F389901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 210 | 239 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300041491|Ga0451833_0464765|Ga0451833_0464765_686_1651 |
| Length | 308 |
| Sequence | MTVIASYIYRNGKRAEEVALQSQSFATRDGEFVWIGLAEPTSDEMDSLKMMFGLHPLAVEDALNGQQVPKVDVYGDQLFVVIKTAHLEGDKIAYGETCIFVGKHHLISVRHGSAKSHKGLREQLEHSPIIDFVVDGYLPMVETMEDRVLELEKHVLISFLEREQIRRIFRMRRQVIKFQRVLGPMSEVVGKLTHLDLPCVDENSKPFFRDVHDHVRRVESVVGGLRDIITSVFEASNLLEQQRQGTITRQLAAWAAILAVPTAIAGIYGMNFEHMPELGTEYGYYVVLTVIVVVCGILYSRFRKAGWL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 4 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 5 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 6 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 7 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 8 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 9 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 10 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 11 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 12 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 13 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 14 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 15 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 16 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 17 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 18 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 19 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 20 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 21 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 22 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 23 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 24 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 25 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 26 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 27 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 28 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 29 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 30 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 31 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 32 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 33 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 34 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 35 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 36 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 37 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 38 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 39 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 40 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 43 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 54 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 155 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 156 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 157 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 158 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 159 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 162 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 163 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 164 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 165 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 166 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 196 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 201 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 202 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 205 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 206 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 207 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 208 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 209 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 210 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.41 |
| Metatranscriptomes | 0 |
| Isolates | 17.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 2.76 |
| Bulb | 0 |
| Endosphere | 12.41 |
| Nodule | 4.48 |
| Rhizoplane | 2.41 |
| Rhizosphere | 66.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_212945 | 2162886012 | Bacteria | 1665 |
| 2 | MBSR1b_contig_7766768 | 2162886012 | Bacteria | 1663 |
| 3 | JGI24739J22299_10029751 | 3300001989 | Bacteria | 1896 |
| 4 | JGI24034J26672_10002332 | 3300002239 | Bacteria | 2602 |
| 5 | JGI24742J22300_10004332 | 3300002244 | Bacteria | 2320 |
| 6 | JGI25159J45721_1000012 | 3300002987 | Bacteria | 149808 |
| 7 | JGI25151J46595_10026212 | 3300003187 | Bacteria | 2357 |
| 8 | rootH1_10026045 | 3300003323 | Bacteria | 6647 |
| 9 | JGI25160J50197_1000042 | 3300003354 | Bacteria | 149808 |
| 10 | JGI25161J50226_1000210 | 3300003374 | Bacteria | 37233 |
| 11 | Ga0055526_1000834 | 3300003771 | Bacteria | 23036 |
| 12 | Ga0055536_1002660 | 3300003781 | Bacteria | 9910 |
| 13 | Ga0055543_1000123 | 3300004625 | Bacteria | 64977 |
| 14 | Ga0065165_1000174 | 3300005262 | Bacteria | 113769 |
| 15 | Ga0065165_1018856 | 3300005262 | Bacteria | 2483 |
