ga0439448_0009718 | 3300042005 | Bacteria | 2840 |
| 215 | Ga0451577_0002870 | 3300042876 | Bacteria | 19801 |
| 216 | Ga0451577_0218597 | 3300042876 | Bacteria | 1722 |
| 217 | Ga0451577_0273531 | 3300042876 | Unclassified | 1530 |
| 218 | Ga0451577_0461634 | 3300042876 | Bacteria | 1153 |
| 219 | Ga0453683_0004868 | 3300044673 | Bacteria | 9436 |
| 220 | Ga0466966_0005500 | 3300044684 | Bacteria | 8322 |
| 221 | Ga0453684_0004099 | 3300044712 | Bacteria | 31607 |
| 222 | Ga0453684_0005201 | 3300044712 | Bacteria | 26138 |
| 223 | Ga0453684_0008474 | 3300044712 | Bacteria | 18390 |
| 224 | Ga0453684_0018000 | 3300044712 | Bacteria | 10880 |
| 225 | Ga0453684_0064739 | 3300044712 | Unclassified | 4668 |
| 226 | Ga0466959_0082070 | 3300045049 | Bacteria | 2323 |
| 227 | Ga0451576_0018359 | 3300045051 | Bacteria | 7670 |
| 228 | Ga0451576_0040624 | 3300045051 | Bacteria | 4922 |
| 229 | Ga0451576_0149562 | 3300045051 | Bacteria | 2435 |
| 230 | Ga0451576_0159956 | 3300045051 | Bacteria | 2350 |
| 231 | Ga0451576_0236831 | 3300045051 | Bacteria | 1906 |
| 232 | Ga0495638_0143714 | 3300046460 | Bacteria | 1390 |
| 233 | Ga0495651_0076130 | 3300046462 | Bacteria | 2543 |
| 234 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 235 | Ga0495650_0042419 | 3300046471 | Bacteria | 1937 |
| 236 | Ga0495585_0001092 | 3300046492 | Bacteria | 22350 |
| 237 | Ga0495585_0002645 | 3300046492 | Bacteria | 12593 |
| 238 | Ga0495583_0021730 | 3300046506 | Bacteria | 3294 |
| 239 | Ga0495606_0000096 | 3300046507 | Bacteria | 151500 |
| 240 | Ga0495606_0021048 | 3300046507 | Bacteria | 4786 |
| 241 | Ga0495606_0024461 | 3300046507 | Bacteria | 4351 |
| 242 | Ga0495610_0000427 | 3300046512 | Bacteria | 43336 |
| 243 | Ga0495616_0005764 | 3300046513 | Bacteria | 7575 |
| 244 | Ga0495616_0006078 | 3300046513 | Bacteria | 7357 |
| 245 | Ga0495631_0015907 | 3300046518 | Bacteria | 3595 |
| 246 | Ga0495637_0049301 | 3300046520 | Bacteria | 1770 |
| 247 | Ga0495644_0006888 | 3300046523 | Bacteria | 4401 |
| 248 | Ga0495648_0003373 | 3300046524 | Bacteria | 14063 |
| 249 | Ga0495642_0191894 | 3300046528 | Bacteria | 890 |
| 250 | Ga0495609_0020532 | 3300046538 | Bacteria | 3052 |
| 251 | Ga0495622_0027492 | 3300046557 | Bacteria | 2655 |
| 252 | Ga0495633_0000081 | 3300046558 | Bacteria | 125903 |
| 253 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 254 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 255 | Ga0495625_0000846 | 3300046660 | Bacteria | 41815 |
| 256 | Ga0495625_0007119 | 3300046660 | Bacteria | 9827 |
| 257 | Ga0495625_0049673 | 3300046660 | Bacteria | 3014 |
| 258 | Ga0495625_0095378 | 3300046660 | Bacteria | 2051 |
| 259 | Ga0495625_0400479 | 3300046660 | Bacteria | 857 |
| 260 | Ga0495661_0001756 | 3300046665 | Bacteria | 17434 |
| 261 | Ga0495658_0079295 | 3300046683 | Bacteria | 1924 |
| 262 | Ga0495669_0093904 | 3300046684 | Bacteria | 1388 |
| 263 | Ga0495671_0058511 | 3300046692 | Bacteria | 1907 |
| 264 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 265 | Ga0495660_0033067 | 3300046810 | Bacteria | 2902 |
| 266 | Ga0495687_001036 | 3300047443 | Bacteria | 27592 |
