F390451

General Info

Members Datasets Scaffolds Average Seq Length
291 192 267 281

Family's Representative Sequence

Representative Sequence 3300035242|Ga0373962_0006829|Ga0373962_0006829_692_1585
Length 297
Sequence MPERRNAPFSPQRPFALAPLPDVILEPIVKLALAEDLGVAGDLTTDALIDPETRGRWALRARKPGVVAGLDAASLTAWFVDPDLLFDIKKQDGASIGSNETIIEIEGYARSMLTAERVMLNFIGRLSGVATLTRAYVDAVSGTSAIIASTRKTTPGLRALEKRAVKLGGGGSHRYGLDDAILIKDNHIAACGGVTAAMARARAAAGHLCMIEIEVDSLDQLEEALACKPNVILLDNFSLSSMRAAVKLTDGAVALEASGGVSLDSVRAIAETGVDIISIGALTHSATSLDIGLDALD

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0
Isolates 8.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.93
Nodule 0
Rhizoplane 1.03
Rhizosphere 69.07
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10006765 3300003323 Bacteria 6413
2 Ga0055524_1033814 3300003775 Bacteria 1424
3 Ga0055536_1002260 3300003781 Bacteria 10953
4 Ga0055530_10000752 3300003791 Bacteria 26932
5 Ga0055530_10002411 3300003791 Bacteria 12100
6 Ga0055531_10000749 3300003794 Bacteria 27331
7 Ga0055531_10001683 3300003794 Bacteria 15905
8 Ga0065165_1002257 3300005262 Bacteria 17042
9 Ga0070658_10085082 3300005327 Bacteria 2600
10 Ga0070658_10089739 3300005327 Bacteria 2531
11 Ga0070670_100000237 3300005331 Bacteria 49913
12 Ga0070670_100064496 3300005331 Bacteria 3143
13 Ga0070666_10047327 3300005335 Bacteria 2887
14 Ga0070666_10057380 3300005335 Bacteria 2631
15 Ga0070680_100011408 3300005336 Bacteria 6872
16 Ga0070680_100041083 3300005336 Bacteria 3749
17 Ga0070689_100240398 3300005340 Bacteria 1491
18 Ga0070668_100000233 3300005347 Bacteria 36341
19 Ga0070669_100101333 3300005353 Bacteria 2173
20 Ga0070659_100021980 3300005366 Bacteria 4867
21 Ga0070667_100000272 3300005367 Bacteria 58738
22 Ga0070667_100000504 3300005367 Bacteria 39552
23 Ga0070667_100044523 3300005367 Bacteria 3728
24 Ga0070714_100288320 3300005435 Bacteria 1527
25 Ga0070681_10004265 3300005458 Bacteria 13563
26 Ga0070679_100015319 3300005530 Bacteria 7368
27 Ga0070679_100044956 3300005530 Bacteria 4400
28 Ga0068853_100011000 3300005539 Bacteria 7338
29 Ga0070665_100001466 3300005548 Bacteria 27627
30 Ga0070704_100521728 3300005549 Bacteria 1034
31 Ga0068855_100035094 3300005563 Bacteria 5975
32 Ga0068855_100036738 3300005563 Bacteria 5828
33 Ga0068855_100303012 3300005563 Bacteria 1769
34 Ga0068856_100522195 3300005614 Bacteria 1209
35 Ga0068852_100024576 3300005616 Bacteria 4871
36 Ga0068859_100000231 3300005617 Bacteria 55036
37 Ga0068859_100297174 3300005617 Bacteria 1708
38 Ga0068864_100000597 3300005618 Bacteria 30646
39 Ga0068863_100000135 3300005841 Bacteria 78221
40 Ga0068858_100009028 3300005842 Bacteria 9535
41 Ga0068858_100042287 3300005842 Bacteria 4225
42 Ga0068860_100000526 3300005843 Bacteria 46691
43 Ga0068860_100086004 3300005843 Bacteria 2992
44 Ga0068860_100098824 3300005843 Bacteria 2783
45 Ga0068862_100000459 3300005844 Bacteria 44048
46 Ga0068862_100061397 3300005844 Bacteria 3231
47 Ga0075364_10001541 3300006051 Bacteria 12575
48 Ga0075369_10025431 3300006186 Bacteria 2462
49 Ga0075366_10005456 3300006195 Bacteria 6892
50 Ga0075366_10060689 3300006195 Bacteria 2246
51 Ga0075370_10171457 3300006353 Bacteria 1275
52 Ga0097620_100000231 3300006931 Bacteria 55036
53 Ga0097620_100297147 3300006931 Bacteria 1708
54 Ga0105240_10019170 3300009093 Bacteria 9146
55 Ga0105240_10044932 3300009093 Bacteria 5607
56 Ga0105240_10223630 3300009093 Bacteria 2191
57 Ga0105247_10042369 3300009101 Bacteria 2788
58 Ga0105248_10004008 3300009177 Bacteria 16272
59 Ga0105248_10359888 3300009177 Bacteria 1638
60 Ga0105237_10315304 3300009545 Bacteria 1567
61 Ga0105249_10001217 3300009553 Bacteria 22698
62 Ga0157373_10000383 3300013100 Bacteria 35475
63 Ga0157373_10005130 3300013100 Bacteria 9846
64 Ga0157373_10263349 3300013100 Bacteria 1220
65 Ga0157369_10012684 3300013105 Bacteria 9558
66 Ga0163162_10067325 3300013306 Bacteria 3631
67 Ga0157375_10867810 3300013308 Bacteria 1048
68 Ga0163163_10011074 3300014325 Bacteria 8159
69 Ga0157377_10076719 3300014745 Bacteria 1944
70 Ga0157379_10004950 3300014968 Bacteria 11428
71 Ga0157379_10011931 3300014968 Bacteria 7592
72 Ga0213874_10004966 3300021377 Bacteria 3073
73 Ga0213876_10000183 3300021384 Bacteria 64845
74 Ga0213875_10048994 3300021388 Bacteria 1981
75 Ga0209148_1024746 3300025254 Bacteria 945
76 Ga0209673_1029990 3300025273 Bacteria 1722
77 Ga0209676_1000119 3300025292 Bacteria 201094
78 Ga0209676_1000282 3300025292 Bacteria 105777
79 Ga0209564_1002945 3300025295 Bacteria 12347
80 Ga0209564_1017516 3300025295 Bacteria 2787
81 Ga0209758_1000816 3300025297 Bacteria 43874
82 Ga0209758_1002757 3300025297 Bacteria 17216
83 Ga0209050_1000049 3300025298 Bacteria 364096
84 Ga0209050_1003143 3300025298 Bacteria 12601
85 Ga0209050_1003150 3300025298 Bacteria 12573
86 Ga0209256_1001622 3300025299 Bacteria 21931
87 Ga0209257_1000036 3300025304 Bacteria 616006
88 Ga0209257_1000327 3300025304 Bacteria 99581
89 Ga0209257_1000332 3300025304 Bacteria 98632
90 Ga0209257_1001207 3300025304 Bacteria 32467
91 Ga0209257_1003799 3300025304 Bacteria 12432
92 Ga0207680_10031747 3300025903 Bacteria 2995
93 Ga0207643_10052092 3300025908 Bacteria 2324
94 Ga0207707_10052161 3300025912 Bacteria 3562
95 Ga0207707_10162746 3300025912 Bacteria 1951
96 Ga0207695_10003553 3300025913 Bacteria 21835
97 Ga0207695_10012950 3300025913 Bacteria 9973
98 Ga0207660_10040920 3300025917 Bacteria 3246
99 Ga0207660_10122959 3300025917 Bacteria 1967
100 Ga0207652_10271303 3300025921 Bacteria 1530
101 Ga0207681_10101723 3300025923 Bacteria 2073
102 Ga0207650_10000136 3300025925 Bacteria 89925
103 Ga0207650_10046147 3300025925 Bacteria 3208
104 Ga0207644_10004972 3300025931 Bacteria 8669
105 Ga0207690_10002323 3300025932 Bacteria 11585
106 Ga0207686_10043861 3300025934 Bacteria 2743
107 Ga0207711_10057035 3300025941 Bacteria 3357
108 Ga0207711_10227023 3300025941 Bacteria 1709
109 Ga0207667_10018280 3300025949 Bacteria 7867
110 Ga0207667_10201901 3300025949 Bacteria 2039
111 Ga0207712_10000900 3300025961 Bacteria 21552
112 Ga0207668_10000360 3300025972 Bacteria 29295
113 Ga0207668_10003421 3300025972 Bacteria 9308
114 Ga0207668_10016115 3300025972 Bacteria 4658
115 Ga0207658_10000379 3300025986 Bacteria 43390
116 Ga0207658_10000605 3300025986 Bacteria 31883
117 Ga0207703_10002251 3300026035 Bacteria 16864
118 Ga0207703_10007795 3300026035 Bacteria 8476
119 Ga0207639_10015146 3300026041 Bacteria 5432
120 Ga0207702_10283511 3300026078 Bacteria 1567
121 Ga0207641_10000770 3300026088 Bacteria 34326
122 Ga0207641_10005746 3300026088 Bacteria 10539
123 Ga0207676_10000523 3300026095 Bacteria 32225
124 Ga0209981_1009897 3300027378 Bacteria 1306
125 Ga0209999_1004611 3300027543 Bacteria 2473
126 Ga0268266_10001720 3300028379 Bacteria 25070
127 Ga0268265_10003113 3300028380 Bacteria 12100
128 Ga0268265_10202758 3300028380 Bacteria 1722
129 Ga0268264_10000192 3300028381 Bacteria 126749
130 Ga0268264_10035390 3300028381 Bacteria 4111
131 Ga0268264_10254781 3300028381 Bacteria 1632
132 Ga0307515_10060782 3300028794 Bacteria 5379
133 Ga0307515_10086135 3300028794 Bacteria 4009
134 Ga0265338_10026003 3300028800 Bacteria 5918
135 Ga0265338_10118202 3300028800 Bacteria 2119
136 Ga0307511_10008050 3300030521 Bacteria 10566
137 Ga0265327_10000140 3300031251 Bacteria 158935
138 Ga0265327_10007619 3300031251 Bacteria 8300
139 Ga0265327_10114909 3300031251 Bacteria 1281
140 Ga0265314_10061617 3300031711 Bacteria 2553
141 Ga0373946_0013082 3300035171 Bacteria 3114
142 Ga0373962_0006829 3300035242 Bacteria 2777
143 Ga0373931_0003958 3300035691 Bacteria 6707
144 Ga0373927_0000188 3300035695 Bacteria 49189
145 Ga0373925_0000247 3300037068 Bacteria 57283
146 Ga0395900_0035046 3300037418 Bacteria 5169
147 Ga0395900_0163709 3300037418 Bacteria 2268
148 Ga0395900_0184694 3300037418 Bacteria 2117
149 Ga0395898_0018150 3300037466 Bacteria 7181
150 Ga0395898_0496442 3300037466 Bacteria 1161
151 Ga0395905_0195628 3300037471 Bacteria 1896
152 Ga0395905_0532840 3300037471 Bacteria 1075
153 Ga0436364_0461411 3300037853 Bacteria 2484
154 Ga0436364_1246530 3300037853 Bacteria 1434
155 Ga0395901_0025185 3300038443 Bacteria 6108
156 Ga0395901_0733018 3300038443 Bacteria 983
157 Ga0436365_0640791 3300039437 Bacteria 50242
158 Ga0436365_0998372 3300039437 Bacteria 6712
159 Ga0436361_0447772 3300039447 Bacteria 7779
160 Ga0436361_0808480 3300039447 Bacteria 14827
161 Ga0436363_1355867 3300039450 Bacteria 2227
162 Ga0436363_1605317 3300039450 Bacteria 3555
163 Ga0439461_0017341 3300041410 Bacteria 1399
164 Ga0439446_0010344 3300042156 Bacteria 2511
165 Ga0466969_0003007 3300044656 Bacteria 8982
166 Ga0466969_0019889 3300044656 Bacteria 3481
167 Ga0466966_0000375 3300044684 Bacteria 29156
168 Ga0466966_0000979 3300044684 Bacteria 18323
169 Ga0466961_0001014 3300044693 Bacteria 17335
170 Ga0466961_0010192 3300044693 Bacteria 5987
171 Ga0466963_0104889 3300044694 Bacteria 1937
172 Ga0466971_0000522 3300044719 Bacteria 15195
173 Ga0466971_0003502 3300044719 Bacteria 6703
174 Ga0466970_0001081 3300044765 Bacteria 13196
175 Ga0466959_0000108 3300045049 Bacteria 53075
176 Ga0466959_0058821 3300045049 Bacteria 2799
177 Ga0466959_0111449 3300045049 Bacteria 1952
178 Ga0466958_0045015 3300045836 Bacteria 2661
179 Ga0495590_0001689 3300046457 Bacteria 9390
180 Ga0495638_0000692 3300046460 Bacteria 36575
181 Ga0495638_0001024 3300046460 Bacteria 27760
182 Ga0495638_0002437 3300046460 Bacteria 15194
183 Ga0495638_0003978 3300046460 Bacteria 11372
184 Ga0495638_0004691 3300046460 Bacteria 10330
185 Ga0495650_0000024 3300046471 Bacteria 496674
186 Ga0495583_0000013 3300046506 Bacteria 323372
187 Ga0495606_0038241 3300046507 Bacteria 3248
188 Ga0495610_0000078 3300046512 Bacteria 116266
189 Ga0495610_0002837 3300046512 Bacteria 14102
190 Ga0495610_0009513 3300046512 Bacteria 6133
191 Ga0495616_0000222 3300046513 Bacteria 46999
192 Ga0495631_0029679 3300046518 Bacteria 2485
193 Ga0495632_0003808 3300046519 Bacteria 10517
194 Ga0495632_0052162 3300046519 Bacteria 2011
195 Ga0495632_0187898 3300046519 Bacteria 944
196 Ga0495637_0009782 3300046520 Bacteria 4665
197 Ga0495643_0058200 3300046522 Bacteria 2057
198 Ga0495643_0101504 3300046522 Bacteria 1474
199 Ga0495648_0000072 3300046524 Bacteria 132630
200 Ga0495648_0139916 3300046524 Bacteria 1275
201 Ga0495654_0000026 3300046530 Bacteria 234940
202 Ga0495654_0046369 3300046530 Bacteria 2141
203 Ga0495609_0036065 3300046538 Bacteria 2235
204 Ga0495668_0000105 3300046616 Bacteria 133981
205 Ga0495668_0062538 3300046616 Bacteria 2051
206 Ga0495668_0067039 3300046616 Bacteria 1974
207 Ga0495625_0000683 3300046660 Bacteria 48312
208 Ga0495625_0001108 3300046660 Bacteria 34911
209 Ga0495625_0011966 3300046660 Bacteria 7043
210 Ga0495625_0013372 3300046660 Bacteria 6596
211 Ga0495625_0026553 3300046660 Bacteria 4374
212 Ga0495625_0046253 3300046660 Bacteria 3141
213 Ga0495669_0000004 3300046684 Bacteria 208878
214 Ga0495613_0003028 3300046689 Bacteria 12569
215 Ga0495671_0046906 3300046692 Bacteria 2160
216 Ga0495649_0000586 3300046694 Bacteria 30569
217 Ga0495672_0001047 3300047320 Bacteria 28265
218 Ga0495672_0023281 3300047320 Bacteria 4010
219 Ga0495673_0000483 3300047469 Bacteria 42457
220 Ga0495673_0001103 3300047469 Bacteria 23234
221 Ga0495681_0070741 3300047470 Bacteria 1581
222 Ga0495686_0003048 3300047472 Bacteria 14849
223 Ga0495686_0004978 3300047472 Bacteria 10684
224 Ga0495686_0011274 3300047472 Bacteria 6301
225 Ga0495686_0040509 3300047472 Bacteria 2970
226 Ga0495686_0051792 3300047472 Bacteria 2575
227 Ga0495686_0078362 3300047472 Bacteria 2022
228 Ga0495615_0063385 3300048090 Bacteria 981
229 Ga0496107_0057081 3300048910 Bacteria 2822
230 Ga0496115_0002236 3300048918 Bacteria 13875
231 Ga0496115_0069032 3300048918 Bacteria 2862
232 Ga0496125_0002295 3300048928 Bacteria 25284
233 Ga0496125_0030292 3300048928 Bacteria 4843
234 Ga0496126_0003606 3300048929 Bacteria 19378
235 Ga0501047_0000537 3300049581 Bacteria 41106
236 Ga0501073_0297685 3300049589 Bacteria 1113
237 Ga0501257_006630 3300049686 Bacteria 2570
238 nmdc:mga00v17_2891_c1 3300050491 Bacteria 8808
239 nmdc:mga0k408_13943_c1 3300050493 Bacteria 4417
240 nmdc:mga06z11_17453_c1 3300050494 Bacteria 3258
241 nmdc:mga07m45_105981_c1 3300050496 Bacteria 1617
242 nmdc:mga07m45_2430_c1 3300050496 Bacteria 8736
243 nmdc:mga0sz30_2588_c1 3300050516 Bacteria 6433
244 Ga0500578_0003935 3300053086 Bacteria 10784
245 Ga0500644_0000238 3300053088 Bacteria 31362
246 Ga0500644_0042807 3300053088 Bacteria 1512
247 Ga0500647_0007375 3300053091 Bacteria 4723
248 Ga0500556_0001174 3300053104 Bacteria 12502
249 Ga0500562_000847 3300053108 Bacteria 7406
250 Ga0500562_002216 3300053108 Bacteria 4861
251 Ga0500572_000545 3300053111 Bacteria 12794
252 Ga0500594_0007890 3300053118 Bacteria 2415
253 Ga0500595_003265 3300053119 Bacteria 7658
254 Ga0500608_000046 3300053122 Bacteria 55792
255 Ga0500618_000058 3300053125 Bacteria 97628
256 Ga0500658_0003755 3300053134 Bacteria 5721
257 Ga0500559_0000006 3300053136 Bacteria 229895
258 Ga0500559_0000190 3300053136 Bacteria 49263
259 Ga0500559_0009960 3300053136 Bacteria 4095
260 Ga0500564_000496 3300053138 Bacteria 11572
261 Ga0500622_0030924 3300053156 Bacteria 2809
262 Ga0500627_0044504 3300053158 Bacteria 1917
263 Ga0500639_128915 3300053163 Bacteria 1201
264 Ga0500645_002606 3300053730 Bacteria 7913
265 Ga0500645_003237 3300053730 Bacteria 6732
266 Ga0500609_002067 3300053731 Bacteria 2884
267 Ga0466962_0005658 3300061719 Bacteria 6005

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0532840 Ga0395905_0532840_355_1056 229
2 3300053163 Ga0500639_128915 Ga0500639_128915_41_766 239
3 3300005340 Ga0070689_100240398 Ga0070689_1002403982 241
4 3300025908 Ga0207643_10052092 Ga0207643_100520922 241
5 3300045049 Ga0466959_0111449 Ga0466959_0111449_331_1227 251
6 3300014745 Ga0157377_10076719 Ga0157377_100767191 255
7 3300028800 Ga0265338_10026003 Ga0265338_100260034 261
8 3300005327 Ga0070658_10085082 Ga0070658_100850825 262
9 3300028794 Ga0307515_10060782 Ga0307515_100607822 262
10 3300037418 Ga0395900_0035046 Ga0395900_0035046_3236_4132 262
11 3300038443 Ga0395901_0025185 Ga0395901_0025185_1811_2707 262
12 3300046660 Ga0495625_0000683 Ga0495625_0000683_8353_9210 262
13 3300049589 Ga0501073_0297685 Ga0501073_0297685_302_1096 262
14 3300049686 Ga0501257_006630 Ga0501257_006630_739_1584 262
15 3300013308 Ga0157375_10867810 Ga0157375_108678102 263
16 3300053136 Ga0500559_0000190 Ga0500559_0000190_23413_24213 264
17 3300053731 Ga0500609_002067 Ga0500609_002067_785_1585 264
18 3300053091 Ga0500647_0007375 Ga0500647_0007375_2259_3146 266
19 3300005614 Ga0068856_100522195 Ga0068856_1005221951 267
20 3300026078 Ga0207702_10283511 Ga0207702_102835112 267
21 3300031251 Ga0265327_10007619 Ga0265327_100076191 267
22 3300044656 Ga0466969_0003007 Ga0466969_0003007_3903_4748 267
23 3300044684 Ga0466966_0000375 Ga0466966_0000375_17777_18622 267
24 3300044693 Ga0466961_0001014 Ga0466961_0001014_12190_13035 267
25 3300044719 Ga0466971_0000522 Ga0466971_0000522_2857_3702 267
26 3300044765 Ga0466970_0001081 Ga0466970_0001081_12062_12907 267
27 3300045049 Ga0466959_0058821 Ga0466959_0058821_1292_2137 267
28 3300053108 Ga0500562_000847 Ga0500562_000847_34_843 267
29 3300005335 Ga0070666_10047327 Ga0070666_100473273 268
30 3300005367 Ga0070667_100000504 Ga0070667_1000005043 268
31 3300025986 Ga0207658_10000605 Ga0207658_1000060523 268
32 3300039450 Ga0436363_1355867 Ga0436363_1355867_296_1144 268
33 3300005336 Ga0070680_100041083 Ga0070680_1000410834 269
34 3300013100 Ga0157373_10263349 Ga0157373_102633492 269
35 3300021377 Ga0213874_10004966 Ga0213874_100049662 269
36 3300021384 Ga0213876_10000183 Ga0213876_1000018348 269
37 3300037853 Ga0436364_1246530 Ga0436364_1246530_521_1366 269
38 3300039437 Ga0436365_0640791 Ga0436365_0640791_13934_14779 269
39 3300039450 Ga0436363_1605317 Ga0436363_1605317_1629_2474 269
40 3300046519 Ga0495632_0003808 Ga0495632_0003808_2664_3509 269
41 3300046506 Ga0495583_0000013 Ga0495583_0000013_289113_289961 270
42 3300003781 Ga0055536_1002260 Ga0055536_10022605 271
43 3300003794 Ga0055531_10000749 Ga0055531_100007495 271
44 3300025292 Ga0209676_1000282 Ga0209676_100028247 271
45 3300025298 Ga0209050_1003143 Ga0209050_10031435 271
46 3300025304 Ga0209257_1000332 Ga0209257_100033241 271
47 3300047472 Ga0495686_0040509 Ga0495686_0040509_172_1020 271
48 3300005843 Ga0068860_100086004 Ga0068860_1000860042 272
49 3300028381 Ga0268264_10254781 Ga0268264_102547812 272
50 3300046616 Ga0495668_0000105 Ga0495668_0000105_112372_113220 273
51 3300046694 Ga0495649_0000586 Ga0495649_0000586_29468_30325 273
52 3300005336 Ga0070680_100011408 Ga0070680_1000114087 274
53 3300005435 Ga0070714_100288320 Ga0070714_1002883202 274
54 3300005530 Ga0070679_100044956 Ga0070679_1000449563 274
55 3300005563 Ga0068855_100036738 Ga0068855_1000367386 274
56 3300009093 Ga0105240_10223630 Ga0105240_102236303 274
57 3300009545 Ga0105237_10315304 Ga0105237_103153042 274
58 3300013105 Ga0157369_10012684 Ga0157369_100126842 274
59 3300025917 Ga0207660_10040920 Ga0207660_100409202 274
60 3300037418 Ga0395900_0163709 Ga0395900_0163709_37_909 274
61 3300037418 Ga0395900_0184694 Ga0395900_0184694_1116_1988 274
62 3300037466 Ga0395898_0018150 Ga0395898_0018150_1518_2390 274
63 3300037466 Ga0395898_0496442 Ga0395898_0496442_22_894 274
64 3300046530 Ga0495654_0046369 Ga0495654_0046369_254_1099 275
65 3300048928 Ga0496125_0002295 Ga0496125_0002295_15209_16054 275
66 iso_pu_bacteria 2510917020 2511121782 275
67 iso_pu_bacteria 2643221545 2643747123 275
68 iso_pu_bacteria 2643221552 2643783152 275
69 iso_pu_bacteria 2643221584 2643930905 275
70 iso_pu_bacteria 2643221691 2644507679 275
71 iso_pu_bacteria 2941485952 2941489292 275
72 iso_pu_bacteria 2582581279 2585147765 276
73 iso_pu_bacteria 2585428106 2587917440 276
74 iso_pu_bacteria 2643221640 2644227037 276
75 iso_pu_bacteria 2643221642 2644233495 276
76 iso_pu_bacteria 2857504554 2857508404 276
77 iso_pu_bacteria 2884960567 2884961981 276
78 iso_pu_bacteria 2928531327 2928533397 276
79 iso_pu_bacteria 2818991435 2819537458 277
80 iso_pu_bacteria 2818991454 2819646480 277
81 3300005549 Ga0070704_100521728 Ga0070704_1005217281 278
82 3300005844 Ga0068862_100061397 Ga0068862_1000613974 278
83 3300028380 Ga0268265_10202758 Ga0268265_102027582 278
84 3300005331 Ga0070670_100000237 Ga0070670_10000023716 279
85 3300005331 Ga0070670_100064496 Ga0070670_1000644961 279
86 3300005335 Ga0070666_10057380 Ga0070666_100573802 279
87 3300005347 Ga0070668_100000233 Ga0070668_1000002333 279
88 3300005353 Ga0070669_100101333 Ga0070669_1001013333 279
89 3300005367 Ga0070667_100000272 Ga0070667_10000027239 279
90 3300005367 Ga0070667_100044523 Ga0070667_1000445233 279
91 3300005458 Ga0070681_10004265 Ga0070681_100042655 279
92 3300005530 Ga0070679_100015319 Ga0070679_1000153194 279
93 3300005548 Ga0070665_100001466 Ga0070665_10000146626 279
94 3300005563 Ga0068855_100035094 Ga0068855_1000350944 279
95 3300005563 Ga0068855_100303012 Ga0068855_1003030122 279
96 3300005616 Ga0068852_100024576 Ga0068852_1000245763 279
97 3300005617 Ga0068859_100000231 Ga0068859_10000023115 279
98 3300005617 Ga0068859_100297174 Ga0068859_1002971743 279
99 3300005618 Ga0068864_100000597 Ga0068864_10000059727 279
100 3300005841 Ga0068863_100000135 Ga0068863_10000013531 279
101 3300005842 Ga0068858_100009028 Ga0068858_10000902811 279
102 3300005842 Ga0068858_100042287 Ga0068858_1000422875 279
103 3300005843 Ga0068860_100000526 Ga0068860_10000052615 279
104 3300005843 Ga0068860_100098824 Ga0068860_1000988244 279
105 3300005844 Ga0068862_100000459 Ga0068862_10000045923 279
106 3300006051 Ga0075364_10001541 Ga0075364_1000154113 279
107 3300006195 Ga0075366_10005456 Ga0075366_100054566 279
108 3300006353 Ga0075370_10171457 Ga0075370_101714572 279
109 3300006931 Ga0097620_100000231 Ga0097620_10000023115 279
110 3300006931 Ga0097620_100297147 Ga0097620_1002971472 279
111 3300009093 Ga0105240_10019170 Ga0105240_100191702 279
112 3300009093 Ga0105240_10044932 Ga0105240_100449323 279
113 3300009101 Ga0105247_10042369 Ga0105247_100423691 279
114 3300009177 Ga0105248_10004008 Ga0105248_100040082 279
115 3300009177 Ga0105248_10359888 Ga0105248_103598883 279
116 3300009553 Ga0105249_10001217 Ga0105249_1000121718 279
117 3300013100 Ga0157373_10000383 Ga0157373_1000038321 279
118 3300013100 Ga0157373_10005130 Ga0157373_100051302 279
119 3300013306 Ga0163162_10067325 Ga0163162_100673252 279
120 3300014325 Ga0163163_10011074 Ga0163163_100110746 279
121 3300014968 Ga0157379_10004950 Ga0157379_1000495010 279
122 3300014968 Ga0157379_10011931 Ga0157379_100119314 279
123 3300021388 Ga0213875_10048994 Ga0213875_100489942 279
124 3300025297 Ga0209758_1000816 Ga0209758_100081632 279
125 3300025903 Ga0207680_10031747 Ga0207680_100317473 279
126 3300025912 Ga0207707_10052161 Ga0207707_100521614 279
127 3300025912 Ga0207707_10162746 Ga0207707_101627463 279
128 3300025913 Ga0207695_10003553 Ga0207695_1000355315 279
129 3300025913 Ga0207695_10012950 Ga0207695_100129502 279
130 3300025917 Ga0207660_10122959 Ga0207660_101229592 279
131 3300025921 Ga0207652_10271303 Ga0207652_102713032 279
132 3300025923 Ga0207681_10101723 Ga0207681_101017232 279
133 3300025925 Ga0207650_10000136 Ga0207650_1000013638 279
134 3300025925 Ga0207650_10046147 Ga0207650_100461471 279
135 3300025931 Ga0207644_10004972 Ga0207644_100049726 279
136 3300025934 Ga0207686_10043861 Ga0207686_100438613 279
137 3300025941 Ga0207711_10057035 Ga0207711_100570355 279
138 3300025941 Ga0207711_10227023 Ga0207711_102270232 279
139 3300025949 Ga0207667_10018280 Ga0207667_100182807 279
140 3300025949 Ga0207667_10201901 Ga0207667_102019012 279
141 3300025961 Ga0207712_10000900 Ga0207712_1000090018 279
142 3300025972 Ga0207668_10000360 Ga0207668_1000036016 279
143 3300025972 Ga0207668_10003421 Ga0207668_100034212 279
144 3300025972 Ga0207668_10016115 Ga0207668_100161154 279
145 3300025986 Ga0207658_10000379 Ga0207658_1000037936 279
146 3300026035 Ga0207703_10002251 Ga0207703_100022519 279
147 3300026035 Ga0207703_10007795 Ga0207703_100077952 279
148 3300026088 Ga0207641_10000770 Ga0207641_1000077021 279
149 3300026088 Ga0207641_10005746 Ga0207641_100057466 279
150 3300026095 Ga0207676_10000523 Ga0207676_1000052327 279
151 3300028379 Ga0268266_10001720 Ga0268266_100017205 279
152 3300028380 Ga0268265_10003113 Ga0268265_1000311315 279
153 3300028381 Ga0268264_10000192 Ga0268264_1000019296 279
154 3300028381 Ga0268264_10035390 Ga0268264_100353903 279
155 3300028800 Ga0265338_10118202 Ga0265338_101182021 279
156 3300030521 Ga0307511_10008050 Ga0307511_1000805010 279
157 3300037471 Ga0395905_0195628 Ga0395905_0195628_714_1565 279
158 3300037853 Ga0436364_0461411 Ga0436364_0461411_983_1828 279
159 3300038443 Ga0395901_0733018 Ga0395901_0733018_39_884 279
160 3300039437 Ga0436365_0998372 Ga0436365_0998372_3155_4000 279
161 3300039447 Ga0436361_0808480 Ga0436361_0808480_10490_11335 279
162 3300046460 Ga0495638_0002437 Ga0495638_0002437_12200_13045 279
163 3300046460 Ga0495638_0004691 Ga0495638_0004691_1984_2829 279
164 3300046471 Ga0495650_0000024 Ga0495650_0000024_341526_342371 279
165 3300046507 Ga0495606_0038241 Ga0495606_0038241_1693_2538 279
166 3300046512 Ga0495610_0000078 Ga0495610_0000078_94425_95270 279
167 3300046513 Ga0495616_0000222 Ga0495616_0000222_25653_26498 279
168 3300046519 Ga0495632_0052162 Ga0495632_0052162_997_1842 279
169 3300046519 Ga0495632_0187898 Ga0495632_0187898_35_880 279
170 3300046522 Ga0495643_0058200 Ga0495643_0058200_639_1484 279
171 3300046538 Ga0495609_0036065 Ga0495609_0036065_1142_1987 279
172 3300046616 Ga0495668_0067039 Ga0495668_0067039_1027_1872 279
173 3300046660 Ga0495625_0001108 Ga0495625_0001108_13974_14819 279
174 3300046660 Ga0495625_0011966 Ga0495625_0011966_2748_3593 279
175 3300046660 Ga0495625_0013372 Ga0495625_0013372_3022_3867 279
176 3300046660 Ga0495625_0046253 Ga0495625_0046253_30_875 279
177 3300046684 Ga0495669_0000004 Ga0495669_0000004_178391_179236 279
178 3300046689 Ga0495613_0003028 Ga0495613_0003028_7044_7913 279
179 3300047320 Ga0495672_0001047 Ga0495672_0001047_16302_17159 279
180 3300047470 Ga0495681_0070741 Ga0495681_0070741_457_1302 279
181 3300047472 Ga0495686_0051792 Ga0495686_0051792_1002_1853 279
182 3300047472 Ga0495686_0078362 Ga0495686_0078362_1009_1854 279
183 3300048090 Ga0495615_0063385 Ga0495615_0063385_104_949 279
184 3300048910 Ga0496107_0057081 Ga0496107_0057081_361_1239 279
185 3300048918 Ga0496115_0002236 Ga0496115_0002236_9304_10149 279
186 3300049581 Ga0501047_0000537 Ga0501047_0000537_22965_23810 279
187 3300050491 nmdc:mga00v17_2891_c1 nmdc:mga00v17_2891_c1_6248_7093 279
188 3300050493 nmdc:mga0k408_13943_c1 nmdc:mga0k408_13943_c1_1545_2390 279
189 3300050494 nmdc:mga06z11_17453_c1 nmdc:mga06z11_17453_c1_2294_3139 279
190 3300050496 nmdc:mga07m45_105981_c1 nmdc:mga07m45_105981_c1_51_896 279
191 3300050496 nmdc:mga07m45_2430_c1 nmdc:mga07m45_2430_c1_2579_3424 279
192 3300053104 Ga0500556_0001174 Ga0500556_0001174_7850_8695 279
193 3300053108 Ga0500562_002216 Ga0500562_002216_2880_3725 279
194 3300053111 Ga0500572_000545 Ga0500572_000545_9890_10777 279
195 3300053119 Ga0500595_003265 Ga0500595_003265_617_1468 279
196 3300053125 Ga0500618_000058 Ga0500618_000058_86011_86856 279
197 3300053134 Ga0500658_0003755 Ga0500658_0003755_1285_2130 279
198 3300053136 Ga0500559_0000006 Ga0500559_0000006_179263_180108 279
199 3300053730 Ga0500645_002606 Ga0500645_002606_583_1428 279
200 3300053730 Ga0500645_003237 Ga0500645_003237_629_1480 279
201 3300003323 rootH1_10006765 rootH1_1000676510 280
202 3300003775 Ga0055524_1033814 Ga0055524_10338141 280
203 3300003791 Ga0055530_10000752 Ga0055530_1000075219 280
204 3300003791 Ga0055530_10002411 Ga0055530_100024114 280
205 3300003794 Ga0055531_10001683 Ga0055531_1000168316 280
206 3300005262 Ga0065165_1002257 Ga0065165_100225710 280
207 3300005327 Ga0070658_10089739 Ga0070658_100897392 280
208 3300005366 Ga0070659_100021980 Ga0070659_1000219804 280
209 3300005539 Ga0068853_100011000 Ga0068853_1000110005 280
210 3300006186 Ga0075369_10025431 Ga0075369_100254312 280
211 3300006195 Ga0075366_10060689 Ga0075366_100606892 280
212 3300025254 Ga0209148_1024746 Ga0209148_10247461 280
213 3300025273 Ga0209673_1029990 Ga0209673_10299902 280
214 3300025292 Ga0209676_1000119 Ga0209676_100011914 280
215 3300025295 Ga0209564_1002945 Ga0209564_10029454 280
216 3300025295 Ga0209564_1017516 Ga0209564_10175164 280
217 3300025297 Ga0209758_1002757 Ga0209758_10027573 280
218 3300025298 Ga0209050_1000049 Ga0209050_1000049283 280
219 3300025298 Ga0209050_1003150 Ga0209050_10031505 280
220 3300025299 Ga0209256_1001622 Ga0209256_10016223 280
221 3300025304 Ga0209257_1000036 Ga0209257_1000036355 280
222 3300025304 Ga0209257_1000327 Ga0209257_100032753 280
223 3300025304 Ga0209257_1001207 Ga0209257_100120710 280
224 3300025304 Ga0209257_1003799 Ga0209257_10037995 280
225 3300025932 Ga0207690_10002323 Ga0207690_100023239 280
226 3300026041 Ga0207639_10015146 Ga0207639_100151466 280
227 3300027378 Ga0209981_1009897 Ga0209981_10098972 280
228 3300027543 Ga0209999_1004611 Ga0209999_10046112 280
229 3300028794 Ga0307515_10086135 Ga0307515_100861354 280
230 3300031251 Ga0265327_10000140 Ga0265327_1000014091 280
231 3300031251 Ga0265327_10114909 Ga0265327_101149092 280
232 3300031711 Ga0265314_10061617 Ga0265314_100616172 280
233 3300035171 Ga0373946_0013082 Ga0373946_0013082_337_1197 280
234 3300035242 Ga0373962_0006829 Ga0373962_0006829_692_1585 280
235 3300035691 Ga0373931_0003958 Ga0373931_0003958_5606_6499 280
236 3300035695 Ga0373927_0000188 Ga0373927_0000188_30030_30890 280
237 3300037068 Ga0373925_0000247 Ga0373925_0000247_17552_18412 280
238 3300039447 Ga0436361_0447772 Ga0436361_0447772_3262_4110 280
239 3300041410 Ga0439461_0017341 Ga0439461_0017341_413_1267 280
240 3300042156 Ga0439446_0010344 Ga0439446_0010344_296_1150 280
241 3300044656 Ga0466969_0019889 Ga0466969_0019889_1425_2267 280
242 3300044684 Ga0466966_0000979 Ga0466966_0000979_4999_5841 280
243 3300044693 Ga0466961_0010192 Ga0466961_0010192_1616_2458 280
244 3300044694 Ga0466963_0104889 Ga0466963_0104889_307_1149 280
245 3300044719 Ga0466971_0003502 Ga0466971_0003502_1659_2501 280
246 3300045049 Ga0466959_0000108 Ga0466959_0000108_27603_28445 280
247 3300045836 Ga0466958_0045015 Ga0466958_0045015_579_1421 280
248 3300046457 Ga0495590_0001689 Ga0495590_0001689_8492_9340 280
249 3300046460 Ga0495638_0000692 Ga0495638_0000692_21344_22192 280
250 3300046460 Ga0495638_0001024 Ga0495638_0001024_24124_24972 280
251 3300046460 Ga0495638_0003978 Ga0495638_0003978_9639_10487 280
252 3300046512 Ga0495610_0002837 Ga0495610_0002837_289_1140 280
253 3300046512 Ga0495610_0009513 Ga0495610_0009513_5244_6092 280
254 3300046518 Ga0495631_0029679 Ga0495631_0029679_623_1471 280
255 3300046520 Ga0495637_0009782 Ga0495637_0009782_3798_4649 280
256 3300046522 Ga0495643_0101504 Ga0495643_0101504_197_1051 280
257 3300046524 Ga0495648_0000072 Ga0495648_0000072_20210_21058 280
258 3300046524 Ga0495648_0139916 Ga0495648_0139916_245_1096 280
259 3300046530 Ga0495654_0000026 Ga0495654_0000026_54945_55796 280
260 3300046616 Ga0495668_0062538 Ga0495668_0062538_1059_1907 280
261 3300046660 Ga0495625_0026553 Ga0495625_0026553_1030_1878 280
262 3300046692 Ga0495671_0046906 Ga0495671_0046906_146_994 280
263 3300047320 Ga0495672_0023281 Ga0495672_0023281_2129_3022 280
264 3300047469 Ga0495673_0000483 Ga0495673_0000483_32752_33600 280
265 3300047469 Ga0495673_0001103 Ga0495673_0001103_12278_13138 280
266 3300047472 Ga0495686_0003048 Ga0495686_0003048_1454_2302 280
267 3300047472 Ga0495686_0004978 Ga0495686_0004978_1781_2629 280
268 3300047472 Ga0495686_0011274 Ga0495686_0011274_5156_6004 280
269 3300048918 Ga0496115_0069032 Ga0496115_0069032_1565_2416 280
270 3300048928 Ga0496125_0030292 Ga0496125_0030292_3146_3994 280
271 3300048929 Ga0496126_0003606 Ga0496126_0003606_6790_7638 280
272 3300050516 nmdc:mga0sz30_2588_c1 nmdc:mga0sz30_2588_c1_4770_5618 280
273 3300053086 Ga0500578_0003935 Ga0500578_0003935_2896_3744 280
274 3300053088 Ga0500644_0000238 Ga0500644_0000238_30410_31258 280
275 3300053088 Ga0500644_0042807 Ga0500644_0042807_405_1253 280
276 3300053118 Ga0500594_0007890 Ga0500594_0007890_1527_2375 280
277 3300053122 Ga0500608_000046 Ga0500608_000046_1585_2436 280
278 3300053136 Ga0500559_0009960 Ga0500559_0009960_2802_3653 280
279 3300053138 Ga0500564_000496 Ga0500564_000496_3188_4036 280
280 3300053156 Ga0500622_0030924 Ga0500622_0030924_1414_2274 280
281 3300053158 Ga0500627_0044504 Ga0500627_0044504_498_1349 280
282 3300061719 Ga0466962_0005658 Ga0466962_0005658_2583_3425 280
283 iso_pu_bacteria 2582581280 2585152958 280
284 iso_pu_bacteria 2582581293 2585195083 280
285 iso_pu_bacteria 2643221583 2643924429 280
286 iso_pu_bacteria 2791355048 2792461024 280
287 iso_pu_bacteria 2843744320 2843749307 280
288 iso_pu_bacteria 2849560528 2849562716 280
289 iso_pu_bacteria 2849573788 2849578005 280
290 iso_pu_bacteria 2851153111 2851154017 280
291 iso_pu_bacteria 2898329390 2898333170 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01729

QRPTase_C

Quinolinate phosphoribosyl transferase, C-terminal domain

129

294

0.98

PF02749

QRPTase_N

Quinolinate phosphoribosyl transferase, N-terminal domain

42

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hul-assembly1.cif.gz_A crystal structure of nadc deletion mutant in cubic space group 0.9656 4 279
5huo-assembly1.cif.gz_E-3 crystal structure of nadc deletion mutant in c2221 space group 0.9586 4 279
1x1o-assembly1.cif.gz_A crystal structure of project id tt0268 from thermus thermophilus hb8 0.958 11 280
5huo-assembly2.cif.gz_H-2 crystal structure of nadc deletion mutant in c2221 space group 0.9567 4 279
5hul-assembly1.cif.gz_B crystal structure of nadc deletion mutant in cubic space group 0.9566 4 279
ID Description Score Start End Superfamily
3tqvB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9717 123 268 3.20.20.70
af_P30011_147_280_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9679 130 263 3.90.1170.20
3gnnA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 129 267 3.20.20.70
1qpnA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.965 117 269 3.20.20.70
3l0gD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9637 117 269 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A352CB40-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9892 118 280 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A261UL75-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9858 2 279 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A258C6Z3-F1-model_v4 deleted 0.9853 2 164
AF-A0A257V293-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9847 4 280 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A1H8BNW2-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9846 5 278 GO:0004514
GO:0005737
GO:0009435
GO:0034213

Feature Viewer

pLDDT pTM Quality
94.33 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map