F390524

General Info

Members Datasets Scaffolds Average Seq Length
291 168 281 259

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0024461|Ga0495606_0024461_2383_3267
Length 281
Sequence MIYTKRFIFDKKFGEQIIITNFMSIKLLINLANPNFMSTISQNIKFLRKKKGITQQQFADEVGIKRSLVGAYEEERAEPKYELLKALAIYFDITIDDFINETIDEKWAPKPKGNPANLRVLSISVDKEDNENIEMVPMKASAGYLNGYADPEYVSKLPKFYLPMFKQGTFRAFEIKGDSMLPIISGDIIIGEYLENWADLKSGETYIIISKNDGVVYKRVGNKFKENKKLKLISDNPVYEPYEINGEDVLEIWKAKGYISTQLPQPTQMQRSISNLQQSNN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
107 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 0
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 0.69
Rhizosphere 81.44
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003555 3300001904 Bacteria 2696
2 JGI24736J21556_1007427 3300001904 Bacteria 1842
3 JGI24740J21852_10078723 3300001979 Bacteria 868
4 JGI24737J22298_10000227 3300001990 Bacteria 18576
5 JGI24737J22298_10014282 3300001990 Bacteria 2579
6 JGI24737J22298_10016419 3300001990 Bacteria 2390
7 JGI24735J21928_10000002 3300002067 Bacteria 624895
8 JGI24735J21928_10011866 3300002067 Bacteria 2757
9 JGI25162J39368_1000022 3300002737 Bacteria 239510
10 JGI25162J39368_1000961 3300002737 Bacteria 18378
11 JGI25157J39369_1008227 3300002741 Bacteria 1460
12 JGI25164J39214_1001399 3300002772 Bacteria 5723
13 JGI25165J46597_1001179 3300003214 Bacteria 16018
14 JGI25165J46597_1001485 3300003214 Bacteria 12076
15 JGI25165J46597_1006465 3300003214 Bacteria 2076
16 rootH1_10083870 3300003316 Bacteria 1822
17 rootH2_10004415 3300003320 Bacteria 27098
18 rootH2_10057092 3300003320 Bacteria 3648
19 rootH2_10096525 3300003320 Bacteria 5981
20 rootL2_10127356 3300003322 Bacteria 3288
21 rootL2_10205062 3300003322 Bacteria 1940
22 rootL2_10270125 3300003322 Bacteria 3756
23 rootL2_10280638 3300003322 Unclassified 1486
24 rootH1_10006785 3300003323 Bacteria 51850
25 rootH1_10028473 3300003323 Bacteria 8789
26 rootH1_10036067 3300003323 Bacteria 14639
27 rootH1_10165154 3300003316 Bacteria 1265
28 rootH1_10165154 3300003323 Bacteria 3764
29 Ga0055531_10004256 3300003794 Bacteria 8796
30 Ga0065714_10078008 3300005288 Bacteria 2625
31 Ga0065715_10089444 3300005293 Bacteria 10138
32 Ga0070658_10000019 3300005327 Bacteria 194742
33 Ga0070658_10070798 3300005327 Bacteria 2856
34 Ga0070658_10190768 3300005327 Bacteria 1727
35 Ga0070658_10306903 3300005327 Bacteria 1354
36 Ga0070658_10366936 3300005327 Bacteria 1234
37 Ga0070676_10000165 3300005328 Bacteria 26705
38 Ga0070683_100006104 3300005329 Bacteria 10102
39 Ga0070683_100542528 3300005329 Bacteria 1112
40 Ga0068869_100207390 3300005334 Bacteria 1548
41 Ga0070680_100001197 3300005336 Bacteria 18706
42 Ga0070660_100024845 3300005339 Bacteria 4450
43 Ga0070671_100007630 3300005355 Bacteria 8653
44 Ga0070673_100026243 3300005364 Bacteria 4301
45 Ga0070659_100000854 3300005366 Bacteria 22245
46 Ga0070659_100013570 3300005366 Bacteria 6068
47 Ga0070663_100096113 3300005455 Bacteria 2203
48 Ga0070678_100015400 3300005456 Bacteria 4861
49 Ga0070662_100000185 3300005457 Bacteria 36147
50 Ga0068867_100000116 3300005459 Bacteria 50447
51 Ga0070679_100001998 3300005530 Bacteria 18314
52 Ga0070684_100051250 3300005535 Bacteria 3585
53 Ga0068853_100084815 3300005539 Bacteria 2776
54 Ga0068853_100524220 3300005539 Bacteria 1120
55 Ga0070665_100000003 3300005548 Bacteria 811857
56 Ga0068855_100000196 3300005563 Bacteria 78135
57 Ga0068855_100000519 3300005563 Bacteria 47297
58 Ga0068855_100004987 3300005563 Bacteria 16203
59 Ga0068855_100084823 3300005563 Bacteria 3666
60 Ga0068855_100992604 3300005563 Bacteria 882
61 Ga0068854_100120936 3300005578 Bacteria 1988
62 Ga0068856_100000092 3300005614 Bacteria 84781
63 Ga0068856_100002099 3300005614 Bacteria 20660
64 Ga0068852_100961013 3300005616 Bacteria 872
65 Ga0068864_100435737 3300005618 Bacteria 1251
66 Ga0068866_10028350 3300005718 Bacteria 2667
67 Ga0068863_100581647 3300005841 Bacteria 1107
68 Ga0068863_100615990 3300005841 Bacteria 1075
69 Ga0075366_10000849 3300006195 Bacteria 14722
70 Ga0075366_10108077 3300006195 Bacteria 1673
71 Ga0097621_100000054 3300006237 Bacteria 59756
72 Ga0068871_100000145 3300006358 Bacteria 46320
73 Ga0068865_100000051 3300006881 Bacteria 65346
74 Ga0105240_10000722 3300009093 Bacteria 60400
75 Ga0105240_10373614 3300009093 Bacteria 1611
76 Ga0105240_10483746 3300009093 Bacteria 1379
77 Ga0105241_10010287 3300009174 Bacteria 6871
78 Ga0105241_10023476 3300009174 Bacteria 4574
79 Ga0105237_10000818 3300009545 Bacteria 42552
80 Ga0105237_10002246 3300009545 Bacteria 24061
81 Ga0105237_10003874 3300009545 Bacteria 17567
82 Ga0105237_10026966 3300009545 Bacteria 5869
83 Ga0105237_10371117 3300009545 Bacteria 1436
84 Ga0105238_10183082 3300009551 Bacteria 2071
85 Ga0105239_10000002 3300010375 Bacteria 610298
86 Ga0105239_10000074 3300010375 Bacteria 140673
87 Ga0105239_10009550 3300010375 Bacteria 10916
88 Ga0105239_10011559 3300010375 Bacteria 9848
89 Ga0105239_10013160 3300010375 Bacteria 9192
90 Ga0105239_10075730 3300010375 Bacteria 3701
91 Ga0157373_10000161 3300013100 Bacteria 54194
92 Ga0157373_10001209 3300013100 Bacteria 19722
93 Ga0157373_10054471 3300013100 Bacteria 2842
94 Ga0157371_10003015 3300013102 Bacteria 15633
95 Ga0157371_10009880 3300013102 Bacteria 7472
96 Ga0157371_10027525 3300013102 Bacteria 4123
97 Ga0157371_10502573 3300013102 Bacteria 895
98 Ga0157370_10021688 3300013104 Bacteria 6399
99 Ga0157370_10335649 3300013104 Bacteria 1393
100 Ga0157369_10003273 3300013105 Bacteria 19291
101 Ga0157369_10390345 3300013105 Bacteria 1444
102 Ga0157369_10434498 3300013105 Bacteria 1360
103 Ga0157374_10001618 3300013296 Bacteria 18887
104 Ga0157374_10036041 3300013296 Bacteria 4530
105 Ga0157374_10131550 3300013296 Bacteria 2422
106 Ga0157378_10049108 3300013297 Bacteria 3753
107 Ga0157378_10257456 3300013297 Bacteria 1673
108 Ga0157378_10258675 3300013297 Bacteria 1669
109 Ga0163162_10000064 3300013306 Bacteria 103542
110 Ga0163162_10015522 3300013306 Bacteria 7444
111 Ga0163162_10135765 3300013306 Bacteria 2571
112 Ga0157372_10000021 3300013307 Bacteria 207801
113 Ga0157372_10000883 3300013307 Bacteria 32570
114 Ga0157372_10002309 3300013307 Bacteria 20685
115 Ga0157372_10003368 3300013307 Bacteria 17241
116 Ga0157372_10013159 3300013307 Bacteria 8828
117 Ga0157377_10008517 3300014745 Bacteria 5005
118 Ga0157377_10307265 3300014745 Bacteria 1049
119 Ga0157376_10212487 3300014969 Bacteria 1787
120 Ga0207427_100171 3300025231 Bacteria 71988
121 Ga0209437_100024 3300025233 Bacteria 592878
122 Ga0209437_100052 3300025233 Bacteria 380548
123 Ga0209026_1000351 3300025250 Bacteria 43657
124 Ga0209026_1004283 3300025250 Bacteria 4308
125 Ga0209026_1004483 3300025250 Bacteria 4122
126 Ga0209129_1008760 3300025258 Bacteria 2765
127 Ga0209233_1000067 3300025261 Bacteria 380554
128 Ga0209233_1001459 3300025261 Bacteria 9332
129 Ga0209257_1000006 3300025304 Bacteria 1570111
130 Ga0207647_10000030 3300025904 Bacteria 106974
131 Ga0207647_10000093 3300025904 Bacteria 68094
132 Ga0207647_10048827 3300025904 Bacteria 2627
133 Ga0207645_10000652 3300025907 Bacteria 28838
134 Ga0207705_10000069 3300025909 Bacteria 133094
135 Ga0207705_10101766 3300025909 Bacteria 2114
136 Ga0207705_10109604 3300025909 Bacteria 2039
137 Ga0207705_10430582 3300025909 Bacteria 1022
138 Ga0207654_10003795 3300025911 Bacteria 7619
139 Ga0207654_10068073 3300025911 Bacteria 2106
140 Ga0207695_10000013 3300025913 Bacteria 821265
141 Ga0207695_10003137 3300025913 Bacteria 23613
142 Ga0207695_10029276 3300025913 Bacteria 6090
143 Ga0207695_10142065 3300025913 Bacteria 2348
144 Ga0207695_10167983 3300025913 Bacteria 2121
145 Ga0207695_10176141 3300025913 Bacteria 2061
146 Ga0207671_10000542 3300025914 Bacteria 50975
147 Ga0207671_10001726 3300025914 Bacteria 24605
148 Ga0207671_10002982 3300025914 Bacteria 17364
149 Ga0207671_10015797 3300025914 Bacteria 5892
150 Ga0207671_10016854 3300025914 Bacteria 5659
151 Ga0207671_10043295 3300025914 Bacteria 3329