| 267 | Ga0495687_001602 | 3300047443 | Bacteria | 20428 |
| 268 | Ga0495686_0000367 | 3300047472 | Bacteria | 73112 |
| 269 | Ga0495686_0003019 | 3300047472 | Bacteria | 14949 |
| 270 | Ga0495686_0050238 | 3300047472 | Bacteria | 2621 |
| 271 | Ga0495678_014896 | 3300049459 | Bacteria | 3601 |
| 272 | Ga0501223_018383 | 3300049663 | Unclassified | 1376 |
| 273 | Ga0501240_005395 | 3300049673 | Bacteria | 1529 |
| 274 | Ga0501035_0566534 | 3300049822 | Bacteria | 929 |
| 275 | nmdc:mga0k408_2545_c1 | 3300050493 | Bacteria | 9691 |
| 276 | Ga0500635_0001938 | 3300053080 | Bacteria | 5050 |
| 277 | Ga0500608_000329 | 3300053122 | Bacteria | 18275 |
| 278 | Ga0500608_020757 | 3300053122 | Bacteria | 3025 |
| 279 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 280 | Ga0500616_0013337 | 3300053153 | Unclassified | 4776 |
| 281 | Ga0500622_0000864 | 3300053156 | Bacteria | 25792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_112230_113006 | 225 |
| 2 | 3300046506 | Ga0495583_0021730 | Ga0495583_0021730_1607_2383 | 225 |
| 3 | 3300046665 | Ga0495661_0001756 | Ga0495661_0001756_16052_16828 | 225 |
| 4 | 3300046694 | Ga0495649_0000002 | Ga0495649_0000002_883144_883920 | 225 |
| 5 | 3300047472 | Ga0495686_0050238 | Ga0495686_0050238_1599_2375 | 225 |
| 6 | 3300009545 | Ga0105237_10000818 | Ga0105237_100008183 | 226 |
| 7 | 3300010375 | Ga0105239_10000074 | Ga0105239_1000007425 | 226 |
| 8 | 3300025914 | Ga0207671_10000542 | Ga0207671_100005423 | 226 |
| 9 | iso_pu_bacteria | 2884634485 | 2884636410 | 227 |
| 10 | iso_pu_bacteria | 2919692658 | 2919696434 | 227 |
| 11 | 3300042876 | Ga0451577_0002870 | Ga0451577_0002870_17057_17827 | 230 |
| 12 | 3300044712 | Ga0453684_0005201 | Ga0453684_0005201_13684_14454 | 230 |
| 13 | 3300045051 | Ga0451576_0018359 | Ga0451576_0018359_1004_1774 | 230 |
| 14 | 3300032004 | Ga0307414_10000124 | Ga0307414_1000012422 | 231 |
| 15 | 3300032004 | Ga0307414_10007631 | Ga0307414_100076313 | 231 |
| 16 | 3300036647 | Ga0316582_0312882 | Ga0316582_0312882_161_955 | 231 |
| 17 | 3300036712 | Ga0316584_0213861 | Ga0316584_0213861_197_991 | 231 |
| 18 | 3300042876 | Ga0451577_0273531 | Ga0451577_0273531_173_949 | 232 |
| 19 | 3300042876 | Ga0451577_0461634 | Ga0451577_0461634_215_997 | 232 |
| 20 | 3300044712 | Ga0453684_0018000 | Ga0453684_0018000_1310_2092 | 232 |
| 21 | 3300044712 | Ga0453684_0064739 | Ga0453684_0064739_3838_4614 | 232 |
| 22 | 3300045051 | Ga0451576_0159956 | Ga0451576_0159956_1070_1852 | 232 |
| 23 | 3300044673 | Ga0453683_0004868 | Ga0453683_0004868_7134_7904 | 233 |
| 24 | 3300003316 | rootH1_10083870 | rootH1_100838703 | 234 |
| 25 | 3300003322 | rootL2_10205062 | rootL2_102050623 | 234 |
| 26 | 3300003322 | rootL2_10280638 | rootL2_102806383 | 234 |
| 27 | 3300003794 | Ga0055531_10004256 | Ga0055531_100042567 | 234 |
| 28 | 3300005618 | Ga0068864_100435737 | Ga0068864_1004357372 | 234 |
| 29 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006450 | 234 |
| 30 | 3300031507 | Ga0307509_10091587 | Ga0307509_100915872 | 234 |
| 31 | 3300053153 | Ga0500616_0013337 | Ga0500616_0013337_1832_2608 | 234 |
| 32 | iso_pu_bacteria | 2842903701 | 2842906803 | 234 |
| 33 | iso_pu_bacteria | 2852623160 | 2852623440 | 234 |
| 34 | iso_pu_bacteria | 2884933994 | 2884937682 | 234 |
| 35 | iso_pu_bacteria | 2919437846 | 2919441651 | 234 |
| 36 | iso_pu_bacteria | 2928078545 | 2928080432 | 234 |
| 37 | iso_pu_bacteria | 2928147474 | 2928149396 | 234 |
| 38 | iso_pu_bacteria | 2977232053 | 2977236432 | 234 |
| 39 | 3300003320 | rootH2_10057092 | rootH2_100570925 | 235 |
| 40 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1470396_1471160 | 235 |
| 41 | 3300042876 | Ga0451577_0218597 | Ga0451577_0218597_547_1341 | 235 |
| 42 | 3300045051 | Ga0451576_0040624 | Ga0451576_0040624_1129_1923 | 235 |
| 43 | 3300005293 | Ga0065715_10089444 | Ga0065715_100894448 | 236 |
| 44 | 3300005327 | Ga0070658_10366936 | Ga0070658_103669362 | 236 |
| 45 | 3300005339 | Ga0070660_100024845 | Ga0070660_1000248452 | 236 |
| 46 | 3300005366 | Ga0070659_100000854 | Ga0070659_10000085419 | 236 |
| 47 | 3300005841 | Ga0068863_100615990 | Ga0068863_1006159901 | 236 |
| 48 | 3300013297 | Ga0157378_10258675 | Ga0157378_102586752 | 236 |
| 49 | 3300025919 | Ga0207657_10037451 | Ga0207657_100374512 | 236 |
| 50 | 3300025932 | Ga0207690_10003762 | Ga0207690_100037627 | 236 |
| 51 | 3300026088 | Ga0207641_10558088 | Ga0207641_105580882 | 236 |
| 52 | 3300031507 | Ga0307509_10176174 | Ga0307509_101761741 | 236 |
| 53 | 3300037418 | Ga0395900_0069197 | Ga0395900_0069197_2596_3372 | 237 |
| 54 | 3300041452 | Ga0451793_0921627 | Ga0451793_0921627_778_1548 | 237 |
| 55 | 3300044712 | Ga0453684_0004099 | Ga0453684_0004099_26075_26854 | 237 |
| 56 | 3300044712 | Ga0453684_0008474 | Ga0453684_0008474_3193_3981 | 237 |
| 57 | 3300045051 | Ga0451576_0149562 | Ga0451576_0149562_391_1170 | 237 |
| 58 | 3300001979 | JGI24740J21852_10078723 | JGI24740J21852_100787231 | 238 |
| 59 | 3300002737 | JGI25162J39368_1000961 | JGI25162J39368_10009618 | 238 |
| 60 | 3300002772 | JGI25164J39214_1001399 | JGI25164J39214_10013993 | 238 |
| 61 | 3300003214 | JGI25165J46597_1001179 | JGI25165J46597_10011795 | 238 |
| 62 | 3300003214 | JGI25165J46597_1001485 | JGI25165J46597_10014859 | 238 |
| 63 | 3300003320 | rootH2_10096525 | rootH2_100965251 | 238 |
| 64 | 3300003322 | rootL2_10270125 | rootL2_102701252 | 238 |
| 65 | 3300003323 | rootH1_10006785 | rootH1_1000678519 | 238 |
| 66 | 3300003323 | rootH1_10028473 | rootH1_100284732 | 238 |
| 67 | 3300005327 | Ga0070658_10000019 | Ga0070658_1000001983 | 238 |
| 68 | 3300005327 | Ga0070658_10070798 | Ga0070658_100707984 | 238 |
| 69 | 3300005329 | Ga0070683_100006104 | Ga0070683_1000061046 | 238 |
| 70 | 3300005329 | Ga0070683_100542528 | Ga0070683_1005425281 | 238 |
| 71 | 3300005535 | Ga0070684_100051250 | Ga0070684_1000512503 | 238 |
| 72 | 3300006195 | Ga0075366_10108077 | Ga0075366_101080772 | 238 |
| 73 | 3300010375 | Ga0105239_10075730 | Ga0105239_100757305 | 238 |
| 74 | 3300013100 | Ga0157373_10000161 | Ga0157373_100001612 | 238 |
| 75 | 3300013307 | Ga0157372_10002309 | Ga0157372_100023093 | 238 |
| 76 | 3300025231 | Ga0207427_100171 | Ga0207427_10017125 | 238 |
| 77 | 3300025233 | Ga0209437_100052 | Ga0209437_10005280 | 238 |
| 78 | 3300025250 | Ga0209026_1000351 | Ga0209026_100035110 | 238 |
| 79 | 3300025261 | Ga0209233_1000067 | Ga0209233_100006780 | 238 |
| 80 | 3300025909 | Ga0207705_10000069 | Ga0207705_1000006985 | 238 |
| 81 | 3300025909 | Ga0207705_10109604 | Ga0207705_101096043 | 238 |
| 82 | 3300025944 | Ga0207661_10013224 | Ga0207661_100132245 | 238 |
| 83 | 3300030732 | Ga0316176_1114662 | Ga0316176_11146622 | 238 |
| 84 | 3300030742 | Ga0316183_1174733 | Ga0316183_117473324 | 238 |
| 85 | 3300030744 | Ga0316181_1092606 | Ga0316181_109260610 | 238 |
| 86 | 3300031548 | Ga0307408_100025496 | Ga0307408_1000254963 | 238 |
| 87 | 3300031731 | Ga0307405_10015602 | Ga0307405_100156022 | 238 |
| 88 | 3300031911 | Ga0307412_10010470 | Ga0307412_100104702 | 238 |
| 89 | 3300032004 | Ga0307414_10080850 | Ga0307414_100808501 | 238 |
| 90 | 3300032005 | Ga0307411_10018820 | Ga0307411_100188203 | 238 |
| 91 | 3300035115 | Ga0373941_0035706 | Ga0373941_0035706_563_1339 | 238 |
| 92 | 3300037312 | Ga0395899_0108054 | Ga0395899_0108054_1151_1927 | 238 |
| 93 | 3300037418 | Ga0395900_0002099 | Ga0395900_0002099_4060_4836 | 238 |
| 94 | 3300037466 | Ga0395898_0085793 | Ga0395898_0085793_1138_1914 | 238 |
| 95 | 3300037471 | Ga0395905_0000807 | Ga0395905_0000807_13432_14208 | 238 |
| 96 | 3300038443 | Ga0395901_0004286 | Ga0395901_0004286_6278_7054 | 238 |
| 97 | 3300045051 | Ga0451576_0236831 | Ga0451576_0236831_242_1042 | 238 |
| 98 | 3300046460 | Ga0495638_0143714 | Ga0495638_0143714_258_1034 | 238 |
| 99 | 3300046513 | Ga0495616_0005764 | Ga0495616_0005764_517_1293 | 238 |
| 100 | 3300046557 | Ga0495622_0027492 | Ga0495622_0027492_1594_2370 | 238 |
| 101 | 3300046660 | Ga0495625_0007119 | Ga0495625_0007119_5580_6359 | 238 |
| 102 | 3300046660 | Ga0495625_0049673 | Ga0495625_0049673_2202_2978 | 238 |
| 103 | 3300046683 | Ga0495658_0079295 | Ga0495658_0079295_738_1514 | 238 |
| 104 | 3300046810 | Ga0495660_0033067 | Ga0495660_0033067_1807_2583 | 238 |
| 105 | 3300049459 | Ga0495678_014896 | Ga0495678_014896_1136_1912 | 238 |
| 106 | 3300049663 | Ga0501223_018383 | Ga0501223_018383_129_905 | 238 |
| 107 | 3300049673 | Ga0501240_005395 | Ga0501240_005395_223_999 | 238 |
| 108 | 3300049822 | Ga0501035_0566534 | Ga0501035_0566534_115_888 | 238 |
| 109 | 3300050493 | nmdc:mga0k408_2545_c1 | nmdc:mga0k408_2545_c1_6851_7630 | 238 |
| 110 | 3300053122 | Ga0500608_000329 | Ga0500608_000329_3758_4534 | 238 |
| 111 | 3300053156 | Ga0500622_0000864 | Ga0500622_0000864_10339_11118 | 238 |
| 112 | 3300003322 | rootL2_10127356 | rootL2_101273565 | 239 |
| 113 | 3300003323 | rootH1_10165154 | rootH1_101651541 | 239 |
| 114 | 3300013306 | Ga0163162_10015522 | Ga0163162_100155225 | 239 |
| 115 | 3300046492 | Ga0495585_0001092 | Ga0495585_0001092_963_1781 | 239 |
| 116 | 3300046507 | Ga0495606_0000096 | Ga0495606_0000096_118320_119138 | 239 |
| 117 | 3300046512 | Ga0495610_0000427 | Ga0495610_0000427_35132_35950 | 239 |
| 118 | 3300046513 | Ga0495616_0006078 | Ga0495616_0006078_4183_5001 | 239 |
| 119 | 3300046520 | Ga0495637_0049301 | Ga0495637_0049301_14_832 | 239 |
| 120 | 3300046660 | Ga0495625_0000003 | Ga0495625_0000003_123073_123891 | 239 |
| 121 | 3300046692 | Ga0495671_0058511 | Ga0495671_0058511_410_1228 | 239 |
| 122 | 3300047443 | Ga0495687_001602 | Ga0495687_001602_7470_8288 | 239 |
| 123 | 3300005841 | Ga0068863_100581647 | Ga0068863_1005816472 | 240 |
| 124 | iso_pu_bacteria | 2599185184 | 2599478516 | 248 |
| 125 | iso_pu_bacteria | 2932082852 | 2932083227 | 248 |
| 126 | 3300003323 | rootH1_10036067 | rootH1_100360675 | 249 |
| 127 | 3300009093 | Ga0105240_10000722 | Ga0105240_1000072234 | 249 |
| 128 | 3300009545 | Ga0105237_10003874 | Ga0105237_100038745 | 249 |
| 129 | 3300009545 | Ga0105237_10371117 | Ga0105237_103711171 | 249 |
| 130 | 3300010375 | Ga0105239_10013160 | Ga0105239_100131607 | 249 |
| 131 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013130 | 249 |
| 132 | 3300025914 | Ga0207671_10002982 | Ga0207671_1000298216 | 249 |
| 133 | 3300025914 | Ga0207671_10161909 | Ga0207671_101619092 | 249 |
| 134 | 3300046471 | Ga0495650_0042419 | Ga0495650_0042419_345_1259 | 249 |
| 135 | 3300002741 | JGI25157J39369_1008227 | JGI25157J39369_10082271 | 250 |
| 136 | 3300005327 | Ga0070658_10190768 | Ga0070658_101907683 | 250 |
| 137 | 3300025250 | Ga0209026_1004283 | Ga0209026_10042835 | 250 |
| 138 | 3300046507 | Ga0495606_0021048 | Ga0495606_0021048_1539_2354 | 250 |
| 139 | 3300005614 | Ga0068856_100000092 | Ga0068856_10000009220 | 251 |
| 140 | 3300009093 | Ga0105240_10373614 | Ga0105240_103736141 | 251 |
| 141 | 3300009551 | Ga0105238_10183082 | Ga0105238_101830824 | 251 |
| 142 | 3300013306 | Ga0163162_10135765 | Ga0163162_101357652 | 251 |
| 143 | 3300026078 | Ga0207702_10001849 | Ga0207702_100018495 | 251 |
| 144 | 3300028794 | Ga0307515_10202796 | Ga0307515_102027961 | 251 |
| 145 | 3300028800 | Ga0265338_10443849 | Ga0265338_104438491 | 251 |
| 146 | 3300001904 | JGI24736J21556_1003555 | JGI24736J21556_10035554 | 252 |
| 147 | 3300001904 | JGI24736J21556_1007427 | JGI24736J21556_10074272 | 252 |
| 148 | 3300001990 | JGI24737J22298_10000227 | JGI24737J22298_100002275 | 252 |
| 149 | 3300001990 | JGI24737J22298_10014282 | JGI24737J22298_100142823 | 252 |
| 150 | 3300001990 | JGI24737J22298_10016419 | JGI24737J22298_100164192 | 252 |
| 151 | 3300002067 | JGI24735J21928_10000002 | JGI24735J21928_10000002437 | 252 |
| 152 | 3300002067 | JGI24735J21928_10011866 | JGI24735J21928_100118664 | 252 |
| 153 | 3300002737 | JGI25162J39368_1000022 | JGI25162J39368_1000022203 | 252 |
| 154 | 3300003214 | JGI25165J46597_1006465 | JGI25165J46597_10064652 | 252 |
| 155 | 3300003320 | rootH2_10004415 | rootH2_1000441525 | 252 |
| 156 | 3300005288 | Ga0065714_10078008 | Ga0065714_100780084 | 252 |
| 157 | 3300005327 | Ga0070658_10306903 | Ga0070658_103069032 | 252 |
| 158 | 3300005328 | Ga0070676_10000165 | Ga0070676_100001656 | 252 |
| 159 | 3300005334 | Ga0068869_100207390 | Ga0068869_1002073902 | 252 |
| 160 | 3300005336 | Ga0070680_100001197 | Ga0070680_10000119710 | 252 |
| 161 | 3300005355 | Ga0070671_100007630 | Ga0070671_1000076309 | 252 |
| 162 | 3300005364 | Ga0070673_100026243 | Ga0070673_1000262435 | 252 |