| 16 | Ga0065712_10096323 | 3300005290 | Bacteria | 2187 |
| 17 | Ga0065715_10098526 | 3300005293 | Bacteria | 3535 |
| 18 | Ga0065707_10132074 | 3300005295 | Bacteria | 1903 |
| 19 | Ga0065707_10155045 | 3300005295 | Bacteria | 1617 |
| 20 | Ga0070676_10083455 | 3300005328 | Bacteria | 1943 |
| 21 | Ga0070670_100019927 | 3300005331 | Bacteria | 5758 |
| 22 | Ga0070670_100026918 | 3300005331 | Bacteria | 4946 |
| 23 | Ga0070677_10001278 | 3300005333 | Bacteria | 8056 |
| 24 | Ga0070677_10011230 | 3300005333 | Bacteria | 3083 |
| 25 | Ga0070677_10149240 | 3300005333 | Bacteria | 1086 |
| 26 | Ga0068868_100000006 | 3300005338 | Bacteria | 123358 |
| 27 | Ga0070660_100000448 | 3300005339 | Bacteria | 27431 |
| 28 | Ga0070668_100036110 | 3300005347 | Bacteria | 3771 |
| 29 | Ga0070668_100151724 | 3300005347 | Bacteria | 1874 |
| 30 | Ga0070668_100197877 | 3300005347 | Bacteria | 1649 |
| 31 | Ga0070669_100016851 | 3300005353 | Bacteria | 5216 |
| 32 | Ga0070675_100007206 | 3300005354 | Bacteria | 8573 |
| 33 | Ga0070675_100009549 | 3300005354 | Bacteria | 7547 |
| 34 | Ga0070675_100030882 | 3300005354 | Bacteria | 4327 |
| 35 | Ga0070671_100037218 | 3300005355 | Bacteria | 4035 |
| 36 | Ga0070671_100039683 | 3300005355 | Bacteria | 3908 |
| 37 | Ga0070671_100155318 | 3300005355 | Bacteria | 1933 |
| 38 | Ga0070674_100036180 | 3300005356 | Bacteria | 3311 |
| 39 | Ga0070673_100020951 | 3300005364 | Bacteria | 4726 |
| 40 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 41 | Ga0070701_10072544 | 3300005438 | Bacteria | 1844 |
| 42 | Ga0070678_100027699 | 3300005456 | Bacteria | 3852 |
| 43 | Ga0070662_100005727 | 3300005457 | Bacteria | 7961 |
| 44 | Ga0068853_100083069 | 3300005539 | Bacteria | 2806 |
| 45 | Ga0068853_100227757 | 3300005539 | Bacteria | 1704 |
| 46 | Ga0070672_100436059 | 3300005543 | Bacteria | 1127 |
| 47 | Ga0070686_100001878 | 3300005544 | Bacteria | 11700 |
| 48 | Ga0070686_100067416 | 3300005544 | Bacteria | 2331 |
| 49 | Ga0070665_100000038 | 3300005548 | Bacteria | 309230 |
| 50 | Ga0070664_100101284 | 3300005564 | Bacteria | 2505 |
| 51 | Ga0068854_100065327 | 3300005578 | Bacteria | 2645 |
| 52 | Ga0068859_100004778 | 3300005617 | Bacteria | 13781 |
| 53 | Ga0068859_100400125 | 3300005617 | Bacteria | 1469 |
| 54 | Ga0068864_100011441 | 3300005618 | Bacteria | 7330 |
| 55 | Ga0068864_100062643 | 3300005618 | Bacteria | 3223 |
| 56 | Ga0068866_10100736 | 3300005718 | Bacteria | 1593 |
| 57 | Ga0068861_100108314 | 3300005719 | Bacteria | 2222 |
| 58 | Ga0068870_10137175 | 3300005840 | Bacteria | 1428 |
| 59 | Ga0068863_100008473 | 3300005841 | Bacteria | 10043 |
| 60 | Ga0068863_100045965 | 3300005841 | Bacteria | 4144 |
| 61 | Ga0068860_100013059 | 3300005843 | Bacteria | 8151 |
| 62 | Ga0068860_100069207 | 3300005843 | Bacteria | 3354 |
| 63 | Ga0068860_100230896 | 3300005843 | Bacteria | 1798 |
| 64 | Ga0068862_100000074 | 3300005844 | Bacteria | 118036 |
| 65 | Ga0068862_100020793 | 3300005844 | Bacteria | 5482 |
| 66 | Ga0075367_10000044 | 3300006178 | Bacteria | 28305 |
| 67 | Ga0075428_100149850 | 3300006844 | Bacteria | 2534 |
| 68 | Ga0097620_100004778 | 3300006931 | Bacteria | 13781 |
| 69 | Ga0097620_100400200 | 3300006931 | Bacteria | 1469 |
| 70 | Ga0105245_10015502 | 3300009098 | Bacteria | 6645 |
| 71 | Ga0105247_10016490 | 3300009101 | Bacteria | 4429 |
| 72 | Ga0105249_10000167 | 3300009553 | Bacteria | 77350 |
| 73 | Ga0105249_10037701 | 3300009553 | Bacteria | 4386 |
| 74 | Ga0157373_10050737 | 3300013100 | Bacteria | 2954 |
| 75 | Ga0157371_10176204 | 3300013102 | Bacteria | 1529 |
| 76 | Ga0157370_10052632 | 3300013104 | Bacteria | 3887 |
| 77 | Ga0157369_10020532 | 3300013105 | Bacteria | 7384 |
| 78 | Ga0157369_10035368 | 3300013105 | Bacteria | 5478 |
| 79 | Ga0157372_10075574 | 3300013307 | Bacteria | 3801 |
| 80 | Ga0157372_10618789 | 3300013307 | Bacteria | 1262 |
| 81 | Ga0157380_10026698 | 3300014326 | Bacteria | 4386 |
| 82 | Ga0157380_10056460 | 3300014326 | Bacteria | 3122 |
| 83 | Ga0157380_10331810 | 3300014326 | Bacteria | 1415 |
| 84 | Ga0163161_10064338 | 3300017792 | Bacteria | 2675 |
| 85 | Ga0163161_10097874 | 3300017792 | Bacteria | 2180 |
| 86 | Ga0209436_100140 | 3300025208 | Bacteria | 35032 |
| 87 | Ga0209147_101666 | 3300025229 | Bacteria | 7306 |
| 88 | Ga0207425_1013753 | 3300025245 | Bacteria | 1858 |
| 89 | Ga0209130_1000075 | 3300025284 | Bacteria | 171698 |
| 90 | Ga0209130_1025642 | 3300025284 | Bacteria | 1274 |
| 91 | Ga0209676_1003221 | 3300025292 | Bacteria | 10310 |
| 92 | Ga0209025_1001974 | 3300025294 | Bacteria | 23554 |
| 93 | Ga0209564_1000278 | 3300025295 | Bacteria | 105405 |
| 94 | Ga0209758_1023202 | 3300025297 | Bacteria | 2814 |
| 95 | Ga0209050_1003053 | 3300025298 | Bacteria | 12906 |
| 96 | Ga0209256_1000411 | 3300025299 | Bacteria | 67351 |
| 97 | Ga0207426_1000163 | 3300025302 | Bacteria | 171698 |
| 98 | Ga0207426_1000745 | 3300025302 | Bacteria | 36615 |
| 99 | Ga0209051_1050007 | 3300025303 | Bacteria | 1403 |
| 100 | Ga0209257_1009385 | 3300025304 | Bacteria | 5261 |
