F390400

General Info

Members Datasets Scaffolds Average Seq Length
291 166 582 144

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100514690|Ga0207675_1005146901
Length 178
Sequence MKIAIGSDHAGFRYKEKIKTYLAGLRHEVIDFGTDSEEPVDYPLFIRPVALAVANGEVDRGVVLGGSGNGEAMCANRIKGVRCALCWNVESAQLARLHNDANMISLGQRLLRQETALEIVRVWLETPFAGGRHVRRNQMLDPGRGIRRRFTIFADSEKENAPMIRLEGRKASPTCIGP

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100514690 3300026118 Bacteria 1192
2 MBSR1b_contig_5162133 2162886012 Bacteria 1165
3 Ga0065715_10109631 3300005293 Bacteria 2659
4 Ga0065707_10001725 3300005295 Bacteria 5860
5 Ga0065707_10116274 3300005295 Bacteria 2242
6 Ga0065707_10568976 3300005295 Bacteria 709
7 Ga0070676_10377340 3300005328 Bacteria 981
8 Ga0070690_100045860 3300005330 Unclassified 2778
9 Ga0070690_100076025 3300005330 Bacteria 2190
10 Ga0070690_100109489 3300005330 Bacteria 1841
11 Ga0070690_100335575 3300005330 Bacteria 1093
12 Ga0070670_100326639 3300005331 Bacteria 1345
13 Ga0070666_10123922 3300005335 Bacteria 1793
14 Ga0070666_10542224 3300005335 Bacteria 846
15 Ga0070680_100036533 3300005336 Bacteria 3969
16 Ga0070680_101070850 3300005336 Bacteria 697
17 Ga0068868_100446733 3300005338 Bacteria 1124
18 Ga0068868_101632748 3300005338 Bacteria 606
19 Ga0070689_100213415 3300005340 Bacteria 1581
20 Ga0070687_100771083 3300005343 Bacteria 678
21 Ga0070692_10045921 3300005345 Bacteria 2255
22 Ga0070692_10433757 3300005345 Bacteria 837
23 Ga0070669_100011251 3300005353 Bacteria 6353
24 Ga0070669_100225793 3300005353 Bacteria 1482
25 Ga0070669_100824534 3300005353 Bacteria 789
26 Ga0070671_101864929 3300005355 Bacteria 534
27 Ga0070674_100508638 3300005356 Unclassified 1004
28 Ga0070688_100160558 3300005365 Unclassified 1544
29 Ga0070703_10000060 3300005406 Bacteria 54329
30 Ga0070710_10408936 3300005437 Unclassified 911
31 Ga0070701_10124497 3300005438 Bacteria 1457
32 Ga0070701_10155898 3300005438 Bacteria 1319
33 Ga0070711_100778759 3300005439 Unclassified 810
34 Ga0070705_100307496 3300005440 Bacteria 1139
35 Ga0070700_100022084 3300005441 Bacteria 3706
36 Ga0070700_100095101 3300005441 Bacteria 1952
37 Ga0070694_100001792 3300005444 Bacteria 12711
38 Ga0070694_100012752 3300005444 Bacteria 5235
39 Ga0070694_100031323 3300005444 Bacteria 3487
40 Ga0070694_100306857 3300005444 Bacteria 1218
41 Ga0070694_100562593 3300005444 Bacteria 914
42 Ga0070708_100030229 3300005445 Unclassified 4682
43 Ga0070708_100529611 3300005445 Bacteria 1111
44 Ga0070708_100944191 3300005445 Bacteria 809
45 Ga0070708_101038979 3300005445 Unclassified 768
46 Ga0070681_10030252 3300005458 Bacteria 5432
47 Ga0068867_100045406 3300005459 Bacteria 3222
48 Ga0068867_100052207 3300005459 Unclassified 3016
49 Ga0068867_100481958 3300005459 Bacteria 1063
50 Ga0068867_100599045 3300005459 Bacteria 961
51 Ga0070707_100013117 3300005468 Bacteria 7746
52 Ga0070707_100014845 3300005468 Bacteria 7304
53 Ga0070707_100229352 3300005468 Bacteria 1808
54 Ga0070707_100590456 3300005468 Bacteria 1073
55 Ga0070707_100828961 3300005468 Bacteria 889
56 Ga0070698_100089525 3300005471 Bacteria 3061
57 Ga0070698_100658860 3300005471 Bacteria 988
58 Ga0070698_100827344 3300005471 Unclassified 870
59 Ga0070698_101071925 3300005471 Bacteria 754
60 Ga0070699_100084120 3300005518 Bacteria 2776
61 Ga0070699_101085608 3300005518 Bacteria 734
62 Ga0070679_100160007 3300005530 Bacteria 2226
63 Ga0070697_100150677 3300005536 Bacteria 1960
64 Ga0070697_100715982 3300005536 Bacteria 883
65 Ga0070686_100004222 3300005544 Bacteria 7907
66 Ga0070686_100055583 3300005544 Bacteria 2536
67 Ga0070686_100073652 3300005544 Bacteria 2243
68 Ga0070686_100952271 3300005544 Bacteria 701
69 Ga0070686_100974028 3300005544 Bacteria 694
70 Ga0070695_100039463 3300005545 Unclassified 2985
71 Ga0070695_100048629 3300005545 Unclassified 2713
72 Ga0070695_100131292 3300005545 Bacteria 1727
73 Ga0070695_100142815 3300005545 Unclassified 1662
74 Ga0070695_100496715 3300005545 Unclassified 943
75 Ga0070695_100525482 3300005545 Unclassified 919
76 Ga0070696_100690700 3300005546 Bacteria 831
77 Ga0070696_101147598 3300005546 Bacteria 655
78 Ga0070696_101153111 3300005546 Unclassified 653
79 Ga0070704_100012228 3300005549 Bacteria 5299
80 Ga0070704_100025510 3300005549 Unclassified 3893
81 Ga0070704_100099612 3300005549 Unclassified 2186
82 Ga0070704_100260264 3300005549 Bacteria 1429
83 Ga0070704_100779165 3300005549 Bacteria 853
84 Ga0070704_100884950 3300005549 Bacteria 802
85 Ga0068854_100239168 3300005578 Unclassified 1445
86 Ga0068854_100994533 3300005578 Bacteria 742
87 Ga0070702_100118144 3300005615 Bacteria 1656
88 Ga0070702_100167805 3300005615 Bacteria 1425
89 Ga0070702_100415671 3300005615 Bacteria 966
90 Ga0068859_100007887 3300005617 Bacteria 10805
91 Ga0068859_100020664 3300005617 Bacteria 6607
92 Ga0068859_100850841 3300005617 Bacteria 998
93 Ga0068859_102601946 3300005617 Unclassified 557
94 Ga0068864_100306751 3300005618 Bacteria 1487
95 Ga0068864_100437377 3300005618 Unclassified 1249
96 Ga0068864_101414075 3300005618 Bacteria 698
97 Ga0068866_10007132 3300005718 Bacteria 4672
98 Ga0068861_100030566 3300005719 Bacteria 3949
99 Ga0068861_100103404 3300005719 Bacteria 2270
100 Ga0068861_100339059 3300005719 Bacteria 1315
101 Ga0068861_100607066 3300005719 Bacteria 1005
102 Ga0068863_100622447 3300005841 Bacteria 1069
103 Ga0068858_100573850 3300005842 Bacteria 1093
104 Ga0068860_100434523 3300005843 Bacteria 1303
105 Ga0068860_101590079 3300005843 Bacteria 675
106 Ga0068862_100002293 3300005844 Bacteria 17096
107 Ga0068862_100049694 3300005844 Bacteria 3582
108 Ga0068862_100088350 3300005844 Bacteria 2697
109 Ga0081539_10036703 3300005985 Unclassified 2928
110 Ga0070715_10000056 3300006163 Bacteria 41126
111 Ga0070716_100052727 3300006173 Bacteria 2316
112 Ga0097621_100350222 3300006237 Bacteria 1313
113 Ga0097621_100583217 3300006237 Bacteria 1020
114 Ga0068871_100508672 3300006358 Bacteria 1086
115 Ga0068871_102062752 3300006358 Bacteria 543
116 Ga0075428_100116044 3300006844 Bacteria 2917
117 Ga0075428_101041535 3300006844 Bacteria 865
118 Ga0075433_10156029 3300006852 Bacteria 2031
119 Ga0075433_10709296 3300006852 Bacteria 881
120 Ga0075433_11368340 3300006852 Unclassified 613
121 Ga0075434_100002092 3300006871 Bacteria 17349
122 Ga0075434_100325481 3300006871 Bacteria 1557
123 Ga0075434_100791984 3300006871 Bacteria 964
124 Ga0075429_100092675 3300006880 Bacteria 2635
125 Ga0075429_100486967 3300006880 Bacteria 1081
126 Ga0068865_100379867 3300006881 Bacteria 1152
127 Ga0075436_100000006 3300006914 Bacteria 306066
128 Ga0097620_100007887 3300006931 Bacteria 10805
129 Ga0097620_100020665 3300006931 Bacteria 6607
130 Ga0097620_100850693 3300006931 Bacteria 998
131 Ga0097620_102602346 3300006931 Unclassified 557
132 Ga0075435_100005073 3300007076 Bacteria 9151
133 Ga0075435_100905770 3300007076 Bacteria 769
134 Ga0099794_10026941 3300007265 Bacteria 2661
135 Ga0099794_10071701 3300007265 Bacteria 1697
136 Ga0099794_10639735 3300007265 Unclassified 564
137 Ga0105251_10222389 3300009011 Bacteria 850
138 Ga0105250_10554254 3300009092 Bacteria 528
139 Ga0105240_10006179 3300009093 Bacteria 17646
140 Ga0111539_10152544 3300009094 Bacteria 2704
141 Ga0111539_10244219 3300009094 Bacteria 2090
142 Ga0111539_10586248 3300009094 Bacteria 1298
143 Ga0105245_10711824 3300009098 Bacteria 1038
144 Ga0114129_10020075 3300009147 Bacteria 9511
145 Ga0114129_10103410 3300009147 Bacteria 3938
146 Ga0114129_10305799 3300009147 Bacteria 2118
147 Ga0114129_10307952 3300009147 Bacteria 2109
148 Ga0105243_10005880 3300009148 Bacteria 9502
149 Ga0105243_10012021 3300009148 Bacteria 6545
150 Ga0105243_10495716 3300009148 Bacteria 1156
151 Ga0105241_11235688 3300009174 Bacteria 709
152 Ga0105242_10007404 3300009176 Bacteria 8452
153 Ga0105242_11934317 3300009176 Bacteria 631
154 Ga0105248_10487684 3300009177 Bacteria 1389
155 Ga0105248_10846948 3300009177 Bacteria 1032
156 Ga0105249_10015600 3300009553 Bacteria 6725
157 Ga0105249_10238555 3300009553 Bacteria 1797
158 Ga0105249_10474150 3300009553 Bacteria 1293
159 Ga0105249_10777763 3300009553 Bacteria 1020
160 Ga0099796_10258180 3300010159 Bacteria 726
161 Ga0105239_10112819 3300010375 Bacteria 3014
162 Ga0105246_10572791 3300011119 Bacteria 971
163 Ga0105246_11432150 3300011119 Bacteria 646
164 Ga0157378_10046522 3300013297 Bacteria 3856
165 Ga0157378_10130027 3300013297 Unclassified 2330
166 Ga0157378_10196654 3300013297 Bacteria 1905
167 Ga0163162_10177454 3300013306 Bacteria 2256
168 Ga0163162_10200747 3300013306 Bacteria 2123
169 Ga0163162_11268077 3300013306 Bacteria 837
170 Ga0157375_10033975 3300013308 Bacteria 4853
171 Ga0157375_10233704 3300013308 Bacteria 1997
172 Ga0157380_10082681 3300014326 Bacteria 2629
173 Ga0157380_10260728 3300014326 Bacteria 1574
174 Ga0157380_11510671 3300014326 Bacteria 725
175 Ga0157376_10853142 3300014969 Bacteria 926
176 Ga0163161_10855122 3300017792 Bacteria 768
177 Ga0207653_10000145 3300025885 Bacteria 50672
178 Ga0207692_10337709 3300025898 Unclassified 926
179 Ga0207642_10032368 3300025899 Bacteria 2201
180 Ga0207680_10572342 3300025903 Bacteria 807
181 Ga0207685_10000060 3300025905 Bacteria 31981
182 Ga0207684_10006757 3300025910 Bacteria 10411
183 Ga0207654_10148631 3300025911 Bacteria 1502
184 Ga0207707_10004879 3300025912 Bacteria 11779
185 Ga0207695_10048582 3300025913 Bacteria 4480
186 Ga0207660_10203425 3300025917 Bacteria 1547
187 Ga0207660_10509012 3300025917 Bacteria 977
188 Ga0207662_10239634 3300025918 Bacteria 1187
189 Ga0207652_10027117 3300025921 Bacteria 4773
190 Ga0207652_11053016 3300025921 Bacteria 713
191 Ga0207646_10016303 3300025922 Bacteria 6973
192 Ga0207646_10036566 3300025922 Bacteria 4432
193 Ga0207687_10613861 3300025927 Bacteria 917
194 Ga0207644_11576314 3300025931 Bacteria 551
195 Ga0207686_10000151 3300025934 Bacteria 53049
196 Ga0207686_10000380 3300025934 Bacteria 30978
197 Ga0207709_10000108 3300025935 Bacteria 129013
198 Ga0207709_10000513 3300025935 Bacteria 34041
199 Ga0207709_10082199 3300025935 Bacteria 2079
200 Ga0207670_10345309 3300025936 Bacteria 1177
201 Ga0207704_10076562 3300025938 Bacteria 2144
202 Ga0207704_10470385 3300025938 Bacteria 1007
203 Ga0207665_10054956 3300025939 Bacteria 2685
204 Ga0207665_11096004 3300025939 Bacteria 635
205 Ga0207711_10572441 3300025941 Bacteria 1054
206 Ga0207711_10769103 3300025941 Bacteria 897
207 Ga0207661_10058630 3300025944 Bacteria 3099
208 Ga0207712_10160726 3300025961 Bacteria 1745
209 Ga0207640_11147265 3300025981 Bacteria 689
210 Ga0207677_10210730 3300026023 Bacteria 1552
211 Ga0207703_10232056 3300026035 Unclassified 1655
212 Ga0207703_10290515 3300026035 Bacteria 1488
213 Ga0207703_10365586 3300026035 Bacteria 1331
214 Ga0207708_10086449 3300026075 Unclassified 2413
215 Ga0207708_10517973 3300026075 Bacteria 1002
216 Ga0207641_10245924 3300026088 Bacteria 1669
217 Ga0207648_10036319 3300026089 Unclassified 4340
218 Ga0207648_10073976 3300026089 Unclassified 2969
219 Ga0207676_10421558 3300026095 Bacteria 1252
220 Ga0207676_10854721 3300026095 Unclassified 890
221 Ga0207675_100121892 3300026118 Bacteria 2468
222 Ga0207675_100142181 3300026118 Bacteria 2280
223 Ga0207428_10006003 3300027907 Bacteria 11246
224 Ga0268264_10207648 3300028381 Bacteria 1796
225 Ga0268264_10783741 3300028381 Bacteria 951
226 Ga0268264_11519985 3300028381 Bacteria 680
227 Ga0265338_10010192 3300028800 Bacteria 11076
228 Ga0307511_10043952 3300030521 Bacteria 3721
229 Ga0265314_10240804 3300031711 Bacteria 1044
230 Ga0316584_0239904 3300036712 Bacteria 1327
231 Ga0395899_0103351 3300037312 Bacteria 2055
232 Ga0395899_0136390 3300037312 Bacteria 1749
233 Ga0395900_0034726 3300037418 Bacteria 5194
234 Ga0395900_0353696 3300037418 Bacteria 1442
235 Ga0395898_0234470 3300037466 Bacteria 1750
236 Ga0395898_0272514 3300037466 Bacteria 1614
237 Ga0395905_0016285 3300037471 Bacteria 7064
238 Ga0395905_0162561 3300037471 Bacteria 2098
239 Ga0395901_0017902 3300038443 Bacteria 7231
240 Ga0395901_0318580 3300038443 Bacteria 1609
241 Ga0453683_0023885 3300044673 Bacteria 3894
242 Ga0453683_0057344 3300044673 Unclassified 2437
243 Ga0453684_0419331 3300044712 Bacteria 1495
244 Ga0495598_0443772 3300046537 Bacteria 513
245 Ga0495621_0077552 3300046539 Bacteria 1234
246 Ga0495659_0487293 3300046664 Bacteria 539
247 Ga0496101_0578400 3300048904 Unclassified 888
248 Ga0496104_1011729 3300048907 Bacteria 735
249 Ga0496106_0032706 3300048909 Bacteria 3879
250 Ga0496107_0328973 3300048910 Unclassified 1137
251 Ga0496114_0326605 3300048917 Unclassified 1356
252 Ga0501297_085064 3300049520 Bacteria 518
253 Ga0501032_0343342 3300049569 Bacteria 962
254 Ga0501033_0083475 3300049570 Bacteria 2342
255 Ga0501036_0930130 3300049572 Bacteria 713
256 Ga0501037_0141589 3300049573 Bacteria 1721
257 Ga0501038_0087262 3300049574 Bacteria 2620
258 Ga0501039_0095752 3300049575 Bacteria 2314
259 Ga0501040_0061214 3300049576 Bacteria 2588
260 Ga0501041_0027060 3300049577 Bacteria 3454
261 Ga0501042_0020686 3300049578 Bacteria 4581
262 Ga0501042_0908277 3300049578 Bacteria 641
263 Ga0501048_0039821 3300049582 Bacteria 3369
264 Ga0501068_0095103 3300049584 Bacteria 1842
265 Ga0501070_0123802 3300049586 Bacteria 2137
266 Ga0501071_0028177 3300049587 Bacteria 3956
267 Ga0501072_0073217 3300049588 Bacteria 2709
268 Ga0501074_0234497 3300049590 Bacteria 1306
269 Ga0501075_0011236 3300049591 Bacteria 6334
270 Ga0501076_0003577 3300049592 Bacteria 10914
271 Ga0501076_0734843 3300049592 Bacteria 815
272 Ga0501077_0006444 3300049593 Bacteria 7205
273 Ga0501079_0017554 3300049741 Bacteria 5465
274 Ga0501080_0027571 3300049742 Bacteria 5282
275 Ga0501081_0046140 3300049743 Bacteria 2994
276 Ga0501083_0206400 3300049744 Bacteria 1281
277 Ga0501035_0259640 3300049822 Bacteria 1473
278 Ga0501045_0131087 3300049824 Bacteria 1863
279 nmdc:mga05p37_4969_c1 3300050507 Bacteria 15581
280 nmdc:mga05p37_91687_c1 3300050507 Bacteria 3744
281 nmdc:mga09592_162569_c1 3300050508 Bacteria 1929
282 nmdc:mga09592_519053_c1 3300050508 Bacteria 1025
283 nmdc:mga08y16_66177_c1 3300050511 Bacteria 3772
284 nmdc:mga0n895_569615_c1 3300050512 Bacteria 1137
285 nmdc:mga0n895_779863_c1 3300050512 Bacteria 947
286 nmdc:mga0rr50_1046_c1 3300050513 Bacteria 15025
287 nmdc:mga08x19_43_c1 3300050514 Bacteria 148391
288 nmdc:mga0a205_62141_c1 3300050515 Bacteria 2992
289 Ga0501084_0085711 3300054114 Bacteria 2645
290 Ga0501082_0051447 3300060353 Bacteria 3550
291 Ga0530510_0037272 3300061734 Bacteria 3506
292 Ga0207675_100514690
293 MBSR1b_contig_5162133
294 Ga0065715_10109631
295 Ga0065707_10001725
296 Ga0065707_10116274
297 Ga0065707_10568976
298 Ga0070676_10377340
299 Ga0070690_100045860
300 Ga0070690_100076025
301 Ga0070690_100109489
302 Ga0070690_100335575
303 Ga0070670_100326639
304 Ga0070666_10123922
305 Ga0070666_10542224
306 Ga0070680_100036533
307 Ga0070680_101070850
308 Ga0068868_100446733
309 Ga0068868_101632748
310 Ga0070689_100213415
311 Ga0070687_100771083
312 Ga0070692_10045921
313 Ga0070692_10433757
314 Ga0070669_100011251
315 Ga0070669_100225793
316 Ga0070669_100824534
317 Ga0070671_101864929
318 Ga0070674_100508638
319 Ga0070688_100160558
320 Ga0070703_10000060
321 Ga0070710_10408936
322 Ga0070701_10124497
323 Ga0070701_10155898
324 Ga0070711_100778759
325 Ga0070705_100307496
326 Ga0070700_100022084
327 Ga0070700_100095101
328 Ga0070694_100001792
329 Ga0070694_100012752
330 Ga0070694_100031323
331 Ga0070694_100306857
332 Ga0070694_100562593
333 Ga0070708_100030229
334 Ga0070708_100529611
335 Ga0070708_100944191
336 Ga0070708_101038979
337 Ga0070681_10030252
338 Ga0068867_100045406
339 Ga0068867_100052207
340 Ga0068867_100481958
341 Ga0068867_100599045
342 Ga0070707_100013117
343 Ga0070707_100014845
344 Ga0070707_100229352
345 Ga0070707_100590456
346 Ga0070707_100828961
347 Ga0070698_100089525
348 Ga0070698_100658860
349 Ga0070698_100827344
350 Ga0070698_101071925
351 Ga0070699_100084120
352 Ga0070699_101085608
353 Ga0070679_100160007
354 Ga0070697_100150677
355 Ga0070697_100715982
356 Ga0070686_100004222
357 Ga0070686_100055583
358 Ga0070686_100073652
359 Ga0070686_100952271
360 Ga0070686_100974028
361 Ga0070695_100039463
362 Ga0070695_100048629
363 Ga0070695_100131292
364 Ga0070695_100142815
365 Ga0070695_100496715
366 Ga0070695_100525482
367 Ga0070696_100690700
368 Ga0070696_101147598
369 Ga0070696_101153111
370 Ga0070704_100012228
371 Ga0070704_100025510
372 Ga0070704_100099612
373 Ga0070704_100260264
374 Ga0070704_100779165
375 Ga0070704_100884950
376 Ga0068854_100239168
377 Ga0068854_100994533
378 Ga0070702_100118144
379 Ga0070702_100167805
380 Ga0070702_100415671
381 Ga0068859_100007887
382 Ga0068859_100020664
383 Ga0068859_100850841
384 Ga0068859_102601946
385 Ga0068864_100306751
386 Ga0068864_100437377
387 Ga0068864_101414075
388 Ga0068866_10007132
389 Ga0068861_100030566
390 Ga0068861_100103404
391 Ga0068861_100339059
392 Ga0068861_100607066
393 Ga0068863_100622447
394 Ga0068858_100573850
395 Ga0068860_100434523
396 Ga0068860_101590079
397 Ga0068862_100002293
398 Ga0068862_100049694
399 Ga0068862_100088350
400 Ga0081539_10036703
401 Ga0070715_10000056
402 Ga0070716_100052727
403 Ga0097621_100350222
404 Ga0097621_100583217
405 Ga0068871_100508672
406 Ga0068871_102062752
407 Ga0075428_100116044
408 Ga0075428_101041535
409 Ga0075433_10156029
410 Ga0075433_10709296
411 Ga0075433_11368340
412 Ga0075434_100002092
413 Ga0075434_100325481
414 Ga0075434_100791984
415 Ga0075429_100092675
416 Ga0075429_100486967
417 Ga0068865_100379867
418 Ga0075436_100000006
419 Ga0097620_100007887
420 Ga0097620_100020665
421 Ga0097620_100850693
422 Ga0097620_102602346
423 Ga0075435_100005073
424 Ga0075435_100905770
425 Ga0099794_10026941
426 Ga0099794_10071701
427 Ga0099794_10639735
428 Ga0105251_10222389
429 Ga0105250_10554254
430 Ga0105240_10006179
431 Ga0111539_10152544
432 Ga0111539_10244219
433 Ga0111539_10586248
434 Ga0105245_10711824
435 Ga0114129_10020075
436 Ga0114129_10103410
437 Ga0114129_10305799
438 Ga0114129_10307952
439 Ga0105243_10005880
440 Ga0105243_10012021
441 Ga0105243_10495716
442 Ga0105241_11235688
443 Ga0105242_10007404
444 Ga0105242_11934317
445 Ga0105248_10487684
446 Ga0105248_10846948
447 Ga0105249_10015600
448 Ga0105249_10238555
449 Ga0105249_10474150
450 Ga0105249_10777763
451 Ga0099796_10258180
452 Ga0105239_10112819
453 Ga0105246_10572791
454 Ga0105246_11432150
455 Ga0157378_10046522
456 Ga0157378_10130027
457 Ga0157378_10196654
458 Ga0163162_10177454
459 Ga0163162_10200747
460 Ga0163162_11268077
461 Ga0157375_10033975
462 Ga0157375_10233704
463 Ga0157380_10082681
464 Ga0157380_10260728
465 Ga0157380_11510671
466 Ga0157376_10853142
467 Ga0163161_10855122
468 Ga0207653_10000145
469 Ga0207692_10337709
470 Ga0207642_10032368
471 Ga0207680_10572342
472 Ga0207685_10000060
473 Ga0207684_10006757
474 Ga0207654_10148631
475 Ga0207707_10004879
476 Ga0207695_10048582
477 Ga0207660_10203425
478 Ga0207660_10509012
479 Ga0207662_10239634
480 Ga0207652_10027117
481 Ga0207652_11053016
482 Ga0207646_10016303
483 Ga0207646_10036566
484 Ga0207687_10613861
485 Ga0207644_11576314
486 Ga0207686_10000151
487 Ga0207686_10000380
488 Ga0207709_10000108
489 Ga0207709_10000513
490 Ga0207709_10082199
491 Ga0207670_10345309
492 Ga0207704_10076562
493 Ga0207704_10470385
494 Ga0207665_10054956
495 Ga0207665_11096004
496 Ga0207711_10572441
497 Ga0207711_10769103
498 Ga0207661_10058630
499 Ga0207712_10160726
500 Ga0207640_11147265
501 Ga0207677_10210730
502 Ga0207703_10232056
503 Ga0207703_10290515
504 Ga0207703_10365586
505 Ga0207708_10086449
506 Ga0207708_10517973
507 Ga0207641_10245924
508 Ga0207648_10036319
509 Ga0207648_10073976
510 Ga0207676_10421558
511 Ga0207676_10854721
512 Ga0207675_100121892
513 Ga0207675_100142181
514 Ga0207428_10006003
515 Ga0268264_10207648
516 Ga0268264_10783741
517 Ga0268264_11519985
518 Ga0265338_10010192
519 Ga0307511_10043952
520 Ga0265314_10240804
521 Ga0316584_0239904
522 Ga0395899_0103351
523 Ga0395899_0136390
524 Ga0395900_0034726
525 Ga0395900_0353696
526 Ga0395898_0234470
527 Ga0395898_0272514
528 Ga0395905_0016285
529 Ga0395905_0162561
530 Ga0395901_0017902
531 Ga0395901_0318580
532 Ga0453683_0023885
533 Ga0453683_0057344
534 Ga0453684_0419331
535 Ga0495598_0443772
536 Ga0495621_0077552
537 Ga0495659_0487293
538 Ga0496101_0578400
539 Ga0496104_1011729
540 Ga0496106_0032706
541 Ga0496107_0328973
542 Ga0496114_0326605
543 Ga0501297_085064
544 Ga0501032_0343342
545 Ga0501033_0083475
546 Ga0501036_0930130
547 Ga0501037_0141589
548 Ga0501038_0087262
549 Ga0501039_0095752
550 Ga0501040_0061214
551 Ga0501041_0027060
552 Ga0501042_0020686
553 Ga0501042_0908277
554 Ga0501048_0039821
555 Ga0501068_0095103
556 Ga0501070_0123802
557 Ga0501071_0028177
558 Ga0501072_0073217
559 Ga0501074_0234497
560 Ga0501075_0011236
561 Ga0501076_0003577
562 Ga0501076_0734843
563 Ga0501077_0006444
564 Ga0501079_0017554
565 Ga0501080_0027571
566 Ga0501081_0046140
567 Ga0501083_0206400
568 Ga0501035_0259640
569 Ga0501045_0131087
570 nmdc:mga05p37_4969_c1
571 nmdc:mga05p37_91687_c1
572 nmdc:mga09592_162569_c1
573 nmdc:mga09592_519053_c1
574 nmdc:mga08y16_66177_c1
575 nmdc:mga0n895_569615_c1
576 nmdc:mga0n895_779863_c1
577 nmdc:mga0rr50_1046_c1
578 nmdc:mga08x19_43_c1
579 nmdc:mga0a205_62141_c1
580 Ga0501084_0085711
581 Ga0501082_0051447
582 Ga0530510_0037272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9906 1 141
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9795 2 141
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9784 2 141
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9741 2 141
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9702 2 143
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9779 2 141 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9671 1 141 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.967 2 141 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9668 2 143 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9661 1 144 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2Z4AIQ0-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) 1.003 1 141 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6B4V8-F1-model_v4 Ribose-5-phosphate isomerase 1.003 1 117 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6JTY0-F1-model_v4 Ribose-5-phosphate isomerase 1.002 1 124 GO:0004751
GO:0009052
GO:0019316
AF-A0A146GAC9-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 1.001 1 141 GO:0004751
GO:0009052
GO:0019316
AF-A0A1G2YWW7-F1-model_v4 Ribose 5-phosphate isomerase B 1.001 1 141 GO:0004751
GO:0009052
GO:0019316

Map