| 163 | 3300005366 | Ga0070659_100013570 | Ga0070659_1000135703 | 252 |
| 164 | 3300005455 | Ga0070663_100096113 | Ga0070663_1000961131 | 252 |
| 165 | 3300005456 | Ga0070678_100015400 | Ga0070678_1000154005 | 252 |
| 166 | 3300005457 | Ga0070662_100000185 | Ga0070662_10000018526 | 252 |
| 167 | 3300005459 | Ga0068867_100000116 | Ga0068867_1000001163 | 252 |
| 168 | 3300005530 | Ga0070679_100001998 | Ga0070679_10000199811 | 252 |
| 169 | 3300005539 | Ga0068853_100084815 | Ga0068853_1000848151 | 252 |
| 170 | 3300005539 | Ga0068853_100524220 | Ga0068853_1005242201 | 252 |
| 171 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003345 | 252 |
| 172 | 3300005563 | Ga0068855_100000196 | Ga0068855_10000019640 | 252 |
| 173 | 3300005563 | Ga0068855_100000519 | Ga0068855_10000051930 | 252 |
| 174 | 3300005563 | Ga0068855_100004987 | Ga0068855_10000498717 | 252 |
| 175 | 3300005563 | Ga0068855_100084823 | Ga0068855_1000848234 | 252 |
| 176 | 3300005563 | Ga0068855_100992604 | Ga0068855_1009926041 | 252 |
| 177 | 3300005578 | Ga0068854_100120936 | Ga0068854_1001209363 | 252 |
| 178 | 3300005614 | Ga0068856_100002099 | Ga0068856_10000209912 | 252 |
| 179 | 3300005616 | Ga0068852_100961013 | Ga0068852_1009610131 | 252 |
| 180 | 3300005718 | Ga0068866_10028350 | Ga0068866_100283503 | 252 |
| 181 | 3300006195 | Ga0075366_10000849 | Ga0075366_100008498 | 252 |
| 182 | 3300006237 | Ga0097621_100000054 | Ga0097621_10000005426 | 252 |
| 183 | 3300006358 | Ga0068871_100000145 | Ga0068871_10000014522 | 252 |
| 184 | 3300006881 | Ga0068865_100000051 | Ga0068865_10000005130 | 252 |
| 185 | 3300009093 | Ga0105240_10483746 | Ga0105240_104837462 | 252 |
| 186 | 3300009174 | Ga0105241_10010287 | Ga0105241_100102875 | 252 |
| 187 | 3300009174 | Ga0105241_10023476 | Ga0105241_100234766 | 252 |
| 188 | 3300009545 | Ga0105237_10002246 | Ga0105237_100022466 | 252 |
| 189 | 3300009545 | Ga0105237_10026966 | Ga0105237_100269665 | 252 |
| 190 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002449 | 252 |
| 191 | 3300010375 | Ga0105239_10009550 | Ga0105239_1000955011 | 252 |
| 192 | 3300010375 | Ga0105239_10011559 | Ga0105239_1001155910 | 252 |
| 193 | 3300013100 | Ga0157373_10001209 | Ga0157373_1000120915 | 252 |
| 194 | 3300013100 | Ga0157373_10054471 | Ga0157373_100544712 | 252 |
| 195 | 3300013102 | Ga0157371_10003015 | Ga0157371_100030153 | 252 |
| 196 | 3300013102 | Ga0157371_10009880 | Ga0157371_100098802 | 252 |
| 197 | 3300013102 | Ga0157371_10027525 | Ga0157371_100275253 | 252 |
| 198 | 3300013102 | Ga0157371_10502573 | Ga0157371_105025731 | 252 |
| 199 | 3300013104 | Ga0157370_10021688 | Ga0157370_100216883 | 252 |
| 200 | 3300013104 | Ga0157370_10335649 | Ga0157370_103356493 | 252 |
| 201 | 3300013105 | Ga0157369_10003273 | Ga0157369_100032732 | 252 |
| 202 | 3300013105 | Ga0157369_10390345 | Ga0157369_103903451 | 252 |
| 203 | 3300013105 | Ga0157369_10434498 | Ga0157369_104344982 | 252 |
| 204 | 3300013296 | Ga0157374_10001618 | Ga0157374_1000161818 | 252 |
| 205 | 3300013296 | Ga0157374_10036041 | Ga0157374_100360416 | 252 |
| 206 | 3300013296 | Ga0157374_10131550 | Ga0157374_101315501 | 252 |
| 207 | 3300013297 | Ga0157378_10049108 | Ga0157378_100491084 | 252 |
| 208 | 3300013297 | Ga0157378_10257456 | Ga0157378_102574561 | 252 |
| 209 | 3300013306 | Ga0163162_10000064 | Ga0163162_100000648 | 252 |
| 210 | 3300013307 | Ga0157372_10000021 | Ga0157372_1000002167 | 252 |
| 211 | 3300013307 | Ga0157372_10000883 | Ga0157372_1000088324 | 252 |
| 212 | 3300013307 | Ga0157372_10003368 | Ga0157372_1000336810 | 252 |
| 213 | 3300013307 | Ga0157372_10013159 | Ga0157372_100131594 | 252 |
| 214 | 3300014745 | Ga0157377_10008517 | Ga0157377_100085177 | 252 |
| 215 | 3300014745 | Ga0157377_10307265 | Ga0157377_103072651 | 252 |
| 216 | 3300014969 | Ga0157376_10212487 | Ga0157376_102124872 | 252 |
| 217 | 3300025233 | Ga0209437_100024 | Ga0209437_100024517 | 252 |
| 218 | 3300025250 | Ga0209026_1004483 | Ga0209026_10044834 | 252 |
| 219 | 3300025258 | Ga0209129_1008760 | Ga0209129_10087604 | 252 |
| 220 | 3300025261 | Ga0209233_1001459 | Ga0209233_10014594 | 252 |
| 221 | 3300025904 | Ga0207647_10000030 | Ga0207647_1000003029 | 252 |
| 222 | 3300025904 | Ga0207647_10000093 | Ga0207647_1000009313 | 252 |
| 223 | 3300025904 | Ga0207647_10048827 | Ga0207647_100488275 | 252 |
| 224 | 3300025907 | Ga0207645_10000652 | Ga0207645_1000065214 | 252 |
| 225 | 3300025909 | Ga0207705_10101766 | Ga0207705_101017663 | 252 |
| 226 | 3300025909 | Ga0207705_10430582 | Ga0207705_104305822 | 252 |
| 227 | 3300025911 | Ga0207654_10003795 | Ga0207654_100037954 | 252 |
| 228 | 3300025911 | Ga0207654_10068073 | Ga0207654_100680733 | 252 |
| 229 | 3300025913 | Ga0207695_10003137 | Ga0207695_100031372 | 252 |
| 230 | 3300025913 | Ga0207695_10029276 | Ga0207695_100292767 | 252 |
| 231 | 3300025913 | Ga0207695_10142065 | Ga0207695_101420653 | 252 |
| 232 | 3300025913 | Ga0207695_10167983 | Ga0207695_101679833 | 252 |
| 233 | 3300025913 | Ga0207695_10176141 | Ga0207695_101761412 | 252 |
| 234 | 3300025914 | Ga0207671_10001726 | Ga0207671_1000172617 | 252 |
| 235 | 3300025914 | Ga0207671_10015797 | Ga0207671_100157975 | 252 |
| 236 | 3300025914 | Ga0207671_10016854 | Ga0207671_100168545 | 252 |
| 237 | 3300025914 | Ga0207671_10043295 | Ga0207671_100432953 | 252 |
| 238 | 3300025917 | Ga0207660_10003635 | Ga0207660_100036353 | 252 |
| 239 | 3300025921 | Ga0207652_10010172 | Ga0207652_100101725 | 252 |
| 240 | 3300025921 | Ga0207652_10204951 | Ga0207652_102049513 | 252 |
| 241 | 3300025931 | Ga0207644_10365575 | Ga0207644_103655752 | 252 |
| 242 | 3300025933 | Ga0207706_10000243 | Ga0207706_100002439 | 252 |
| 243 | 3300025937 | Ga0207669_10311201 | Ga0207669_103112012 | 252 |
| 244 | 3300025938 | Ga0207704_10000046 | Ga0207704_1000004629 | 252 |
| 245 | 3300025942 | Ga0207689_10168493 | Ga0207689_101684932 | 252 |
| 246 | 3300025949 | Ga0207667_10000037 | Ga0207667_1000003739 | 252 |
| 247 | 3300025949 | Ga0207667_10009468 | Ga0207667_100094687 | 252 |
| 248 | 3300025949 | Ga0207667_10013674 | Ga0207667_100136747 | 252 |
| 249 | 3300025949 | Ga0207667_10048950 | Ga0207667_100489503 | 252 |
| 250 | 3300025960 | Ga0207651_10169022 | Ga0207651_101690223 | 252 |
| 251 | 3300026023 | Ga0207677_10014630 | Ga0207677_100146304 | 252 |
| 252 | 3300026041 | Ga0207639_10040324 | Ga0207639_100403245 | 252 |
| 253 | 3300026067 | Ga0207678_10059222 | Ga0207678_100592224 | 252 |
| 254 | 3300026078 | Ga0207702_10050709 | Ga0207702_100507092 | 252 |
| 255 | 3300026089 | Ga0207648_10000257 | Ga0207648_1000025747 | 252 |
| 256 | 3300026121 | Ga0207683_10027024 | Ga0207683_100270243 | 252 |
| 257 | 3300026142 | Ga0207698_10016186 | Ga0207698_100161865 | 252 |
| 258 | 3300028379 | Ga0268266_10000078 | Ga0268266_10000078135 | 252 |
| 259 | 3300028786 | Ga0307517_10010505 | Ga0307517_100105055 | 252 |
| 260 | 3300028794 | Ga0307515_10000778 | Ga0307515_1000077832 | 252 |
| 261 | 3300028794 | Ga0307515_10003029 | Ga0307515_1000302918 | 252 |
| 262 | 3300033179 | Ga0307507_10002030 | Ga0307507_1000203014 | 252 |
| 263 | 3300033180 | Ga0307510_10001211 | Ga0307510_1000121116 | 252 |
| 264 | 3300037312 | Ga0395899_0000950 | Ga0395899_0000950_19981_20796 | 252 |
| 265 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_126374_127189 | 252 |
| 266 | 3300037466 | Ga0395898_0005668 | Ga0395898_0005668_10369_11184 | 252 |
| 267 | 3300037471 | Ga0395905_0000037 | Ga0395905_0000037_126364_127179 | 252 |
| 268 | 3300038443 | Ga0395901_0000117 | Ga0395901_0000117_40021_40836 | 252 |
| 269 | 3300042005 | Ga0439448_0009718 | Ga0439448_0009718_1886_2701 | 252 |
| 270 | 3300044684 | Ga0466966_0005500 | Ga0466966_0005500_7438_8256 | 252 |
| 271 | 3300045049 | Ga0466959_0082070 | Ga0466959_0082070_373_1191 | 252 |
| 272 | 3300046462 | Ga0495651_0076130 | Ga0495651_0076130_1010_1828 | 252 |
| 273 | 3300046492 | Ga0495585_0002645 | Ga0495585_0002645_6077_6895 | 252 |
| 274 | 3300046507 | Ga0495606_0024461 | Ga0495606_0024461_2383_3267 | 252 |
| 275 | 3300046518 | Ga0495631_0015907 | Ga0495631_0015907_1536_2354 | 252 |
| 276 | 3300046523 | Ga0495644_0006888 | Ga0495644_0006888_3042_3857 | 252 |
| 277 | 3300046524 | Ga0495648_0003373 | Ga0495648_0003373_11278_12096 | 252 |
| 278 | 3300046528 | Ga0495642_0191894 | Ga0495642_0191894_32_847 | 252 |
| 279 | 3300046538 | Ga0495609_0020532 | Ga0495609_0020532_1828_2646 | 252 |
| 280 | 3300046558 | Ga0495633_0000081 | Ga0495633_0000081_113803_114621 | 252 |
| 281 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_672363_673181 | 252 |
| 282 | 3300046660 | Ga0495625_0000846 | Ga0495625_0000846_26168_26986 | 252 |
| 283 | 3300046660 | Ga0495625_0095378 | Ga0495625_0095378_579_1397 | 252 |
| 284 | 3300046660 | Ga0495625_0400479 | Ga0495625_0400479_29_847 | 252 |
| 285 | 3300046684 | Ga0495669_0093904 | Ga0495669_0093904_551_1369 | 252 |
| 286 | 3300047443 | Ga0495687_001036 | Ga0495687_001036_1754_2572 | 252 |
| 287 | 3300047472 | Ga0495686_0000367 | Ga0495686_0000367_33169_33987 | 252 |
| 288 | 3300047472 | Ga0495686_0003019 | Ga0495686_0003019_3158_3973 | 252 |
| 289 | 3300053080 | Ga0500635_0001938 | Ga0500635_0001938_1954_2772 | 252 |
| 290 | 3300053122 | Ga0500608_020757 | Ga0500608_020757_158_976 | 252 |
| 291 | 3300053125 | Ga0500618_000004 | Ga0500618_000004_22635_23453 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar