F389957

General Info

Members Datasets Scaffolds Average Seq Length
290 184 580 111

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0030273|Ga0495630_0030273_763_1152
Length 129
Sequence VGFSNRAERGSNHRYDDRVAYDEALAERIRQLVEGEAGLTEKAMFGGLAFLVDGNMAVSASGQGGLLVRVDPDESDALVARTGARPMEMRGREMAGWLRVDADQVRTKRQLAPWVQRGVAFARSLPPKG

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2643221604 Nocardioides sp. Root190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 10.34
Rhizosphere 86.9
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0030273 3300046517 Bacteria 4026
2 Ga0070682_100262329 3300005337 Bacteria 1251
3 Ga0068868_100100716 3300005338 Bacteria 2337
4 Ga0070671_101371257 3300005355 Bacteria 624
5 Ga0070709_10708090 3300005434 Bacteria 784
6 Ga0070714_100040588 3300005435 Bacteria 3923
7 Ga0070714_100159038 3300005435 Bacteria 2042
8 Ga0070714_101341047 3300005435 Bacteria 698
9 Ga0070714_101500460 3300005435 Bacteria 658
10 Ga0070713_101613735 3300005436 Bacteria 629
11 Ga0070710_10009988 3300005437 Bacteria 4653
12 Ga0070710_10507544 3300005437 Bacteria 826
13 Ga0070711_101940538 3300005439 Bacteria 517
14 Ga0070662_100080863 3300005457 Bacteria 2420
15 Ga0070681_10108305 3300005458 Bacteria 2719
16 Ga0070685_11090663 3300005466 Bacteria 603
17 Ga0070706_100046263 3300005467 Bacteria 4017
18 Ga0070707_100368359 3300005468 Bacteria 1396
19 Ga0070698_100001207 3300005471 Bacteria 28694
20 Ga0070698_100977977 3300005471 Bacteria 793
21 Ga0070699_100054763 3300005518 Bacteria 3453
22 Ga0070699_100404157 3300005518 Bacteria 1235
23 Ga0070684_100800997 3300005535 Bacteria 881
24 Ga0070684_101005162 3300005535 Bacteria 783
25 Ga0068853_100526224 3300005539 Bacteria 1118
26 Ga0070695_100000662 3300005545 Bacteria 18372
27 Ga0070696_100251932 3300005546 Bacteria 1336
28 Ga0070696_101977675 3300005546 Unclassified 506
29 Ga0070704_100685229 3300005549 Bacteria 908
30 Ga0068855_100108038 3300005563 Bacteria 3196
31 Ga0068854_100964060 3300005578 Bacteria 753
32 Ga0068856_100138256 3300005614 Bacteria 2442
33 Ga0068861_100194751 3300005719 Bacteria 1697
34 Ga0081455_10074882 3300005937 Bacteria 2794
35 Ga0081538_10004162 3300005981 Bacteria 13425
36 Ga0081538_10173314 3300005981 Bacteria 937
37 Ga0081538_10319764 3300005981 Bacteria 566
38 Ga0070717_10191252 3300006028 Bacteria 1788
39 Ga0070717_11553236 3300006028 Bacteria 600
40 Ga0070717_12026040 3300006028 Bacteria 518
41 Ga0075365_11187351 3300006038 Bacteria 537
42 Ga0075432_10005220 3300006058 Bacteria 4421
43 Ga0070712_101459153 3300006175 Bacteria 597
44 Ga0070712_101933748 3300006175 Bacteria 516
45 Ga0070712_101941123 3300006175 Bacteria 515
46 Ga0075370_10102335 3300006353 Bacteria 1659
47 Ga0075428_100003091 3300006844 Bacteria 18165
48 Ga0075431_100013575 3300006847 Bacteria 8231
49 Ga0075431_100442759 3300006847 Bacteria 1296
50 Ga0075433_10359689 3300006852 Bacteria 1286
51 Ga0075434_100675792 3300006871 Bacteria 1050
52 Ga0075434_101806458 3300006871 Bacteria 618
53 Ga0075429_100010783 3300006880 Bacteria 7903
54 Ga0075429_100145812 3300006880 Bacteria 2072
55 Ga0075436_100224468 3300006914 Bacteria 1333
56 Ga0075436_100706463 3300006914 Bacteria 747
57 Ga0075435_100476351 3300007076 Bacteria 1078
58 Ga0105240_10045480 3300009093 Bacteria 5568
59 Ga0111539_10078887 3300009094 Bacteria 3873
60 Ga0105245_10016881 3300009098 Bacteria 6373
61 Ga0105245_10059806 3300009098 Bacteria 3431
62 Ga0105245_10367798 3300009098 Bacteria 1429
63 Ga0105247_10044176 3300009101 Bacteria 2732
64 Ga0114129_10017811 3300009147 Bacteria 10114
65 Ga0114129_10030090 3300009147 Bacteria 7690
66 Ga0114129_10071265 3300009147 Bacteria 4846
67 Ga0105242_10890802 3300009176 Bacteria 889
68 Ga0105237_10022194 3300009545 Bacteria 6514
69 Ga0105238_12019129 3300009551 Bacteria 610
70 Ga0105239_10030428 3300010375 Bacteria 5937
71 Ga0105239_10661786 3300010375 Bacteria 1193
72 Ga0157374_10105111 3300013296 Bacteria 2711
73 Ga0157372_10095161 3300013307 Bacteria 3393
74 Ga0157372_10198342 3300013307 Bacteria 2325
75 Ga0157377_10470965 3300014745 Bacteria 872
76 Ga0163161_11050735 3300017792 Bacteria 698
77 Ga0207692_10149358 3300025898 Bacteria 1337
78 Ga0207692_10229440 3300025898 Bacteria 1104
79 Ga0207710_10063664 3300025900 Unclassified 1678
80 Ga0207688_10023337 3300025901 Bacteria 3387
81 Ga0207685_10180994 3300025905 Bacteria 977
82 Ga0207699_10626951 3300025906 Bacteria 784
83 Ga0207684_10408217 3300025910 Bacteria 1167
84 Ga0207707_10122690 3300025912 Bacteria 2272
85 Ga0207695_10043428 3300025913 Bacteria 4791
86 Ga0207671_10333181 3300025914 Bacteria 1202
87 Ga0207693_10001515 3300025915 Bacteria 20506
88 Ga0207663_10161261 3300025916 Bacteria 1583
89 Ga0207660_11328324 3300025917 Bacteria 584
90 Ga0207652_11391597 3300025921 Bacteria 605
91 Ga0207646_10810139 3300025922 Bacteria 834
92 Ga0207687_10032897 3300025927 Bacteria 3515
93 Ga0207687_10070102 3300025927 Bacteria 2502
94 Ga0207700_10366987 3300025928 Bacteria 1256
95 Ga0207664_10861468 3300025929 Bacteria 814
96 Ga0207706_10013933 3300025933 Bacteria 7291
97 Ga0207669_10255416 3300025937 Bacteria 1308
98 Ga0207665_10000060 3300025939 Bacteria 70443
99 Ga0207665_11146498 3300025939 Bacteria 620
100 Ga0207667_10263451 3300025949 Bacteria 1762
101 Ga0207640_10687597 3300025981 Bacteria 876
102 Ga0207677_10492051 3300026023 Bacteria 1059
103 Ga0207702_11179751 3300026078 Bacteria 760
104 Ga0207675_100103100 3300026118 Bacteria 2688
105 Ga0207698_10610309 3300026142 Bacteria 1076
106 Ga0207698_12182812 3300026142 Bacteria 567
107 Ga0207428_10016491 3300027907 Bacteria 6353
108 Ga0207428_10131293 3300027907 Bacteria 1916
109 Ga0307512_10006053 3300030522 Bacteria 12389
110 Ga0307409_101146630 3300031995 Bacteria 799
111 Ga0307416_100153216 3300032002 Bacteria 2118
112 Ga0373929_0042656 3300035085 Bacteria 1013
113 Ga0373944_0140614 3300035089 Bacteria 845
114 Ga0373936_0190001 3300035113 Bacteria 903
115 Ga0373945_0052957 3300035116 Bacteria 1497
116 Ga0373945_0530952 3300035116 Bacteria 526
117 Ga0373960_0045169 3300035121 Bacteria 1289
118 Ga0373943_0100213 3300035170 Bacteria 1514
119 Ga0373943_0123045 3300035170 Bacteria 1380
120 Ga0373943_0150752 3300035170 Bacteria 1259
121 Ga0373946_0055510 3300035171 Bacteria 1670
122 Ga0373946_0286017 3300035171 Bacteria 812
123 Ga0373942_0084037 3300035207 Bacteria 950
124 Ga0373931_0305419 3300035691 Bacteria 984
125 Ga0373935_0039631 3300035692 Bacteria 2954
126 Ga0373947_0014084 3300035725 Bacteria 4584
127 Ga0373947_0898846 3300035725 Bacteria 604
128 Ga0373925_0017517 3300037068 Bacteria 5194
129 Ga0373925_0073811 3300037068 Bacteria 2582
130 Ga0395899_0193314 3300037312 Bacteria 1423
131 Ga0395899_0220540 3300037312 Bacteria 1314
132 Ga0395900_0004243 3300037418 Bacteria 15208
133 Ga0395900_0053380 3300037418 Bacteria 4160
134 Ga0395900_0185715 3300037418 Bacteria 2110
135 Ga0395900_1191314 3300037418 Bacteria 677
136 Ga0395898_0001845 3300037466 Bacteria 27238
137 Ga0395898_0427820 3300037466 Bacteria 1261
138 Ga0395905_0021310 3300037471 Bacteria 6131
139 Ga0395905_0084090 3300037471 Bacteria 2981
140 Ga0395905_0228585 3300037471 Bacteria 1740
141 Ga0395905_0624966 3300037471 Bacteria 979
142 Ga0395901_0021003 3300038443 Bacteria 6688
143 Ga0395901_0046283 3300038443 Bacteria 4518
144 Ga0395901_0111708 3300038443 Bacteria 2870
145 Ga0395901_0248119 3300038443 Bacteria 1855
146 Ga0395901_0310746 3300038443 Bacteria 1632
147 Ga0436362_0709992 3300039453 Bacteria 2627
148 Ga0451837_1867173 3300041494 Bacteria 506
149 Ga0451843_0287284 3300041509 Bacteria 730
150 Ga0451853_2026546 3300041512 Bacteria 2724
151 Ga0466972_0028002 3300044658 Bacteria 2784
152 Ga0466965_0177302 3300044683 Bacteria 1123
153 Ga0466961_0016301 3300044693 Bacteria 4772
154 Ga0466961_0042596 3300044693 Bacteria 2910
155 Ga0466961_0174270 3300044693 Bacteria 1337
156 Ga0466963_0992799 3300044694 Bacteria 591
157 Ga0466964_0006649 3300044706 Bacteria 4309
158 Ga0466964_0097139 3300044706 Bacteria 1292
159 Ga0466971_0000622 3300044719 Bacteria 14130
160 Ga0466971_0070878 3300044719 Bacteria 1583
161 Ga0466971_0242476 3300044719 Bacteria 857
162 Ga0466968_0046734 3300044735 Bacteria 1839
163 Ga0466968_0328523 3300044735 Bacteria 740
164 Ga0466970_0295052 3300044765 Bacteria 914
165 Ga0466970_0710784 3300044765 Bacteria 586
166 Ga0466970_0881698 3300044765 Bacteria 526
167 Ga0466957_0005498 3300044842 Bacteria 7111
168 Ga0466960_0007364 3300044901 Bacteria 4469
169 Ga0466960_0010528 3300044901 Bacteria 3844
170 Ga0466959_0013937 3300045049 Bacteria 5836
171 Ga0466958_0074056 3300045836 Bacteria 2086
172 Ga0466958_0266176 3300045836 Bacteria 1097
173 Ga0466958_0785470 3300045836 Bacteria 621
174 Ga0466967_0001753 3300045976 Bacteria 12956
175 Ga0466967_0090095 3300045976 Bacteria 2786
176 Ga0495603_0039891 3300046455 Bacteria 2812
177 Ga0495629_0000475 3300046459 Bacteria 33620
178 Ga0495629_0085063 3300046459 Bacteria 2206
179 Ga0495641_0017444 3300046461 Bacteria 3741
180 Ga0495641_0050170 3300046461 Bacteria 1908
181 Ga0495651_0079178 3300046462 Bacteria 2484
182 Ga0495651_0877032 3300046462 Bacteria 550
183 Ga0495653_0032563 3300046463 Bacteria 4136
184 Ga0495653_0588916 3300046463 Bacteria 685
185 Ga0495582_0001837 3300046473 Bacteria 11998
186 Ga0495582_0030016 3300046473 Bacteria 2983
187 Ga0495639_0002408 3300046475 Bacteria 8179
188 Ga0495639_0049772 3300046475 Bacteria 1902
189 Ga0495662_0016437 3300046476 Bacteria 3583
190 Ga0495664_0071863 3300046477 Bacteria 2066
191 Ga0495594_0814167 3300046499 Bacteria 526
192 Ga0495608_0273045 3300046511 Bacteria 1051
193 Ga0495618_0030394 3300046514 Bacteria 3373
194 Ga0495628_0083159 3300046516 Bacteria 2486
195 Ga0495630_0152867 3300046517 Bacteria 1756
196 Ga0495630_0417845 3300046517 Bacteria 1027
197 Ga0495630_0756434 3300046517 Bacteria 742
198 Ga0495630_0940948 3300046517 Bacteria 657
199 Ga0495666_0006254 3300046526 Bacteria 5995
200 Ga0495666_0103053 3300046526 Bacteria 1344
201 Ga0495665_0012407 3300046531 Bacteria 4610
202 Ga0495640_0090821 3300046533 Bacteria 2015
203 Ga0495640_0091127 3300046533 Bacteria 2011
204 Ga0495586_0048606 3300046535 Bacteria 2292
205 Ga0495587_0645024 3300046536 Bacteria 582
206 Ga0495667_0099537 3300046559 Bacteria 1882
207 Ga0495634_0170503 3300046642 Bacteria 1367
208 Ga0495634_0482977 3300046642 Bacteria 728
209 Ga0495634_0724656 3300046642 Bacteria 570
210 Ga0495635_0137392 3300046663 Bacteria 1665
211 Ga0495588_0240171 3300046674 Bacteria 955
212 Ga0495647_0000982 3300046681 Bacteria 8656
213 Ga0495658_0000235 3300046683 Bacteria 31858
214 Ga0495658_0022385 3300046683 Bacteria 3341
215 Ga0495613_0045658 3300046689 Bacteria 3239
216 Ga0495613_0300146 3300046689 Bacteria 1112
217 Ga0495624_0000735 3300046690 Bacteria 25747
218 Ga0495600_0103730 3300046809 Bacteria 1853
219 Ga0495581_0000968 3300047315 Bacteria 15438
220 Ga0495581_0076706 3300047315 Bacteria 1933
221 Ga0495674_0267842 3300047319 Bacteria 1402
222 Ga0495674_0273092 3300047319 Bacteria 1386
223 Ga0495676_0076628 3300047321 Bacteria 2552
224 Ga0495676_0162559 3300047321 Bacteria 1578
225 Ga0495680_0035964 3300047322 Bacteria 3982
226 Ga0495684_0100097 3300047471 Bacteria 2191
227 Ga0495593_0001435 3300047673 Bacteria 13980
228 Ga0495593_0158713 3300047673 Bacteria 1142
229 Ga0495602_1100387 3300048088 Bacteria 521
230 Ga0495614_0011030 3300048089 Bacteria 3976
231 Ga0495614_0015858 3300048089 Bacteria 3282
232 Ga0496100_0133147 3300048903 Unclassified 1753
233 Ga0496100_0559048 3300048903 Bacteria 886
234 Ga0496101_0452034 3300048904 Bacteria 1013
235 Ga0496102_0047168 3300048905 Bacteria 3914
236 Ga0496103_0063468 3300048906 Bacteria 2301
237 Ga0496104_0359405 3300048907 Bacteria 1368
238 Ga0496105_0658190 3300048908 Bacteria 807
239 Ga0496106_0108471 3300048909 Bacteria 2159
240 Ga0496106_0431200 3300048909 Unclassified 1059
241 Ga0496107_0614270 3300048910 Bacteria 803
242 Ga0496107_1274213 3300048910 Bacteria 526
243 Ga0496108_0107065 3300048911 Bacteria 2387
244 Ga0496108_0295470 3300048911 Bacteria 1411
245 Ga0496108_0537743 3300048911 Bacteria 1020
246 Ga0496108_0582544 3300048911 Bacteria 975
247 Ga0496109_0024595 3300048912 Bacteria 5356
248 Ga0496109_0108293 3300048912 Bacteria 2582
249 Ga0496109_0293068 3300048912 Bacteria 1534
250 Ga0496110_0121366 3300048913 Bacteria 2355
251 Ga0496110_0132525 3300048913 Bacteria 2251
252 Ga0496111_0086575 3300048914 Bacteria 2292
253 Ga0496111_0993740 3300048914 Bacteria 601
254 Ga0496112_0445693 3300048915 Bacteria 1232
255 Ga0496112_0604316 3300048915 Bacteria 1029
256 Ga0496113_0223288 3300048916 Bacteria 1501
257 Ga0496114_0054598 3300048917 Bacteria 3332
258 Ga0496114_0178976 3300048917 Bacteria 1851
259 Ga0496114_0694087 3300048917 Bacteria 893
260 Ga0496115_0578661 3300048918 Bacteria 895
261 Ga0496115_0609083 3300048918 Bacteria 867
262 Ga0501067_0035910 3300049583 Bacteria 2752
263 Ga0501067_0062226 3300049583 Bacteria 2066
264 Ga0501067_0419869 3300049583 Bacteria 746
265 Ga0501069_0059660 3300049585 Bacteria 2129
266 Ga0501069_0063086 3300049585 Bacteria 2069
267 Ga0501081_0621363 3300049743 Bacteria 809
268 Ga0501081_1078629 3300049743 Bacteria 608
269 nmdc:mga0yw44_691348_c1 3300050492 Bacteria 693
270 nmdc:mga05p37_1717_c1 3300050507 Bacteria 25532
271 nmdc:mga05p37_27609_c1 3300050507 Bacteria 6913
272 nmdc:mga09592_231161_c1 3300050508 Bacteria 1602
273 nmdc:mga09592_941_c1 3300050508 Bacteria 22864
274 nmdc:mga06r32_1167_c1 3300050510 Bacteria 23649
275 nmdc:mga06r32_86518_c1 3300050510 Bacteria 3057
276 nmdc:mga08y16_7520_c1 3300050511 Bacteria 11410
277 nmdc:mga08y16_80133_c1 3300050511 Bacteria 3404
278 nmdc:mga0n895_1582244_c1 3300050512 Bacteria 620
279 nmdc:mga0rr50_52767_c1 3300050513 Bacteria 3023
280 nmdc:mga08x19_378904_c1 3300050514 Bacteria 991
281 nmdc:mga08x19_972266_c1 3300050514 Bacteria 603
282 nmdc:mga0a205_121198_c1 3300050515 Bacteria 2514
283 nmdc:mga0a205_9273_c1 3300050515 Bacteria 8989
284 Ga0495601_0026407 3300053077 Bacteria 3585
285 Ga0495601_0099375 3300053077 Bacteria 1878
286 Ga0495612_0017004 3300053078 Bacteria 2913
287 Ga0495619_0438675 3300053085 Bacteria 900
288 Ga0466962_0000577 3300061719 Bacteria 16135
289 Ga0466962_0342009 3300061719 Bacteria 744
290 2644035899 2643221604 Bacteria 5014917
291 Ga0495630_0030273
292 Ga0070682_100262329
293 Ga0068868_100100716
294 Ga0070671_101371257
295 Ga0070709_10708090
296 Ga0070714_100040588
297 Ga0070714_100159038
298 Ga0070714_101341047
299 Ga0070714_101500460
300 Ga0070713_101613735
301 Ga0070710_10009988
302 Ga0070710_10507544
303 Ga0070711_101940538
304 Ga0070662_100080863
305 Ga0070681_10108305
306 Ga0070685_11090663
307 Ga0070706_100046263
308 Ga0070707_100368359
309 Ga0070698_100001207
310 Ga0070698_100977977
311 Ga0070699_100054763
312 Ga0070699_100404157
313 Ga0070684_100800997
314 Ga0070684_101005162
315 Ga0068853_100526224
316 Ga0070695_100000662
317 Ga0070696_100251932
318 Ga0070696_101977675
319 Ga0070704_100685229
320 Ga0068855_100108038
321 Ga0068854_100964060
322 Ga0068856_100138256
323 Ga0068861_100194751
324 Ga0081455_10074882
325 Ga0081538_10004162
326 Ga0081538_10173314
327 Ga0081538_10319764
328 Ga0070717_10191252
329 Ga0070717_11553236
330 Ga0070717_12026040
331 Ga0075365_11187351
332 Ga0075432_10005220
333 Ga0070712_101459153
334 Ga0070712_101933748
335 Ga0070712_101941123
336 Ga0075370_10102335
337 Ga0075428_100003091
338 Ga0075431_100013575
339 Ga0075431_100442759
340 Ga0075433_10359689
341 Ga0075434_100675792
342 Ga0075434_101806458
343 Ga0075429_100010783
344 Ga0075429_100145812
345 Ga0075436_100224468
346 Ga0075436_100706463
347 Ga0075435_100476351
348 Ga0105240_10045480
349 Ga0111539_10078887
350 Ga0105245_10016881
351 Ga0105245_10059806
352 Ga0105245_10367798
353 Ga0105247_10044176
354 Ga0114129_10017811
355 Ga0114129_10030090
356 Ga0114129_10071265
357 Ga0105242_10890802
358 Ga0105237_10022194
359 Ga0105238_12019129
360 Ga0105239_10030428
361 Ga0105239_10661786
362 Ga0157374_10105111
363 Ga0157372_10095161
364 Ga0157372_10198342
365 Ga0157377_10470965
366 Ga0163161_11050735
367 Ga0207692_10149358
368 Ga0207692_10229440
369 Ga0207710_10063664
370 Ga0207688_10023337
371 Ga0207685_10180994
372 Ga0207699_10626951
373 Ga0207684_10408217
374 Ga0207707_10122690
375 Ga0207695_10043428
376 Ga0207671_10333181
377 Ga0207693_10001515
378 Ga0207663_10161261
379 Ga0207660_11328324
380 Ga0207652_11391597
381 Ga0207646_10810139
382 Ga0207687_10032897
383 Ga0207687_10070102
384 Ga0207700_10366987
385 Ga0207664_10861468
386 Ga0207706_10013933
387 Ga0207669_10255416
388 Ga0207665_10000060
389 Ga0207665_11146498
390 Ga0207667_10263451
391 Ga0207640_10687597
392 Ga0207677_10492051
393 Ga0207702_11179751
394 Ga0207675_100103100
395 Ga0207698_10610309
396 Ga0207698_12182812
397 Ga0207428_10016491
398 Ga0207428_10131293
399 Ga0307512_10006053
400 Ga0307409_101146630
401 Ga0307416_100153216
402 Ga0373929_0042656
403 Ga0373944_0140614
404 Ga0373936_0190001
405 Ga0373945_0052957
406 Ga0373945_0530952
407 Ga0373960_0045169
408 Ga0373943_0100213
409 Ga0373943_0123045
410 Ga0373943_0150752
411 Ga0373946_0055510
412 Ga0373946_0286017
413 Ga0373942_0084037
414 Ga0373931_0305419
415 Ga0373935_0039631
416 Ga0373947_0014084
417 Ga0373947_0898846
418 Ga0373925_0017517
419 Ga0373925_0073811
420 Ga0395899_0193314
421 Ga0395899_0220540
422 Ga0395900_0004243
423 Ga0395900_0053380
424 Ga0395900_0185715
425 Ga0395900_1191314
426 Ga0395898_0001845
427 Ga0395898_0427820
428 Ga0395905_0021310
429 Ga0395905_0084090
430 Ga0395905_0228585
431 Ga0395905_0624966
432 Ga0395901_0021003
433 Ga0395901_0046283
434 Ga0395901_0111708
435 Ga0395901_0248119
436 Ga0395901_0310746
437 Ga0436362_0709992
438 Ga0451837_1867173
439 Ga0451843_0287284
440 Ga0451853_2026546
441 Ga0466972_0028002
442 Ga0466965_0177302
443 Ga0466961_0016301
444 Ga0466961_0042596
445 Ga0466961_0174270
446 Ga0466963_0992799
447 Ga0466964_0006649
448 Ga0466964_0097139
449 Ga0466971_0000622
450 Ga0466971_0070878
451 Ga0466971_0242476
452 Ga0466968_0046734
453 Ga0466968_0328523
454 Ga0466970_0295052
455 Ga0466970_0710784
456 Ga0466970_0881698
457 Ga0466957_0005498
458 Ga0466960_0007364
459 Ga0466960_0010528
460 Ga0466959_0013937
461 Ga0466958_0074056
462 Ga0466958_0266176
463 Ga0466958_0785470
464 Ga0466967_0001753
465 Ga0466967_0090095
466 Ga0495603_0039891
467 Ga0495629_0000475
468 Ga0495629_0085063
469 Ga0495641_0017444
470 Ga0495641_0050170
471 Ga0495651_0079178
472 Ga0495651_0877032
473 Ga0495653_0032563
474 Ga0495653_0588916
475 Ga0495582_0001837
476 Ga0495582_0030016
477 Ga0495639_0002408
478 Ga0495639_0049772
479 Ga0495662_0016437
480 Ga0495664_0071863
481 Ga0495594_0814167
482 Ga0495608_0273045
483 Ga0495618_0030394
484 Ga0495628_0083159
485 Ga0495630_0152867
486 Ga0495630_0417845
487 Ga0495630_0756434
488 Ga0495630_0940948
489 Ga0495666_0006254
490 Ga0495666_0103053
491 Ga0495665_0012407
492 Ga0495640_0090821
493 Ga0495640_0091127
494 Ga0495586_0048606
495 Ga0495587_0645024
496 Ga0495667_0099537
497 Ga0495634_0170503
498 Ga0495634_0482977
499 Ga0495634_0724656
500 Ga0495635_0137392
501 Ga0495588_0240171
502 Ga0495647_0000982
503 Ga0495658_0000235
504 Ga0495658_0022385
505 Ga0495613_0045658
506 Ga0495613_0300146
507 Ga0495624_0000735
508 Ga0495600_0103730
509 Ga0495581_0000968
510 Ga0495581_0076706
511 Ga0495674_0267842
512 Ga0495674_0273092
513 Ga0495676_0076628
514 Ga0495676_0162559
515 Ga0495680_0035964
516 Ga0495684_0100097
517 Ga0495593_0001435
518 Ga0495593_0158713
519 Ga0495602_1100387
520 Ga0495614_0011030
521 Ga0495614_0015858
522 Ga0496100_0133147
523 Ga0496100_0559048
524 Ga0496101_0452034
525 Ga0496102_0047168
526 Ga0496103_0063468
527 Ga0496104_0359405
528 Ga0496105_0658190
529 Ga0496106_0108471
530 Ga0496106_0431200
531 Ga0496107_0614270
532 Ga0496107_1274213
533 Ga0496108_0107065
534 Ga0496108_0295470
535 Ga0496108_0537743
536 Ga0496108_0582544
537 Ga0496109_0024595
538 Ga0496109_0108293
539 Ga0496109_0293068
540 Ga0496110_0121366
541 Ga0496110_0132525
542 Ga0496111_0086575
543 Ga0496111_0993740
544 Ga0496112_0445693
545 Ga0496112_0604316
546 Ga0496113_0223288
547 Ga0496114_0054598
548 Ga0496114_0178976
549 Ga0496114_0694087
550 Ga0496115_0578661
551 Ga0496115_0609083
552 Ga0501067_0035910
553 Ga0501067_0062226
554 Ga0501067_0419869
555 Ga0501069_0059660
556 Ga0501069_0063086
557 Ga0501081_0621363
558 Ga0501081_1078629
559 nmdc:mga0yw44_691348_c1
560 nmdc:mga05p37_1717_c1
561 nmdc:mga05p37_27609_c1
562 nmdc:mga09592_231161_c1
563 nmdc:mga09592_941_c1
564 nmdc:mga06r32_1167_c1
565 nmdc:mga06r32_86518_c1
566 nmdc:mga08y16_7520_c1
567 nmdc:mga08y16_80133_c1
568 nmdc:mga0n895_1582244_c1
569 nmdc:mga0rr50_52767_c1
570 nmdc:mga08x19_378904_c1
571 nmdc:mga08x19_972266_c1
572 nmdc:mga0a205_121198_c1
573 nmdc:mga0a205_9273_c1
574 Ga0495601_0026407
575 Ga0495601_0099375
576 Ga0495612_0017004
577 Ga0495619_0438675
578 Ga0466962_0000577
579 Ga0466962_0342009
580 2644035899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

31

122

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7041 25 108
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6815 8 104
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.6224 5 108
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.6217 53 88
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6101 7 114
ID Description Score Start End Superfamily
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7087 5 107 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6732 8 101 3.90.1150.30
af_A0A0R0I5R9_294_440_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6552 83 114 3.90.1150.10
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6455 5 107 3.90.1150.30
3h9xA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.645 7 108 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A6J4THZ5-F1-model_v4 Uncharacterized protein 0.9857 54 114
AF-A0A7I7Q373-F1-model_v4 TfoX N-terminal domain-containing protein 0.985 42 114
AF-A0A6G3V2P1-F1-model_v4 deleted 0.9833 26 93
AF-A0A7I7Q373-F1-model_v4 TfoX N-terminal domain-containing protein 0.9719 42 114
AF-H0QWM6-F1-model_v4 TfoX N-terminal domain-containing protein 0.9715 30 114

Map