152 Ga0207671_10161909 3300025914 Bacteria 1733
153 Ga0207660_10003635 3300025917 Bacteria 10051
154 Ga0207657_10037451 3300025919 Bacteria 4330
155 Ga0207652_10010172 3300025921 Bacteria 7572
156 Ga0207652_10204951 3300025921 Bacteria 1775
157 Ga0207644_10365575 3300025931 Bacteria 1174
158 Ga0207690_10003762 3300025932 Bacteria 8994
159 Ga0207706_10000243 3300025933 Bacteria 59842
160 Ga0207669_10311201 3300025937 Bacteria 1201
161 Ga0207704_10000046 3300025938 Bacteria 86187
162 Ga0207689_10168493 3300025942 Bacteria 1805
163 Ga0207661_10013224 3300025944 Bacteria 6027
164 Ga0207667_10000037 3300025949 Bacteria 297252
165 Ga0207667_10009468 3300025949 Bacteria 11471
166 Ga0207667_10013674 3300025949 Bacteria 9276
167 Ga0207667_10048950 3300025949 Bacteria 4467
168 Ga0207651_10169022 3300025960 Bacteria 1722
169 Ga0207677_10014630 3300026023 Bacteria 4589
170 Ga0207639_10040324 3300026041 Bacteria 3484
171 Ga0207678_10059222 3300026067 Bacteria 3295
172 Ga0207702_10001849 3300026078 Bacteria 20848
173 Ga0207702_10050709 3300026078 Bacteria 3504
174 Ga0207641_10558088 3300026088 Bacteria 1117
175 Ga0207648_10000257 3300026089 Bacteria 57438
176 Ga0207683_10027024 3300026121 Bacteria 4959
177 Ga0207698_10016186 3300026142 Bacteria 5019
178 Ga0268266_10000078 3300028379 Bacteria 213632
179 Ga0307517_10010505 3300028786 Bacteria 12953
180 Ga0307515_10000778 3300028794 Bacteria 73451
181 Ga0307515_10003029 3300028794 Bacteria 35637
182 Ga0307515_10202796 3300028794 Bacteria 1853
183 Ga0265338_10443849 3300028800 Bacteria 919
184 Ga0316176_1114662 3300030732 Bacteria 1729
185 Ga0316183_1174733 3300030742 Bacteria 32145
186 Ga0316181_1092606 3300030744 Bacteria 18862
187 Ga0307509_10091587 3300031507 Bacteria 3111
188 Ga0307509_10176174 3300031507 Unclassified 2011
189 Ga0307408_100025496 3300031548 Bacteria 4051
190 Ga0307405_10015602 3300031731 Bacteria 4120
191 Ga0307412_10010470 3300031911 Bacteria 5342
192 Ga0307414_10000124 3300032004 Bacteria 53995
193 Ga0307414_10007631 3300032004 Bacteria 6087
194 Ga0307414_10080850 3300032004 Bacteria 2378
195 Ga0307411_10018820 3300032005 Bacteria 3973
196 Ga0307507_10002030 3300033179 Bacteria 43887
197 Ga0307510_10001211 3300033180 Bacteria 27977
198 Ga0373941_0035706 3300035115 Bacteria 1507
199 Ga0316582_0312882 3300036647 Bacteria 1079
200 Ga0316584_0213861 3300036712 Bacteria 1418
201 Ga0395899_0000001 3300037312 Bacteria 1750322
202 Ga0395899_0000950 3300037312 Bacteria 27103
203 Ga0395899_0108054 3300037312 Bacteria 2002
204 Ga0395900_0000014 3300037418 Bacteria 386513
205 Ga0395900_0002099 3300037418 Bacteria 22311
206 Ga0395900_0069197 3300037418 Bacteria 3628
207 Ga0395898_0005668 3300037466 Bacteria 13461
208 Ga0395898_0085793 3300037466 Bacteria 3035
209 Ga0395905_0000037 3300037471 Bacteria 261808
210 Ga0395905_0000807 3300037471 Bacteria 41139
211 Ga0395901_0000117 3300038443 Bacteria 105071
212 Ga0395901_0004286 3300038443 Bacteria 14391
213 Ga0451793_0921627 3300041452 Bacteria 1559
214 Ga0439448_0009718 3300042005 Bacteria 2840
215 Ga0451577_0002870 3300042876 Bacteria 19801
216 Ga0451577_0218597 3300042876 Bacteria 1722
217 Ga0451577_0273531 3300042876 Unclassified 1530
218 Ga0451577_0461634 3300042876 Bacteria 1153
219 Ga0453683_0004868 3300044673 Bacteria 9436
220 Ga0466966_0005500 3300044684 Bacteria 8322
221 Ga0453684_0004099 3300044712 Bacteria 31607
222 Ga0453684_0005201 3300044712 Bacteria 26138
223 Ga0453684_0008474 3300044712 Bacteria 18390
224 Ga0453684_0018000 3300044712 Bacteria 10880
225 Ga0453684_0064739 3300044712 Unclassified 4668
226 Ga0466959_0082070 3300045049 Bacteria 2323
227 Ga0451576_0018359 3300045051 Bacteria 7670
228 Ga0451576_0040624 3300045051 Bacteria 4922
229 Ga0451576_0149562 3300045051 Bacteria 2435
230 Ga0451576_0159956 3300045051 Bacteria 2350
231 Ga0451576_0236831 3300045051 Bacteria 1906
232 Ga0495638_0143714 3300046460 Bacteria 1390
233 Ga0495651_0076130 3300046462 Bacteria 2543
234 Ga0495650_0000014 3300046471 Bacteria 581606
235 Ga0495650_0042419 3300046471 Bacteria 1937
236 Ga0495585_0001092 3300046492 Bacteria 22350
237 Ga0495585_0002645 3300046492 Bacteria 12593
238 Ga0495583_0021730 3300046506 Bacteria 3294
239 Ga0495606_0000096 3300046507 Bacteria 151500
240 Ga0495606_0021048 3300046507 Bacteria 4786
241 Ga0495606_0024461 3300046507 Bacteria 4351
242 Ga0495610_0000427 3300046512 Bacteria 43336
243 Ga0495616_0005764 3300046513 Bacteria 7575
244 Ga0495616_0006078 3300046513 Bacteria 7357
245 Ga0495631_0015907 3300046518 Bacteria 3595
246 Ga0495637_0049301 3300046520 Bacteria 1770
247 Ga0495644_0006888 3300046523 Bacteria 4401
248 Ga0495648_0003373 3300046524 Bacteria 14063
249 Ga0495642_0191894 3300046528 Bacteria 890
250 Ga0495609_0020532 3300046538 Bacteria 3052
251 Ga0495622_0027492 3300046557 Bacteria 2655
252 Ga0495633_0000081 3300046558 Bacteria 125903
253 Ga0495668_0000003 3300046616 Bacteria 695023
254 Ga0495625_0000003 3300046660 Bacteria 686847
255 Ga0495625_0000846 3300046660 Bacteria 41815
256 Ga0495625_0007119 3300046660 Bacteria 9827
257 Ga0495625_0049673 3300046660 Bacteria 3014
258 Ga0495625_0095378 3300046660 Bacteria 2051
259 Ga0495625_0400479 3300046660 Bacteria 857
260 Ga0495661_0001756 3300046665 Bacteria 17434
261 Ga0495658_0079295 3300046683 Bacteria 1924
262 Ga0495669_0093904 3300046684 Bacteria 1388
263 Ga0495671_0058511 3300046692 Bacteria 1907
264 Ga0495649_0000002 3300046694 Bacteria 1093458
265 Ga0495660_0033067 3300046810 Bacteria 2902
266 Ga0495687_001036 3300047443 Bacteria 27592
267 Ga0495687_001602 3300047443 Bacteria 20428
268 Ga0495686_0000367 3300047472 Bacteria 73112
269 Ga0495686_0003019 3300047472 Bacteria 14949
270 Ga0495686_0050238 3300047472 Bacteria 2621
271 Ga0495678_014896 3300049459 Bacteria 3601
272 Ga0501223_018383 3300049663 Unclassified 1376
273 Ga0501240_005395 3300049673 Bacteria 1529
274 Ga0501035_0566534 3300049822 Bacteria 929
275 nmdc:mga0k408_2545_c1 3300050493 Bacteria 9691
276 Ga0500635_0001938 3300053080 Bacteria 5050
277 Ga0500608_000329 3300053122 Bacteria 18275
278 Ga0500608_020757 3300053122 Bacteria 3025
279 Ga0500618_000004 3300053125 Bacteria 293180
280 Ga0500616_0013337 3300053153 Unclassified 4776
281 Ga0500622_0000864 3300053156 Bacteria 25792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0000014 Ga0495650_0000014_112230_113006 225
2 3300046506 Ga0495583_0021730 Ga0495583_0021730_1607_2383 225
3 3300046665 Ga0495661_0001756 Ga0495661_0001756_16052_16828 225
4 3300046694 Ga0495649_0000002 Ga0495649_0000002_883144_883920 225
5 3300047472 Ga0495686_0050238 Ga0495686_0050238_1599_2375 225
6 3300009545 Ga0105237_10000818 Ga0105237_100008183 226
7 3300010375 Ga0105239_10000074 Ga0105239_1000007425 226
8 3300025914 Ga0207671_10000542 Ga0207671_100005423 226
9 iso_pu_bacteria 2884634485 2884636410 227
10 iso_pu_bacteria 2919692658 2919696434 227
11 3300042876 Ga0451577_0002870 Ga0451577_0002870_17057_17827 230
12 3300044712 Ga0453684_0005201 Ga0453684_0005201_13684_14454 230
13 3300045051 Ga0451576_0018359 Ga0451576_0018359_1004_1774 230
14 3300032004 Ga0307414_10000124 Ga0307414_1000012422 231
15 3300032004 Ga0307414_10007631 Ga0307414_100076313 231
16 3300036647 Ga0316582_0312882 Ga0316582_0312882_161_955 231
17 3300036712 Ga0316584_0213861 Ga0316584_0213861_197_991 231
18 3300042876 Ga0451577_0273531 Ga0451577_0273531_173_949 232
19 3300042876 Ga0451577_0461634 Ga0451577_0461634_215_997 232
20 3300044712 Ga0453684_0018000 Ga0453684_0018000_1310_2092 232
21 3300044712 Ga0453684_0064739 Ga0453684_0064739_3838_4614 232
22 3300045051 Ga0451576_0159956 Ga0451576_0159956_1070_1852 232
23 3300044673 Ga0453683_0004868 Ga0453683_0004868_7134_7904 233
24 3300003316 rootH1_10083870 rootH1_100838703 234
25 3300003322 rootL2_10205062 rootL2_102050623 234
26 3300003322 rootL2_10280638 rootL2_102806383 234
27 3300003794 Ga0055531_10004256 Ga0055531_100042567 234
28 3300005618 Ga0068864_100435737 Ga0068864_1004357372 234
29 3300025304 Ga0209257_1000006 Ga0209257_1000006450 234
30 3300031507 Ga0307509_10091587 Ga0307509_100915872 234
31 3300053153 Ga0500616_0013337 Ga0500616_0013337_1832_2608 234
32 iso_pu_bacteria 2842903701 2842906803 234
33 iso_pu_bacteria 2852623160 2852623440 234
34 iso_pu_bacteria 2884933994 2884937682 234
35 iso_pu_bacteria 2919437846 2919441651 234
36 iso_pu_bacteria 2928078545 2928080432 234
37 iso_pu_bacteria 2928147474 2928149396 234
38 iso_pu_bacteria 2977232053 2977236432 234
39 3300003320 rootH2_10057092 rootH2_100570925 235
40 3300037312 Ga0395899_0000001 Ga0395899_0000001_1470396_1471160 235
41 3300042876 Ga0451577_0218597 Ga0451577_0218597_547_1341 235
42 3300045051 Ga0451576_0040624 Ga0451576_0040624_1129_1923 235
43 3300005293 Ga0065715_10089444 Ga0065715_100894448 236
44 3300005327 Ga0070658_10366936 Ga0070658_103669362 236
45 3300005339 Ga0070660_100024845 Ga0070660_1000248452 236
46 3300005366 Ga0070659_100000854 Ga0070659_10000085419 236
47 3300005841 Ga0068863_100615990 Ga0068863_1006159901 236
48 3300013297 Ga0157378_10258675 Ga0157378_102586752 236
49 3300025919 Ga0207657_10037451 Ga0207657_100374512 236
50 3300025932 Ga0207690_10003762 Ga0207690_100037627 236
51 3300026088 Ga0207641_10558088 Ga0207641_105580882 236
52 3300031507 Ga0307509_10176174 Ga0307509_101761741 236
53 3300037418 Ga0395900_0069197 Ga0395900_0069197_2596_3372 237
54 3300041452 Ga0451793_0921627 Ga0451793_0921627_778_1548 237
55 3300044712 Ga0453684_0004099 Ga0453684_0004099_26075_26854 237
56 3300044712 Ga0453684_0008474 Ga0453684_0008474_3193_3981 237
57 3300045051 Ga0451576_0149562 Ga0451576_0149562_391_1170 237
58 3300001979 JGI24740J21852_10078723 JGI24740J21852_100787231 238
59 3300002737 JGI25162J39368_1000961 JGI25162J39368_10009618 238
60 3300002772 JGI25164J39214_1001399 JGI25164J39214_10013993 238
61 3300003214 JGI25165J46597_1001179 JGI25165J46597_10011795 238
62 3300003214 JGI25165J46597_1001485 JGI25165J46597_10014859 238
63 3300003320 rootH2_10096525 rootH2_100965251 238
64 3300003322 rootL2_10270125 rootL2_102701252 238
65 3300003323 rootH1_10006785 rootH1_1000678519 238
66 3300003323 rootH1_10028473 rootH1_100284732 238
67 3300005327 Ga0070658_10000019 Ga0070658_1000001983 238
68 3300005327 Ga0070658_10070798 Ga0070658_100707984 238
69 3300005329 Ga0070683_100006104 Ga0070683_1000061046 238
70 3300005329 Ga0070683_100542528 Ga0070683_1005425281 238
71 3300005535 Ga0070684_100051250 Ga0070684_1000512503 238
72 3300006195 Ga0075366_10108077 Ga0075366_101080772 238
73 3300010375 Ga0105239_10075730 Ga0105239_100757305 238
74 3300013100 Ga0157373_10000161 Ga0157373_100001612 238
75 3300013307 Ga0157372_10002309 Ga0157372_100023093 238
76 3300025231 Ga0207427_100171 Ga0207427_10017125 238
77 3300025233 Ga0209437_100052 Ga0209437_10005280 238
78 3300025250 Ga0209026_1000351 Ga0209026_100035110 238
79 3300025261 Ga0209233_1000067 Ga0209233_100006780 238
80 3300025909 Ga0207705_10000069 Ga0207705_1000006985 238
81 3300025909 Ga0207705_10109604 Ga0207705_101096043 238
82 3300025944 Ga0207661_10013224 Ga0207661_100132245 238
83 3300030732 Ga0316176_1114662 Ga0316176_11146622 238
84 3300030742 Ga0316183_1174733 Ga0316183_117473324 238
85 3300030744 Ga0316181_1092606 Ga0316181_109260610 238
86 3300031548 Ga0307408_100025496 Ga0307408_1000254963 238
87 3300031731 Ga0307405_10015602 Ga0307405_100156022 238
88 3300031911 Ga0307412_10010470 Ga0307412_100104702 238
89 3300032004 Ga0307414_10080850 Ga0307414_100808501 238
90 3300032005 Ga0307411_10018820 Ga0307411_100188203 238
91 3300035115 Ga0373941_0035706 Ga0373941_0035706_563_1339 238
92 3300037312 Ga0395899_0108054 Ga0395899_0108054_1151_1927 238
93 3300037418 Ga0395900_0002099 Ga0395900_0002099_4060_4836 238
94 3300037466 Ga0395898_0085793 Ga0395898_0085793_1138_1914 238
95 3300037471 Ga0395905_0000807 Ga0395905_0000807_13432_14208 238
96 3300038443 Ga0395901_0004286 Ga0395901_0004286_6278_7054 238
97 3300045051 Ga0451576_0236831 Ga0451576_0236831_242_1042 238
98 3300046460 Ga0495638_0143714 Ga0495638_0143714_258_1034 238
99 3300046513 Ga0495616_0005764 Ga0495616_0005764_517_1293 238
100 3300046557 Ga0495622_0027492 Ga0495622_0027492_1594_2370 238
101 3300046660 Ga0495625_0007119 Ga0495625_0007119_5580_6359 238
102 3300046660 Ga0495625_0049673 Ga0495625_0049673_2202_2978 238
103 3300046683 Ga0495658_0079295 Ga0495658_0079295_738_1514 238
104 3300046810 Ga0495660_0033067 Ga0495660_0033067_1807_2583 238
105 3300049459 Ga0495678_014896 Ga0495678_014896_1136_1912 238
106 3300049663 Ga0501223_018383 Ga0501223_018383_129_905 238
107 3300049673 Ga0501240_005395 Ga0501240_005395_223_999 238
108 3300049822 Ga0501035_0566534 Ga0501035_0566534_115_888 238
109 3300050493 nmdc:mga0k408_2545_c1 nmdc:mga0k408_2545_c1_6851_7630 238
110 3300053122 Ga0500608_000329 Ga0500608_000329_3758_4534 238
111 3300053156 Ga0500622_0000864 Ga0500622_0000864_10339_11118 238
112 3300003322 rootL2_10127356 rootL2_101273565 239
113 3300003323 rootH1_10165154 rootH1_101651541 239
114 3300013306 Ga0163162_10015522 Ga0163162_100155225 239
115 3300046492 Ga0495585_0001092 Ga0495585_0001092_963_1781 239
116 3300046507 Ga0495606_0000096 Ga0495606_0000096_118320_119138 239
117 3300046512 Ga0495610_0000427 Ga0495610_0000427_35132_35950 239
118 3300046513 Ga0495616_0006078 Ga0495616_0006078_4183_5001 239
119 3300046520 Ga0495637_0049301 Ga0495637_0049301_14_832 239
120 3300046660 Ga0495625_0000003 Ga0495625_0000003_123073_123891 239
121 3300046692 Ga0495671_0058511 Ga0495671_0058511_410_1228 239
122 3300047443 Ga0495687_001602 Ga0495687_001602_7470_8288 239
123 3300005841 Ga0068863_100581647 Ga0068863_1005816472 240
124 iso_pu_bacteria 2599185184 2599478516 248
125 iso_pu_bacteria 2932082852 2932083227 248
126 3300003323 rootH1_10036067 rootH1_100360675 249
127 3300009093 Ga0105240_10000722 Ga0105240_1000072234 249
128 3300009545 Ga0105237_10003874 Ga0105237_100038745 249
129 3300009545 Ga0105237_10371117 Ga0105237_103711171 249
130 3300010375 Ga0105239_10013160 Ga0105239_100131607 249
131 3300025913 Ga0207695_10000013 Ga0207695_10000013130 249
132 3300025914 Ga0207671_10002982 Ga0207671_1000298216 249
133 3300025914 Ga0207671_10161909 Ga0207671_101619092 249
134 3300046471 Ga0495650_0042419 Ga0495650_0042419_345_1259 249
135 3300002741 JGI25157J39369_1008227 JGI25157J39369_10082271 250
136 3300005327 Ga0070658_10190768 Ga0070658_101907683 250
137 3300025250 Ga0209026_1004283 Ga0209026_10042835 250
138 3300046507 Ga0495606_0021048 Ga0495606_0021048_1539_2354 250
139 3300005614 Ga0068856_100000092 Ga0068856_10000009220 251
140 3300009093 Ga0105240_10373614 Ga0105240_103736141 251
141 3300009551 Ga0105238_10183082 Ga0105238_101830824 251
142 3300013306 Ga0163162_10135765 Ga0163162_101357652 251
143 3300026078 Ga0207702_10001849 Ga0207702_100018495 251
144 3300028794 Ga0307515_10202796 Ga0307515_102027961 251
145 3300028800 Ga0265338_10443849 Ga0265338_104438491 251
146 3300001904 JGI24736J21556_1003555 JGI24736J21556_10035554 252
147 3300001904 JGI24736J21556_1007427 JGI24736J21556_10074272 252
148 3300001990 JGI24737J22298_10000227 JGI24737J22298_100002275 252
149 3300001990 JGI24737J22298_10014282 JGI24737J22298_100142823 252
150 3300001990 JGI24737J22298_10016419 JGI24737J22298_100164192 252
151 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002437 252
152 3300002067 JGI24735J21928_10011866 JGI24735J21928_100118664 252
153 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022203 252
154 3300003214 JGI25165J46597_1006465 JGI25165J46597_10064652 252
155 3300003320 rootH2_10004415 rootH2_1000441525 252
156 3300005288 Ga0065714_10078008 Ga0065714_100780084 252
157 3300005327 Ga0070658_10306903 Ga0070658_103069032 252
158 3300005328 Ga0070676_10000165 Ga0070676_100001656 252
159 3300005334 Ga0068869_100207390 Ga0068869_1002073902 252
160 3300005336 Ga0070680_100001197 Ga0070680_10000119710 252
161 3300005355 Ga0070671_100007630 Ga0070671_1000076309 252
162 3300005364 Ga0070673_100026243 Ga0070673_1000262435 252
163 3300005366 Ga0070659_100013570 Ga0070659_1000135703 252
164 3300005455 Ga0070663_100096113 Ga0070663_1000961131 252
165 3300005456 Ga0070678_100015400 Ga0070678_1000154005 252
166 3300005457 Ga0070662_100000185 Ga0070662_10000018526 252
167 3300005459 Ga0068867_100000116 Ga0068867_1000001163 252
168 3300005530 Ga0070679_100001998 Ga0070679_10000199811 252
169 3300005539 Ga0068853_100084815 Ga0068853_1000848151 252
170 3300005539 Ga0068853_100524220 Ga0068853_1005242201 252
171 3300005548 Ga0070665_100000003 Ga0070665_100000003345 252
172 3300005563 Ga0068855_100000196 Ga0068855_10000019640 252
173 3300005563 Ga0068855_100000519 Ga0068855_10000051930 252
174 3300005563 Ga0068855_100004987 Ga0068855_10000498717 252
175 3300005563 Ga0068855_100084823 Ga0068855_1000848234 252
176 3300005563 Ga0068855_100992604 Ga0068855_1009926041 252
177 3300005578 Ga0068854_100120936 Ga0068854_1001209363 252
178 3300005614 Ga0068856_100002099 Ga0068856_10000209912 252
179 3300005616 Ga0068852_100961013 Ga0068852_1009610131 252
180 3300005718 Ga0068866_10028350 Ga0068866_100283503 252
181 3300006195 Ga0075366_10000849 Ga0075366_100008498 252
182 3300006237 Ga0097621_100000054 Ga0097621_10000005426 252
183 3300006358 Ga0068871_100000145 Ga0068871_10000014522 252
184 3300006881 Ga0068865_100000051 Ga0068865_10000005130 252
185 3300009093 Ga0105240_10483746 Ga0105240_104837462 252
186 3300009174 Ga0105241_10010287 Ga0105241_100102875 252
187 3300009174 Ga0105241_10023476 Ga0105241_100234766 252
188 3300009545 Ga0105237_10002246 Ga0105237_100022466 252
189 3300009545 Ga0105237_10026966 Ga0105237_100269665 252
190 3300010375 Ga0105239_10000002 Ga0105239_10000002449 252
191 3300010375 Ga0105239_10009550 Ga0105239_1000955011 252
192 3300010375 Ga0105239_10011559 Ga0105239_1001155910 252
193 3300013100 Ga0157373_10001209 Ga0157373_1000120915 252
194 3300013100 Ga0157373_10054471 Ga0157373_100544712 252
195 3300013102 Ga0157371_10003015 Ga0157371_100030153 252
196 3300013102 Ga0157371_10009880 Ga0157371_100098802 252
197 3300013102 Ga0157371_10027525 Ga0157371_100275253 252
198 3300013102 Ga0157371_10502573 Ga0157371_105025731 252
199 3300013104 Ga0157370_10021688 Ga0157370_100216883 252
200 3300013104 Ga0157370_10335649 Ga0157370_103356493 252
201 3300013105 Ga0157369_10003273 Ga0157369_100032732 252
202 3300013105 Ga0157369_10390345 Ga0157369_103903451 252
203 3300013105 Ga0157369_10434498 Ga0157369_104344982 252
204 3300013296 Ga0157374_10001618 Ga0157374_1000161818 252
205 3300013296 Ga0157374_10036041 Ga0157374_100360416 252
206 3300013296 Ga0157374_10131550 Ga0157374_101315501 252
207 3300013297 Ga0157378_10049108 Ga0157378_100491084 252
208 3300013297 Ga0157378_10257456 Ga0157378_102574561 252
209 3300013306 Ga0163162_10000064 Ga0163162_100000648 252
210 3300013307 Ga0157372_10000021 Ga0157372_1000002167 252
211 3300013307 Ga0157372_10000883 Ga0157372_1000088324 252
212 3300013307 Ga0157372_10003368 Ga0157372_1000336810 252
213 3300013307 Ga0157372_10013159 Ga0157372_100131594 252
214 3300014745 Ga0157377_10008517 Ga0157377_100085177 252
215 3300014745 Ga0157377_10307265 Ga0157377_103072651 252
216 3300014969 Ga0157376_10212487 Ga0157376_102124872 252
217 3300025233 Ga0209437_100024 Ga0209437_100024517 252
218 3300025250 Ga0209026_1004483 Ga0209026_10044834 252
219 3300025258 Ga0209129_1008760 Ga0209129_10087604 252
220 3300025261 Ga0209233_1001459 Ga0209233_10014594 252
221 3300025904 Ga0207647_10000030 Ga0207647_1000003029 252
222 3300025904 Ga0207647_10000093 Ga0207647_1000009313 252
223 3300025904 Ga0207647_10048827 Ga0207647_100488275 252
224 3300025907 Ga0207645_10000652 Ga0207645_1000065214 252
225 3300025909 Ga0207705_10101766 Ga0207705_101017663 252
226 3300025909 Ga0207705_10430582 Ga0207705_104305822 252
227 3300025911 Ga0207654_10003795 Ga0207654_100037954 252
228 3300025911 Ga0207654_10068073 Ga0207654_100680733 252
229 3300025913 Ga0207695_10003137 Ga0207695_100031372 252
230 3300025913 Ga0207695_10029276 Ga0207695_100292767 252
231 3300025913 Ga0207695_10142065 Ga0207695_101420653 252
232 3300025913 Ga0207695_10167983 Ga0207695_101679833 252
233 3300025913 Ga0207695_10176141 Ga0207695_101761412 252
234 3300025914 Ga0207671_10001726 Ga0207671_1000172617 252
235 3300025914 Ga0207671_10015797 Ga0207671_100157975 252
236 3300025914 Ga0207671_10016854 Ga0207671_100168545 252
237 3300025914 Ga0207671_10043295 Ga0207671_100432953 252
238 3300025917 Ga0207660_10003635 Ga0207660_100036353 252
239 3300025921 Ga0207652_10010172 Ga0207652_100101725 252
240 3300025921 Ga0207652_10204951 Ga0207652_102049513 252
241 3300025931 Ga0207644_10365575 Ga0207644_103655752 252
242 3300025933 Ga0207706_10000243 Ga0207706_100002439 252
243 3300025937 Ga0207669_10311201 Ga0207669_103112012 252
244 3300025938 Ga0207704_10000046 Ga0207704_1000004629 252
245 3300025942 Ga0207689_10168493 Ga0207689_101684932 252
246 3300025949 Ga0207667_10000037 Ga0207667_1000003739 252
247 3300025949 Ga0207667_10009468 Ga0207667_100094687 252
248 3300025949 Ga0207667_10013674 Ga0207667_100136747 252
249 3300025949 Ga0207667_10048950 Ga0207667_100489503 252
250 3300025960 Ga0207651_10169022 Ga0207651_101690223 252
251 3300026023 Ga0207677_10014630 Ga0207677_100146304 252
252 3300026041 Ga0207639_10040324 Ga0207639_100403245 252
253 3300026067 Ga0207678_10059222 Ga0207678_100592224 252
254 3300026078 Ga0207702_10050709 Ga0207702_100507092 252
255 3300026089 Ga0207648_10000257 Ga0207648_1000025747 252
256 3300026121 Ga0207683_10027024 Ga0207683_100270243 252
257 3300026142 Ga0207698_10016186 Ga0207698_100161865 252
258 3300028379 Ga0268266_10000078 Ga0268266_10000078135 252
259 3300028786 Ga0307517_10010505 Ga0307517_100105055 252
260 3300028794 Ga0307515_10000778 Ga0307515_1000077832 252
261 3300028794 Ga0307515_10003029 Ga0307515_1000302918 252
262 3300033179 Ga0307507_10002030 Ga0307507_1000203014 252
263 3300033180 Ga0307510_10001211 Ga0307510_1000121116 252
264 3300037312 Ga0395899_0000950 Ga0395899_0000950_19981_20796 252
265 3300037418 Ga0395900_0000014 Ga0395900_0000014_126374_127189 252
266 3300037466 Ga0395898_0005668 Ga0395898_0005668_10369_11184 252
267 3300037471 Ga0395905_0000037 Ga0395905_0000037_126364_127179 252
268 3300038443 Ga0395901_0000117 Ga0395901_0000117_40021_40836 252
269 3300042005 Ga0439448_0009718 Ga0439448_0009718_1886_2701 252
270 3300044684 Ga0466966_0005500 Ga0466966_0005500_7438_8256 252
271 3300045049 Ga0466959_0082070 Ga0466959_0082070_373_1191 252
272 3300046462 Ga0495651_0076130 Ga0495651_0076130_1010_1828 252
273 3300046492 Ga0495585_0002645 Ga0495585_0002645_6077_6895 252
274 3300046507 Ga0495606_0024461 Ga0495606_0024461_2383_3267 252
275 3300046518 Ga0495631_0015907 Ga0495631_0015907_1536_2354 252
276 3300046523 Ga0495644_0006888 Ga0495644_0006888_3042_3857 252
277 3300046524 Ga0495648_0003373 Ga0495648_0003373_11278_12096 252
278 3300046528 Ga0495642_0191894 Ga0495642_0191894_32_847 252
279 3300046538 Ga0495609_0020532 Ga0495609_0020532_1828_2646 252
280 3300046558 Ga0495633_0000081 Ga0495633_0000081_113803_114621 252
281 3300046616 Ga0495668_0000003 Ga0495668_0000003_672363_673181 252
282 3300046660 Ga0495625_0000846 Ga0495625_0000846_26168_26986 252
283 3300046660 Ga0495625_0095378 Ga0495625_0095378_579_1397 252
284 3300046660 Ga0495625_0400479 Ga0495625_0400479_29_847 252
285 3300046684 Ga0495669_0093904 Ga0495669_0093904_551_1369 252
286 3300047443 Ga0495687_001036 Ga0495687_001036_1754_2572 252
287 3300047472 Ga0495686_0000367 Ga0495686_0000367_33169_33987 252
288 3300047472 Ga0495686_0003019 Ga0495686_0003019_3158_3973 252
289 3300053080 Ga0500635_0001938 Ga0500635_0001938_1954_2772 252
290 3300053122 Ga0500608_020757 Ga0500608_020757_158_976 252
291 3300053125 Ga0500618_000004 Ga0500618_000004_22635_23453 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

44

98

0.97

PF12844

HTH_19

Helix-turn-helix domain

41

102

0.96

PF00717

Peptidase_S24

Peptidase S24-like

134

256

0.75

Feature Viewer

pLDDT pTM Quality
73.63 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map