| 101 | Ga0207697_10000837 | 3300025315 | Bacteria | 17422 |
| 102 | Ga0207682_10003071 | 3300025893 | Bacteria | 7331 |
| 103 | Ga0207682_10014238 | 3300025893 | Bacteria | 3098 |
| 104 | Ga0207682_10139897 | 3300025893 | Bacteria | 1086 |
| 105 | Ga0207710_10008191 | 3300025900 | Bacteria | 4411 |
| 106 | Ga0207645_10036118 | 3300025907 | Bacteria | 3173 |
| 107 | Ga0207657_10001193 | 3300025919 | Bacteria | 27632 |
| 108 | Ga0207649_10068763 | 3300025920 | Bacteria | 2253 |
| 109 | Ga0207681_10001762 | 3300025923 | Bacteria | 13898 |
| 110 | Ga0207650_10006037 | 3300025925 | Bacteria | 8264 |
| 111 | Ga0207650_10006510 | 3300025925 | Bacteria | 7962 |
| 112 | Ga0207650_10062008 | 3300025925 | Bacteria | 2793 |
| 113 | Ga0207659_10001025 | 3300025926 | Bacteria | 16614 |
| 114 | Ga0207659_10006342 | 3300025926 | Bacteria | 7241 |
| 115 | Ga0207687_10090802 | 3300025927 | Bacteria | 2227 |
| 116 | Ga0207687_10285161 | 3300025927 | Bacteria | 1325 |
| 117 | Ga0207644_10026854 | 3300025931 | Bacteria | 3974 |
| 118 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 119 | Ga0207690_10000033 | 3300025932 | Bacteria | 149705 |
| 120 | Ga0207690_10355366 | 3300025932 | Bacteria | 1159 |
| 121 | Ga0207706_10002424 | 3300025933 | Bacteria | 18204 |
| 122 | Ga0207706_10036474 | 3300025933 | Bacteria | 4367 |
| 123 | Ga0207706_10142193 | 3300025933 | Bacteria | 2111 |
| 124 | Ga0207669_10042823 | 3300025937 | Bacteria | 2646 |
| 125 | Ga0207679_10067078 | 3300025945 | Bacteria | 2691 |
| 126 | Ga0207651_10010425 | 3300025960 | Bacteria | 5152 |
| 127 | Ga0207712_10000049 | 3300025961 | Bacteria | 160026 |
| 128 | Ga0207668_10000870 | 3300025972 | Bacteria | 18225 |
| 129 | Ga0207640_10070132 | 3300025981 | Bacteria | 2356 |
| 130 | Ga0207677_10000043 | 3300026023 | Bacteria | 110161 |
| 131 | Ga0207678_10014976 | 3300026067 | Bacteria | 6823 |
| 132 | Ga0207641_10007896 | 3300026088 | Bacteria | 8825 |
| 133 | Ga0207641_10060208 | 3300026088 | Bacteria | 3236 |
| 134 | Ga0207676_10049218 | 3300026095 | Bacteria | 3277 |
| 135 | Ga0207676_10050890 | 3300026095 | Bacteria | 3232 |
| 136 | Ga0209281_1000110 | 3300027111 | Bacteria | 215631 |
| 137 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 138 | Ga0209371_1001310 | 3300027312 | Bacteria | 17417 |
| 139 | Ga0209813_10000034 | 3300027866 | Bacteria | 61259 |
| 140 | Ga0268266_10000118 | 3300028379 | Bacteria | 163466 |
| 141 | Ga0268265_10000113 | 3300028380 | Bacteria | 101546 |
| 142 | Ga0268265_10013294 | 3300028380 | Bacteria | 5593 |
| 143 | Ga0268265_10430270 | 3300028380 | Bacteria | 1228 |
| 144 | Ga0268264_10009791 | 3300028381 | Bacteria | 7932 |
| 145 | Ga0268264_10290645 | 3300028381 | Bacteria | 1535 |
| 146 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 147 | Ga0268256_1008922 | 3300030500 | Bacteria | 3384 |
| 148 | Ga0307513_10016058 | 3300031456 | Bacteria | 9048 |
| 149 | Ga0307513_10065093 | 3300031456 | Bacteria | 3836 |
| 150 | Ga0307405_10008880 | 3300031731 | Bacteria | 5124 |
| 151 | Ga0307405_10053886 | 3300031731 | Bacteria | 2508 |
| 152 | Ga0307405_10150186 | 3300031731 | Bacteria | 1637 |
| 153 | Ga0307413_10002762 | 3300031824 | Bacteria | 7224 |
| 154 | Ga0307413_10166334 | 3300031824 | Bacteria | 1556 |
| 155 | Ga0307410_10010005 | 3300031852 | Bacteria | 5351 |
| 156 | Ga0307410_10202632 | 3300031852 | Bacteria | 1516 |
| 157 | Ga0307406_10095785 | 3300031901 | Bacteria | 2009 |
| 158 | Ga0307407_10113662 | 3300031903 | Bacteria | 1704 |
| 159 | Ga0307412_10090620 | 3300031911 | Bacteria | 2138 |
| 160 | Ga0307409_100005087 | 3300031995 | Bacteria | 7501 |
| 161 | Ga0307409_100059207 | 3300031995 | Bacteria | 2980 |
| 162 | Ga0307416_100101979 | 3300032002 | Bacteria | 2501 |
| 163 | Ga0307416_100236778 | 3300032002 | Bacteria | 1765 |
| 164 | Ga0307416_100321384 | 3300032002 | Bacteria | 1550 |
| 165 | Ga0307414_10017063 | 3300032004 | Bacteria | 4433 |
| 166 | Ga0307414_10095432 | 3300032004 | Bacteria | 2222 |
| 167 | Ga0307411_10004993 | 3300032005 | Bacteria | 6451 |
| 168 | Ga0307415_100039871 | 3300032126 | Bacteria | 3108 |
| 169 | Ga0307415_100166268 | 3300032126 | Bacteria | 1715 |
| 170 | Ga0436365_1785712 | 3300039437 | Bacteria | 1231 |
| 171 | Ga0451833_0464765 | 3300041491 | Bacteria | 5110 |
| 172 | Ga0451835_0209279 | 3300041492 | Bacteria | 1855 |
| 173 | Ga0451837_0875839 | 3300041494 | Bacteria | 3046 |
| 174 | Ga0451849_0260183 | 3300041505 | Bacteria | 3324 |
| 175 | Ga0451843_0275338 | 3300041509 | Bacteria | 3267 |
| 176 | Ga0451855_0167445 | 3300041511 | Bacteria | 6875 |
| 177 | Ga0451853_0224927 | 3300041512 | Bacteria | 3433 |
| 178 | Ga0439445_0003025 | 3300042004 | Bacteria | 3764 |
| 179 | Ga0439448_0036062 | 3300042005 | Bacteria | 1585 |
| 180 | Ga0439454_007687 | 3300042011 | Bacteria | 1357 |
| 181 | Ga0439455_0000153 | 3300042012 | Bacteria | 7607 |
| 182 | Ga0439458_0001828 | 3300042157 | Bacteria | 5295 |
| 183 | Ga0439458_0011668 | 3300042157 | Bacteria | 1966 |
| 184 | Ga0439464_0088565 | 3300042439 | Bacteria | 931 |
| 185 | Ga0495617_007630 | 3300046452 | Bacteria | 3747 |
| 186 | Ga0495627_000459 | 3300046453 | Bacteria | 35376 |
| 187 | Ga0495627_000503 | 3300046453 | Bacteria | 32725 |
| 188 | Ga0495584_0013745 | 3300046491 | Bacteria | 4129 |
| 189 | Ga0495585_0097846 | 3300046492 | Bacteria | 1573 |
| 190 | Ga0495607_0006848 | 3300046501 | Bacteria | 7953 |
| 191 | Ga0495583_0004105 | 3300046506 | Bacteria | 10681 |
| 192 | Ga0495610_0000043 | 3300046512 | Bacteria | 158045 |
| 193 | Ga0495632_0000048 | 3300046519 | Bacteria | 137883 |
| 194 | Ga0495632_0061819 | 3300046519 | Bacteria | 1817 |
| 195 | Ga0495637_0001256 | 3300046520 | Bacteria | 15302 |
| 196 | Ga0495637_0002774 | 3300046520 | Bacteria | 9507 |
| 197 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 198 | Ga0495648_0009768 | 3300046524 | Bacteria | 7391 |
| 199 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 200 | Ga0495663_0001552 | 3300046525 | Bacteria | 7201 |
| 201 | Ga0495663_0027438 | 3300046525 | Bacteria | 1671 |
| 202 | Ga0495633_0000211 | 3300046558 | Bacteria | 73547 |
| 203 | Ga0495633_0000215 | 3300046558 | Bacteria | 72445 |
| 204 | Ga0495633_0017847 | 3300046558 | Bacteria | 3615 |
| 205 | Ga0495633_0022300 | 3300046558 | Bacteria | 3154 |
| 206 | Ga0495633_0102031 | 3300046558 | Bacteria | 1332 |
| 207 | Ga0495633_0117710 | 3300046558 | Bacteria | 1231 |
| 208 | Ga0495625_0057763 | 3300046660 | Bacteria | 2758 |
| 209 | Ga0495659_0004913 | 3300046664 | Bacteria | 4207 |
| 210 | Ga0495661_0094489 | 3300046665 | Bacteria | 1695 |
| 211 | Ga0495670_0043662 | 3300046691 | Bacteria | 2237 |
| 212 | Ga0495670_0129625 | 3300046691 | Bacteria | 1314 |
| 213 | Ga0495671_0000043 | 3300046692 | Bacteria | 163036 |
| 214 | Ga0495677_0014104 | 3300047445 | Bacteria | 2911 |
| 215 | Ga0495681_0000025 | 3300047470 | Bacteria | 148216 |
| 216 | Ga0495681_0005953 | 3300047470 | Bacteria | 8089 |
| 217 | Ga0495686_0036570 | 3300047472 | Bacteria | 3151 |
| 218 | Ga0496106_0002403 | 3300048909 | Bacteria | 13950 |
| 219 | Ga0496111_0001989 | 3300048914 | Bacteria | 12152 |
| 220 | Ga0496115_0121618 | 3300048918 | Bacteria | 2148 |
| 221 | Ga0496121_0011350 | 3300048924 | Bacteria | 9904 |
| 222 | Ga0496121_0028426 | 3300048924 | Bacteria | 5204 |
| 223 | Ga0496121_0267388 | 3300048924 | Bacteria | 1177 |
| 224 | Ga0496123_0006828 | 3300048926 | Bacteria | 10950 |
| 225 | Ga0496124_0071625 | 3300048927 | Bacteria | 2872 |
| 226 | Ga0496124_0127473 | 3300048927 | Bacteria | 2026 |
| 227 | Ga0496126_0080255 | 3300048929 | Bacteria | 2887 |
| 228 | nmdc:mga03n38_22034_c1 | 3300050490 | Bacteria | 2572 |
| 229 | nmdc:mga06z11_4_c1 | 3300050494 | Bacteria | 131352 |
| 230 | nmdc:mga04h51_7_c1 | 3300050495 | Bacteria | 109425 |
| 231 | nmdc:mga08y16_128747_c1 | 3300050511 | Bacteria | 2633 |
| 232 | nmdc:mga0n895_160861_c1 | 3300050512 | Bacteria | 2277 |
| 233 | Ga0500562_012809 | 3300053108 | Bacteria | 2135 |
| 234 | Ga0500608_000685 | 3300053122 | Bacteria | 12409 |
| 235 | Ga0500618_000402 | 3300053125 | Bacteria | 29508 |
| 236 | Ga0500658_0012956 | 3300053134 | Bacteria | 3080 |
| 237 | Ga0500568_0001141 | 3300053139 | Bacteria | 17815 |
| 238 | Ga0500622_0066586 | 3300053156 | Bacteria | 1829 |
| 239 | Ga0500633_0000181 | 3300053160 | Bacteria | 8695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_160861_c1 | nmdc:mga0n895_160861_c1_1391_2251 | 286 |
| 2 | 3300042439 | Ga0439464_0088565 | Ga0439464_0088565_35_904 | 289 |
| 3 | iso_pu_bacteria | 2599185210 | 2599606107 | 294 |
| 4 | 3300017792 | Ga0163161_10064338 | Ga0163161_100643383 | 297 |
| 5 | 3300048924 | Ga0496121_0267388 | Ga0496121_0267388_191_1108 | 297 |
| 6 | 3300031456 | Ga0307513_10016058 | Ga0307513_100160586 | 304 |
| 7 | 3300005617 | Ga0068859_100400125 | Ga0068859_1004001252 | 308 |
| 8 | 3300005843 | Ga0068860_100230896 | Ga0068860_1002308962 | 308 |
| 9 | 3300006931 | Ga0097620_100400200 | Ga0097620_1004002002 | 308 |
| 10 | 3300028380 | Ga0268265_10430270 | Ga0268265_104302702 | 308 |
| 11 | 3300028381 | Ga0268264_10290645 | Ga0268264_102906452 | 308 |
| 12 | 3300041491 | Ga0451833_0464765 | Ga0451833_0464765_686_1651 | 308 |
| 13 | 3300041494 | Ga0451837_0875839 | Ga0451837_0875839_1782_2747 | 308 |
| 14 | 3300041505 | Ga0451849_0260183 | Ga0451849_0260183_535_1500 | 308 |
| 15 | 3300041509 | Ga0451843_0275338 | Ga0451843_0275338_411_1376 | 308 |
| 16 | 3300041511 | Ga0451855_0167445 | Ga0451855_0167445_1802_2767 | 308 |
| 17 | 3300041512 | Ga0451853_0224927 | Ga0451853_0224927_411_1376 | 308 |
| 18 | iso_pu_bacteria | 2842304105 | 2842311121 | 314 |
| 19 | iso_pu_bacteria | 2513237159 | 2514002269 | 317 |
| 20 | iso_pu_bacteria | 2517093000 | 2517099774 | 317 |
| 21 | iso_pu_bacteria | 2582581299 | 2585233559 | 317 |
| 22 | iso_pu_bacteria | 2582581866 | 2585393418 | 317 |
| 23 | iso_pu_bacteria | 2599185156 | 2599336272 | 317 |
| 24 | iso_pu_bacteria | 2599185236 | 2599718234 | 317 |
| 25 | iso_pu_bacteria | 2600254933 | 2600375069 | 317 |
| 26 | iso_pu_bacteria | 2643221723 | 2644672429 | 317 |
| 27 | iso_pu_bacteria | 2818991439 | 2819561247 | 317 |
| 28 | iso_pu_bacteria | 2818991439 | 2819562132 | 317 |
| 29 | iso_pu_bacteria | 2821123053 | 2821126436 | 317 |
| 30 | iso_pu_bacteria | 2838736955 | 2838737088 | 317 |
| 31 | iso_pu_bacteria | 2841840854 | 2841842543 | 317 |
| 32 | iso_pu_bacteria | 2842140634 | 2842142323 | 317 |
| 33 | iso_pu_bacteria | 2842521101 | 2842525034 | 317 |
| 34 | iso_pu_bacteria | 2842922631 | 2842927964 | 317 |
| 35 | iso_pu_bacteria | 2842922631 | 2842928141 | 317 |
| 36 | iso_pu_bacteria | 2854896431 | 2854900152 | 317 |
| 37 | iso_pu_bacteria | 2857516855 | 2857521381 | 317 |
| 38 | iso_pu_bacteria | 2857531043 | 2857532998 | 317 |
| 39 | iso_pu_bacteria | 2857531043 | 2857533325 | 317 |
| 40 | iso_pu_bacteria | 2923556063 | 2923560251 | 317 |
| 41 | iso_pu_bacteria | 2936367885 | 2936372999 | 317 |
| 42 | iso_pu_bacteria | 2936375103 | 2936381151 | 317 |
| 43 | iso_pu_bacteria | 2941499720 | 2941506672 | 317 |
| 44 | iso_pu_bacteria | 2954011201 | 2954011705 | 317 |
| 45 | iso_pu_bacteria | 2979100975 | 2979101851 | 317 |
| 46 | iso_pu_bacteria | 2979100975 | 2979103225 | 317 |
| 47 | iso_pu_bacteria | 2984509177 | 2984510217 | 317 |
| 48 | iso_pu_bacteria | 2984509177 | 2984514090 | 317 |
| 49 | iso_pu_bacteria | 2984518228 | 2984519079 | 317 |
| 50 | iso_pu_bacteria | 2984518228 | 2984523121 | 317 |
| 51 | iso_pu_bacteria | 2984537506 | 2984538562 | 317 |
| 52 | iso_pu_bacteria | 2984537506 | 2984542342 | 317 |
| 53 | iso_pu_bacteria | 2984601300 | 2984605272 | 317 |
| 54 | iso_pu_bacteria | 2984601300 | 2984606343 | 317 |
| 55 | iso_pu_bacteria | 3005409236 | 3005409853 | 317 |
| 56 | iso_pu_bacteria | 8005376324 | 8005378923 | 317 |
| 57 | iso_pu_bacteria | 8023680758 | 8023685670 | 317 |
| 58 | iso_pu_bacteria | 8054460903 | 8054465518 | 317 |
| 59 | iso_pu_bacteria | 8056875544 | 8056879923 | 317 |
| 60 | iso_pu_bacteria | 2512564014 | 2512642656 | 318 |
| 61 | iso_pu_bacteria | 2808606401 | 2809062517 | 318 |
| 62 | iso_pu_bacteria | 2808606404 | 2809078143 | 318 |
| 63 | iso_pu_bacteria | 2808606405 | 2809082906 | 318 |
| 64 | iso_pu_bacteria | 2880518877 | 2880522222 | 318 |
| 65 | iso_pu_bacteria | 2919709256 | 2919709806 | 318 |
| 66 | iso_pu_bacteria | 2946787523 | 2946788088 | 318 |
| 67 | 3300002987 | JGI25159J45721_1000012 | JGI25159J45721_1000012103 | 321 |
| 68 | 3300003187 | JGI25151J46595_10026212 | JGI25151J46595_100262122 | 321 |
| 69 | 3300003323 | rootH1_10026045 | rootH1_100260456 | 321 |
| 70 | 3300003354 | JGI25160J50197_1000042 | JGI25160J50197_100004251 | 321 |
| 71 | 3300003374 | JGI25161J50226_1000210 | JGI25161J50226_100021025 | 321 |
| 72 | 3300003771 | Ga0055526_1000834 | Ga0055526_10008347 | 321 |
| 73 | 3300003781 | Ga0055536_1002660 | Ga0055536_10026601 | 321 |
| 74 | 3300004625 | Ga0055543_1000123 | Ga0055543_100012351 | 321 |
| 75 | 3300005262 | Ga0065165_1000174 | Ga0065165_1000174103 | 321 |
| 76 | 3300005262 | Ga0065165_1018856 | Ga0065165_10188562 | 321 |
| 77 | 3300013104 | Ga0157370_10052632 | Ga0157370_100526322 | 321 |
| 78 | 3300013105 | Ga0157369_10020532 | Ga0157369_100205324 | 321 |
| 79 | 3300013105 | Ga0157369_10035368 | Ga0157369_100353684 | 321 |
| 80 | 3300025208 | Ga0209436_100140 | Ga0209436_10014035 | 321 |
| 81 | 3300025245 | Ga0207425_1013753 | Ga0207425_10137532 | 321 |
| 82 | 3300025284 | Ga0209130_1000075 | Ga0209130_100007554 | 321 |
| 83 | 3300025284 | Ga0209130_1025642 | Ga0209130_10256421 | 321 |
| 84 | 3300025292 | Ga0209676_1003221 | Ga0209676_10032214 | 321 |
| 85 | 3300025294 | Ga0209025_1001974 | Ga0209025_10019742 | 321 |
| 86 | 3300025295 | Ga0209564_1000278 | Ga0209564_100027848 | 321 |
| 87 | 3300025297 | Ga0209758_1023202 | Ga0209758_10232023 | 321 |
| 88 | 3300025298 | Ga0209050_1003053 | Ga0209050_10030538 | 321 |
| 89 | 3300025299 | Ga0209256_1000411 | Ga0209256_100041124 | 321 |
| 90 | 3300025302 | Ga0207426_1000163 | Ga0207426_100016354 | 321 |
| 91 | 3300025302 | Ga0207426_1000745 | Ga0207426_100074515 | 321 |
| 92 | 3300025303 | Ga0209051_1050007 | Ga0209051_10500071 | 321 |
| 93 | 3300025304 | Ga0209257_1009385 | Ga0209257_10093851 | 321 |
| 94 | 3300027111 | Ga0209281_1000110 | Ga0209281_1000110183 | 321 |
| 95 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035231 | 321 |
| 96 | 3300027312 | Ga0209371_1001310 | Ga0209371_100131010 | 321 |
| 97 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037230 | 321 |
| 98 | 3300030500 | Ga0268256_1008922 | Ga0268256_10089223 | 321 |
| 99 | 3300031731 | Ga0307405_10008880 | Ga0307405_100088802 | 321 |
| 100 | 3300031731 | Ga0307405_10150186 | Ga0307405_101501862 | 321 |
| 101 | 3300031824 | Ga0307413_10166334 | Ga0307413_101663342 | 321 |
| 102 | 3300031911 | Ga0307412_10090620 | Ga0307412_100906202 | 321 |
| 103 | 3300032002 | Ga0307416_100236778 | Ga0307416_1002367782 | 321 |
| 104 | 3300032126 | Ga0307415_100166268 | Ga0307415_1001662682 | 321 |
| 105 | 3300041492 | Ga0451835_0209279 | Ga0451835_0209279_811_1776 | 321 |
| 106 | 3300046492 | Ga0495585_0097846 | Ga0495585_0097846_548_1513 | 321 |
| 107 | 3300046506 | Ga0495583_0004105 | Ga0495583_0004105_3236_4219 | 321 |
| 108 | 3300046519 | Ga0495632_0061819 | Ga0495632_0061819_836_1801 | 321 |
| 109 | 3300046558 | Ga0495633_0102031 | Ga0495633_0102031_292_1257 | 321 |
| 110 | 3300048909 | Ga0496106_0002403 | Ga0496106_0002403_7779_8744 | 321 |
| 111 | 3300048914 | Ga0496111_0001989 | Ga0496111_0001989_2336_3301 | 321 |
| 112 | 3300048924 | Ga0496121_0011350 | Ga0496121_0011350_4289_5254 | 321 |
| 113 | 3300048924 | Ga0496121_0028426 | Ga0496121_0028426_423_1388 | 321 |
| 114 | 3300048926 | Ga0496123_0006828 | Ga0496123_0006828_9570_10535 | 321 |
| 115 | 3300048927 | Ga0496124_0071625 | Ga0496124_0071625_388_1368 | 321 |
| 116 | 3300048927 | Ga0496124_0127473 | Ga0496124_0127473_674_1639 | 321 |
| 117 | 3300048929 | Ga0496126_0080255 | Ga0496126_0080255_300_1265 | 321 |
| 118 | 3300053125 | Ga0500618_000402 | Ga0500618_000402_15227_16192 | 321 |
| 119 | 3300053134 | Ga0500658_0012956 | Ga0500658_0012956_1550_2515 | 321 |
| 120 | 3300053139 | Ga0500568_0001141 | Ga0500568_0001141_4665_5630 | 321 |
| 121 | 3300053160 | Ga0500633_0000181 | Ga0500633_0000181_1740_2705 | 321 |
| 122 | iso_pu_bacteria | 2933570622 | 2933577498 | 321 |
| 123 | 2162886012 | MBSR1b_contig_212945 | MBSR1b_0296.00006600 | 322 |
| 124 | 2162886012 | MBSR1b_contig_7766768 | MBSR1b_0378.00006560 | 322 |
| 125 | 3300001989 | JGI24739J22299_10029751 | JGI24739J22299_100297513 | 322 |
| 126 | 3300002239 | JGI24034J26672_10002332 | JGI24034J26672_100023322 | 322 |
| 127 | 3300002244 | JGI24742J22300_10004332 | JGI24742J22300_100043322 | 322 |
| 128 | 3300005290 | Ga0065712_10096323 | Ga0065712_100963232 | 322 |
| 129 | 3300005293 | Ga0065715_10098526 | Ga0065715_100985262 | 322 |
| 130 | 3300005295 | Ga0065707_10132074 | Ga0065707_101320743 | 322 |
| 131 | 3300005295 | Ga0065707_10155045 | Ga0065707_101550451 | 322 |
| 132 | 3300005328 | Ga0070676_10083455 | Ga0070676_100834552 | 322 |
| 133 | 3300005331 | Ga0070670_100019927 | Ga0070670_1000199273 | 322 |
| 134 | 3300005331 | Ga0070670_100026918 | Ga0070670_1000269183 | 322 |
| 135 | 3300005333 | Ga0070677_10001278 | Ga0070677_100012782 | 322 |
| 136 | 3300005333 | Ga0070677_10011230 | Ga0070677_100112303 | 322 |
| 137 | 3300005333 | Ga0070677_10149240 | Ga0070677_101492401 | 322 |
| 138 | 3300005338 | Ga0068868_100000006 | Ga0068868_10000000617 | 322 |
| 139 | 3300005339 | Ga0070660_100000448 | Ga0070660_10000044817 | 322 |
| 140 | 3300005347 | Ga0070668_100036110 | Ga0070668_1000361102 | 322 |
| 141 | 3300005347 | Ga0070668_100151724 | Ga0070668_1001517242 | 322 |
| 142 | 3300005347 | Ga0070668_100197877 | Ga0070668_1001978771 | 322 |
| 143 | 3300005353 | Ga0070669_100016851 | Ga0070669_1000168515 | 322 |
| 144 | 3300005354 | Ga0070675_100007206 | Ga0070675_1000072064 | 322 |
| 145 | 3300005354 | Ga0070675_100009549 | Ga0070675_1000095494 | 322 |
| 146 | 3300005354 | Ga0070675_100030882 | Ga0070675_1000308822 | 322 |
| 147 | 3300005355 | Ga0070671_100037218 | Ga0070671_1000372182 | 322 |
| 148 | 3300005355 | Ga0070671_100039683 | Ga0070671_1000396831 | 322 |
| 149 | 3300005355 | Ga0070671_100155318 | Ga0070671_1001553182 | 322 |
| 150 | 3300005356 | Ga0070674_100036180 | Ga0070674_1000361802 | 322 |
| 151 | 3300005364 | Ga0070673_100020951 | Ga0070673_1000209512 | 322 |
| 152 | 3300005366 | Ga0070659_100000005 | Ga0070659_100000005118 | 322 |
| 153 | 3300005438 | Ga0070701_10072544 | Ga0070701_100725441 | 322 |
| 154 | 3300005456 | Ga0070678_100027699 | Ga0070678_1000276995 | 322 |
| 155 | 3300005457 | Ga0070662_100005727 | Ga0070662_1000057277 | 322 |
| 156 | 3300005539 | Ga0068853_100083069 | Ga0068853_1000830692 | 322 |
| 157 | 3300005539 | Ga0068853_100227757 | Ga0068853_1002277572 | 322 |
| 158 | 3300005543 | Ga0070672_100436059 | Ga0070672_1004360592 | 322 |
| 159 | 3300005544 | Ga0070686_100001878 | Ga0070686_10000187811 | 322 |
| 160 | 3300005544 | Ga0070686_100067416 | Ga0070686_1000674161 | 322 |
| 161 | 3300005548 | Ga0070665_100000038 | Ga0070665_100000038163 | 322 |
| 162 | 3300005564 | Ga0070664_100101284 | Ga0070664_1001012842 | 322 |
| 163 | 3300005578 | Ga0068854_100065327 | Ga0068854_1000653272 | 322 |
| 164 | 3300005617 | Ga0068859_100004778 | Ga0068859_1000047782 | 322 |
| 165 | 3300005618 | Ga0068864_100011441 | Ga0068864_1000114412 | 322 |
| 166 | 3300005618 | Ga0068864_100062643 | Ga0068864_1000626432 | 322 |
| 167 | 3300005718 | Ga0068866_10100736 | Ga0068866_101007362 | 322 |
| 168 | 3300005719 | Ga0068861_100108314 | Ga0068861_1001083142 | 322 |
| 169 | 3300005840 | Ga0068870_10137175 | Ga0068870_101371752 | 322 |
| 170 | 3300005841 | Ga0068863_100008473 | Ga0068863_1000084736 | 322 |
| 171 | 3300005841 | Ga0068863_100045965 | Ga0068863_1000459653 | 322 |
| 172 | 3300005843 | Ga0068860_100013059 | Ga0068860_1000130594 | 322 |
| 173 | 3300005843 | Ga0068860_100069207 | Ga0068860_1000692072 | 322 |
| 174 | 3300005844 | Ga0068862_100000074 | Ga0068862_10000007460 | 322 |
| 175 | 3300005844 | Ga0068862_100020793 | Ga0068862_1000207935 | 322 |
| 176 | 3300006178 | Ga0075367_10000044 | Ga0075367_100000444 | 322 |
| 177 | 3300006844 | Ga0075428_100149850 | Ga0075428_1001498502 | 322 |
| 178 | 3300006931 | Ga0097620_100004778 | Ga0097620_1000047782 | 322 |
| 179 | 3300009098 | Ga0105245_10015502 | Ga0105245_100155026 | 322 |
| 180 | 3300009101 | Ga0105247_10016490 | Ga0105247_100164904 | 322 |
| 181 | 3300009553 | Ga0105249_10000167 | Ga0105249_1000016768 | 322 |
| 182 | 3300009553 | Ga0105249_10037701 | Ga0105249_100377013 | 322 |
| 183 | 3300013100 | Ga0157373_10050737 | Ga0157373_100507371 | 322 |
| 184 | 3300013102 | Ga0157371_10176204 | Ga0157371_101762042 | 322 |
| 185 | 3300013307 | Ga0157372_10075574 | Ga0157372_100755743 | 322 |
| 186 | 3300013307 | Ga0157372_10618789 | Ga0157372_106187892 | 322 |
| 187 | 3300014326 | Ga0157380_10026698 | Ga0157380_100266985 | 322 |
| 188 | 3300014326 | Ga0157380_10056460 | Ga0157380_100564602 | 322 |
| 189 | 3300014326 | Ga0157380_10331810 | Ga0157380_103318102 | 322 |
| 190 | 3300017792 | Ga0163161_10097874 | Ga0163161_100978742 | 322 |
| 191 | 3300025229 | Ga0209147_101666 | Ga0209147_1016666 | 322 |
| 192 | 3300025315 | Ga0207697_10000837 | Ga0207697_1000083717 | 322 |
| 193 | 3300025893 | Ga0207682_10003071 | Ga0207682_100030717 | 322 |
| 194 | 3300025893 | Ga0207682_10014238 | Ga0207682_100142382 | 322 |
| 195 | 3300025893 | Ga0207682_10139897 | Ga0207682_101398971 | 322 |
| 196 | 3300025900 | Ga0207710_10008191 | Ga0207710_100081911 | 322 |
| 197 | 3300025907 | Ga0207645_10036118 | Ga0207645_100361182 | 322 |
| 198 | 3300025919 | Ga0207657_10001193 | Ga0207657_1000119317 | 322 |
| 199 | 3300025920 | Ga0207649_10068763 | Ga0207649_100687632 | 322 |
| 200 | 3300025923 | Ga0207681_10001762 | Ga0207681_1000176213 | 322 |
| 201 | 3300025925 | Ga0207650_10006037 | Ga0207650_100060372 | 322 |
| 202 | 3300025925 | Ga0207650_10006510 | Ga0207650_100065102 | 322 |
| 203 | 3300025925 | Ga0207650_10062008 | Ga0207650_100620083 | 322 |
| 204 | 3300025926 | Ga0207659_10001025 | Ga0207659_100010252 | 322 |
| 205 | 3300025926 | Ga0207659_10006342 | Ga0207659_100063424 | 322 |
| 206 | 3300025927 | Ga0207687_10090802 | Ga0207687_100908023 | 322 |
| 207 | 3300025927 | Ga0207687_10285161 | Ga0207687_102851612 | 322 |
| 208 | 3300025931 | Ga0207644_10026854 | Ga0207644_100268542 | 322 |
| 209 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002763 | 322 |
| 210 | 3300025932 | Ga0207690_10000033 | Ga0207690_10000033118 | 322 |
| 211 | 3300025932 | Ga0207690_10355366 | Ga0207690_103553661 | 322 |
| 212 | 3300025933 | Ga0207706_10002424 | Ga0207706_100024242 | 322 |
| 213 | 3300025933 | Ga0207706_10036474 | Ga0207706_100364742 | 322 |
| 214 | 3300025933 | Ga0207706_10142193 | Ga0207706_101421932 | 322 |
| 215 | 3300025937 | Ga0207669_10042823 | Ga0207669_100428232 | 322 |
| 216 | 3300025945 | Ga0207679_10067078 | Ga0207679_100670782 | 322 |
| 217 | 3300025960 | Ga0207651_10010425 | Ga0207651_100104252 | 322 |
| 218 | 3300025961 | Ga0207712_10000049 | Ga0207712_1000004960 | 322 |
| 219 | 3300025972 | Ga0207668_10000870 | Ga0207668_100008702 | 322 |
| 220 | 3300025981 | Ga0207640_10070132 | Ga0207640_100701322 | 322 |
| 221 | 3300026023 | Ga0207677_10000043 | Ga0207677_100000433 | 322 |
| 222 | 3300026067 | Ga0207678_10014976 | Ga0207678_100149767 | 322 |
| 223 | 3300026088 | Ga0207641_10007896 | Ga0207641_100078962 | 322 |
| 224 | 3300026088 | Ga0207641_10060208 | Ga0207641_100602083 | 322 |
| 225 | 3300026095 | Ga0207676_10049218 | Ga0207676_100492182 | 322 |
| 226 | 3300026095 | Ga0207676_10050890 | Ga0207676_100508903 | 322 |
| 227 | 3300027866 | Ga0209813_10000034 | Ga0209813_1000003427 | 322 |
| 228 | 3300028379 | Ga0268266_10000118 | Ga0268266_1000011882 | 322 |
| 229 | 3300028380 | Ga0268265_10000113 | Ga0268265_1000011375 | 322 |
| 230 | 3300028380 | Ga0268265_10013294 | Ga0268265_100132942 | 322 |
| 231 | 3300028381 | Ga0268264_10009791 | Ga0268264_100097913 | 322 |
| 232 | 3300031456 | Ga0307513_10065093 | Ga0307513_100650934 | 322 |
| 233 | 3300031731 | Ga0307405_10053886 | Ga0307405_100538862 | 322 |
| 234 | 3300031824 | Ga0307413_10002762 | Ga0307413_100027627 | 322 |
| 235 | 3300031852 | Ga0307410_10010005 | Ga0307410_100100054 | 322 |
| 236 | 3300031852 | Ga0307410_10202632 | Ga0307410_102026322 | 322 |
| 237 | 3300031901 | Ga0307406_10095785 | Ga0307406_100957852 | 322 |
| 238 | 3300031903 | Ga0307407_10113662 | Ga0307407_101136622 | 322 |
| 239 | 3300031995 | Ga0307409_100005087 | Ga0307409_1000050876 | 322 |
| 240 | 3300031995 | Ga0307409_100059207 | Ga0307409_1000592075 | 322 |
| 241 | 3300032002 | Ga0307416_100101979 | Ga0307416_1001019792 | 322 |
| 242 | 3300032002 | Ga0307416_100321384 | Ga0307416_1003213842 | 322 |
| 243 | 3300032004 | Ga0307414_10017063 | Ga0307414_100170636 | 322 |
| 244 | 3300032004 | Ga0307414_10095432 | Ga0307414_100954322 | 322 |
| 245 | 3300032005 | Ga0307411_10004993 | Ga0307411_100049937 | 322 |
| 246 | 3300032126 | Ga0307415_100039871 | Ga0307415_1000398711 | 322 |
| 247 | 3300039437 | Ga0436365_1785712 | Ga0436365_1785712_82_1128 | 322 |
| 248 | 3300042004 | Ga0439445_0003025 | Ga0439445_0003025_1219_2187 | 322 |
| 249 | 3300042005 | Ga0439448_0036062 | Ga0439448_0036062_157_1125 | 322 |
| 250 | 3300042011 | Ga0439454_007687 | Ga0439454_007687_296_1264 | 322 |
| 251 | 3300042012 | Ga0439455_0000153 | Ga0439455_0000153_6418_7386 | 322 |
| 252 | 3300042157 | Ga0439458_0001828 | Ga0439458_0001828_455_1423 | 322 |
| 253 | 3300042157 | Ga0439458_0011668 | Ga0439458_0011668_389_1357 | 322 |
| 254 | 3300046452 | Ga0495617_007630 | Ga0495617_007630_1914_2882 | 322 |
| 255 | 3300046453 | Ga0495627_000459 | Ga0495627_000459_9115_10083 | 322 |
| 256 | 3300046453 | Ga0495627_000503 | Ga0495627_000503_23214_24182 | 322 |
| 257 | 3300046491 | Ga0495584_0013745 | Ga0495584_0013745_545_1609 | 322 |
| 258 | 3300046501 | Ga0495607_0006848 | Ga0495607_0006848_3843_4811 | 322 |
| 259 | 3300046512 | Ga0495610_0000043 | Ga0495610_0000043_73485_74453 | 322 |
| 260 | 3300046519 | Ga0495632_0000048 | Ga0495632_0000048_57379_58443 | 322 |
| 261 | 3300046520 | Ga0495637_0001256 | Ga0495637_0001256_12129_13193 | 322 |
| 262 | 3300046520 | Ga0495637_0002774 | Ga0495637_0002774_390_1358 | 322 |
| 263 | 3300046522 | Ga0495643_0000030 | Ga0495643_0000030_66843_67907 | 322 |
| 264 | 3300046524 | Ga0495648_0009768 | Ga0495648_0009768_2058_3026 | 322 |
| 265 | 3300046525 | Ga0495663_0000003 | Ga0495663_0000003_239831_240895 | 322 |
| 266 | 3300046525 | Ga0495663_0001552 | Ga0495663_0001552_275_1243 | 322 |
| 267 | 3300046525 | Ga0495663_0027438 | Ga0495663_0027438_178_1146 | 322 |
| 268 | 3300046558 | Ga0495633_0000211 | Ga0495633_0000211_70116_71084 | 322 |
| 269 | 3300046558 | Ga0495633_0000215 | Ga0495633_0000215_38086_39150 | 322 |
| 270 | 3300046558 | Ga0495633_0017847 | Ga0495633_0017847_2520_3488 | 322 |
| 271 | 3300046558 | Ga0495633_0022300 | Ga0495633_0022300_975_1943 | 322 |
| 272 | 3300046558 | Ga0495633_0117710 | Ga0495633_0117710_137_1105 | 322 |
| 273 | 3300046660 | Ga0495625_0057763 | Ga0495625_0057763_294_1358 | 322 |
| 274 | 3300046664 | Ga0495659_0004913 | Ga0495659_0004913_43_1011 | 322 |
| 275 | 3300046665 | Ga0495661_0094489 | Ga0495661_0094489_638_1606 | 322 |
| 276 | 3300046691 | Ga0495670_0043662 | Ga0495670_0043662_254_1222 | 322 |
| 277 | 3300046691 | Ga0495670_0129625 | Ga0495670_0129625_171_1139 | 322 |
| 278 | 3300046692 | Ga0495671_0000043 | Ga0495671_0000043_66843_67907 | 322 |
| 279 | 3300047445 | Ga0495677_0014104 | Ga0495677_0014104_1508_2476 | 322 |
| 280 | 3300047470 | Ga0495681_0000025 | Ga0495681_0000025_73260_74228 | 322 |
| 281 | 3300047470 | Ga0495681_0005953 | Ga0495681_0005953_168_1232 | 322 |
| 282 | 3300047472 | Ga0495686_0036570 | Ga0495686_0036570_2142_3110 | 322 |
| 283 | 3300048918 | Ga0496115_0121618 | Ga0496115_0121618_740_1708 | 322 |
| 284 | 3300050490 | nmdc:mga03n38_22034_c1 | nmdc:mga03n38_22034_c1_800_1768 | 322 |
| 285 | 3300050494 | nmdc:mga06z11_4_c1 | nmdc:mga06z11_4_c1_25856_26824 | 322 |
| 286 | 3300050495 | nmdc:mga04h51_7_c1 | nmdc:mga04h51_7_c1_81169_82137 | 322 |
| 287 | 3300050511 | nmdc:mga08y16_128747_c1 | nmdc:mga08y16_128747_c1_937_1905 | 322 |
| 288 | 3300053108 | Ga0500562_012809 | Ga0500562_012809_36_1004 | 322 |
| 289 | 3300053122 | Ga0500608_000685 | Ga0500608_000685_2635_3603 | 322 |
| 290 | 3300053156 | Ga0500622_0066586 | Ga0500622_0066586_383_1351 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jcf-assembly1.cif.gz_A | cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state | 0.8764 | 3 | 322 |
| 5yny-assembly1.cif.gz_A | structure of house dust mite allergen der f 21 in peg2kmme | 0.8743 | 137 | 246 |
| 2bbj-assembly1.cif.gz_F | crystal structure of the cora mg2+ transporter | 0.869 | 3 | 318 |
| 3jcf-assembly1.cif.gz_A | cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state | 0.8688 | 3 | 322 |
| 4eeb-assembly1.cif.gz_C | cora coiled-coil mutant under mg2+ absence | 0.8685 | 6 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50455_48_179_3.30.460.20 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like | 0.9493 | 33 | 129 | 3.30.460.20 |
| 4ev6A02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.948 | 135 | 262 | 1.20.58.340 |
| 4i0uI02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.941 | 136 | 243 | 1.20.58.340 |
| 4i0uJ02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9409 | 137 | 243 | 1.20.58.340 |
| 4i0uB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9401 | 136 | 243 | 1.20.58.340 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JCN4-F1-model_v4 | Magnesium transporter | 0.9857 | 1 | 225 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A520JCN4-F1-model_v4 | Magnesium transporter | 0.9771 | 1 | 225 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A3S4DGT1-F1-model_v4 | Magnesium transport protein CorA | 0.9506 | 2 | 322 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-F8UGV9-F1-model_v4 | Metal ion transport protein | 0.9478 | 3 | 285 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A529YH66-F1-model_v4 | Magnesium transporter | 0.9476 | 3 | 192 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar