F389901

General Info

Members Datasets Scaffolds Average Seq Length
290 210 239 321

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0464765|Ga0451833_0464765_686_1651
Length 308
Sequence MTVIASYIYRNGKRAEEVALQSQSFATRDGEFVWIGLAEPTSDEMDSLKMMFGLHPLAVEDALNGQQVPKVDVYGDQLFVVIKTAHLEGDKIAYGETCIFVGKHHLISVRHGSAKSHKGLREQLEHSPIIDFVVDGYLPMVETMEDRVLELEKHVLISFLEREQIRRIFRMRRQVIKFQRVLGPMSEVVGKLTHLDLPCVDENSKPFFRDVHDHVRRVESVVGGLRDIITSVFEASNLLEQQRQGTITRQLAAWAAILAVPTAIAGIYGMNFEHMPELGTEYGYYVVLTVIVVVCGILYSRFRKAGWL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
4 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
5 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
6 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
7 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
8 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
9 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
10 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
11 2643221723 Ensifer sp. Root278 Isolate Unclassified
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
16 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
17 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
18 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
19 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
20 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
21 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
22 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
23 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
24 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
25 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
26 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
27 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
28 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
29 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
30 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
31 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
32 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
33 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
34 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
35 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
36 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
37 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
38 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
39 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
40 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
207 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
208 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
209 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
210 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.41
Metatranscriptomes 0
Isolates 17.59

Biome Distribution

Category Percentage (%)
Aerial Root 2.76
Bulb 0
Endosphere 12.41
Nodule 4.48
Rhizoplane 2.41
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 11.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_212945 2162886012 Bacteria 1665
2 MBSR1b_contig_7766768 2162886012 Bacteria 1663
3 JGI24739J22299_10029751 3300001989 Bacteria 1896
4 JGI24034J26672_10002332 3300002239 Bacteria 2602
5 JGI24742J22300_10004332 3300002244 Bacteria 2320
6 JGI25159J45721_1000012 3300002987 Bacteria 149808
7 JGI25151J46595_10026212 3300003187 Bacteria 2357
8 rootH1_10026045 3300003323 Bacteria 6647
9 JGI25160J50197_1000042 3300003354 Bacteria 149808
10 JGI25161J50226_1000210 3300003374 Bacteria 37233
11 Ga0055526_1000834 3300003771 Bacteria 23036
12 Ga0055536_1002660 3300003781 Bacteria 9910
13 Ga0055543_1000123 3300004625 Bacteria 64977
14 Ga0065165_1000174 3300005262 Bacteria 113769
15 Ga0065165_1018856 3300005262 Bacteria 2483
16 Ga0065712_10096323 3300005290 Bacteria 2187
17 Ga0065715_10098526 3300005293 Bacteria 3535
18 Ga0065707_10132074 3300005295 Bacteria 1903
19 Ga0065707_10155045 3300005295 Bacteria 1617
20 Ga0070676_10083455 3300005328 Bacteria 1943
21 Ga0070670_100019927 3300005331 Bacteria 5758
22 Ga0070670_100026918 3300005331 Bacteria 4946
23 Ga0070677_10001278 3300005333 Bacteria 8056
24 Ga0070677_10011230 3300005333 Bacteria 3083
25 Ga0070677_10149240 3300005333 Bacteria 1086
26 Ga0068868_100000006 3300005338 Bacteria 123358
27 Ga0070660_100000448 3300005339 Bacteria 27431
28 Ga0070668_100036110 3300005347 Bacteria 3771
29 Ga0070668_100151724 3300005347 Bacteria 1874
30 Ga0070668_100197877 3300005347 Bacteria 1649
31 Ga0070669_100016851 3300005353 Bacteria 5216
32 Ga0070675_100007206 3300005354 Bacteria 8573
33 Ga0070675_100009549 3300005354 Bacteria 7547
34 Ga0070675_100030882 3300005354 Bacteria 4327
35 Ga0070671_100037218 3300005355 Bacteria 4035
36 Ga0070671_100039683 3300005355 Bacteria 3908
37 Ga0070671_100155318 3300005355 Bacteria 1933
38 Ga0070674_100036180 3300005356 Bacteria 3311
39 Ga0070673_100020951 3300005364 Bacteria 4726
40 Ga0070659_100000005 3300005366 Bacteria 259902
41 Ga0070701_10072544 3300005438 Bacteria 1844
42 Ga0070678_100027699 3300005456 Bacteria 3852
43 Ga0070662_100005727 3300005457 Bacteria 7961
44 Ga0068853_100083069 3300005539 Bacteria 2806
45 Ga0068853_100227757 3300005539 Bacteria 1704
46 Ga0070672_100436059 3300005543 Bacteria 1127
47 Ga0070686_100001878 3300005544 Bacteria 11700
48 Ga0070686_100067416 3300005544 Bacteria 2331
49 Ga0070665_100000038 3300005548 Bacteria 309230
50 Ga0070664_100101284 3300005564 Bacteria 2505
51 Ga0068854_100065327 3300005578 Bacteria 2645
52 Ga0068859_100004778 3300005617 Bacteria 13781
53 Ga0068859_100400125 3300005617 Bacteria 1469
54 Ga0068864_100011441 3300005618 Bacteria 7330
55 Ga0068864_100062643 3300005618 Bacteria 3223
56 Ga0068866_10100736 3300005718 Bacteria 1593
57 Ga0068861_100108314 3300005719 Bacteria 2222
58 Ga0068870_10137175 3300005840 Bacteria 1428
59 Ga0068863_100008473 3300005841 Bacteria 10043
60 Ga0068863_100045965 3300005841 Bacteria 4144
61 Ga0068860_100013059 3300005843 Bacteria 8151
62 Ga0068860_100069207 3300005843 Bacteria 3354
63 Ga0068860_100230896 3300005843 Bacteria 1798
64 Ga0068862_100000074 3300005844 Bacteria 118036
65 Ga0068862_100020793 3300005844 Bacteria 5482
66 Ga0075367_10000044 3300006178 Bacteria 28305
67 Ga0075428_100149850 3300006844 Bacteria 2534
68 Ga0097620_100004778 3300006931 Bacteria 13781
69 Ga0097620_100400200 3300006931 Bacteria 1469
70 Ga0105245_10015502 3300009098 Bacteria 6645
71 Ga0105247_10016490 3300009101 Bacteria 4429
72 Ga0105249_10000167 3300009553 Bacteria 77350
73 Ga0105249_10037701 3300009553 Bacteria 4386
74 Ga0157373_10050737 3300013100 Bacteria 2954
75 Ga0157371_10176204 3300013102 Bacteria 1529
76 Ga0157370_10052632 3300013104 Bacteria 3887
77 Ga0157369_10020532 3300013105 Bacteria 7384
78 Ga0157369_10035368 3300013105 Bacteria 5478
79 Ga0157372_10075574 3300013307 Bacteria 3801
80 Ga0157372_10618789 3300013307 Bacteria 1262
81 Ga0157380_10026698 3300014326 Bacteria 4386
82 Ga0157380_10056460 3300014326 Bacteria 3122
83 Ga0157380_10331810 3300014326 Bacteria 1415
84 Ga0163161_10064338 3300017792 Bacteria 2675
85 Ga0163161_10097874 3300017792 Bacteria 2180
86 Ga0209436_100140 3300025208 Bacteria 35032
87 Ga0209147_101666 3300025229 Bacteria 7306
88 Ga0207425_1013753 3300025245 Bacteria 1858
89 Ga0209130_1000075 3300025284 Bacteria 171698
90 Ga0209130_1025642 3300025284 Bacteria 1274
91 Ga0209676_1003221 3300025292 Bacteria 10310
92 Ga0209025_1001974 3300025294 Bacteria 23554
93 Ga0209564_1000278 3300025295 Bacteria 105405
94 Ga0209758_1023202 3300025297 Bacteria 2814
95 Ga0209050_1003053 3300025298 Bacteria 12906
96 Ga0209256_1000411 3300025299 Bacteria 67351
97 Ga0207426_1000163 3300025302 Bacteria 171698
98 Ga0207426_1000745 3300025302 Bacteria 36615
99 Ga0209051_1050007 3300025303 Bacteria 1403
100 Ga0209257_1009385 3300025304 Bacteria 5261
101 Ga0207697_10000837 3300025315 Bacteria 17422
102 Ga0207682_10003071 3300025893 Bacteria 7331
103 Ga0207682_10014238 3300025893 Bacteria 3098
104 Ga0207682_10139897 3300025893 Bacteria 1086
105 Ga0207710_10008191 3300025900 Bacteria 4411
106 Ga0207645_10036118 3300025907 Bacteria 3173
107 Ga0207657_10001193 3300025919 Bacteria 27632
108 Ga0207649_10068763 3300025920 Bacteria 2253
109 Ga0207681_10001762 3300025923 Bacteria 13898
110 Ga0207650_10006037 3300025925 Bacteria 8264
111 Ga0207650_10006510 3300025925 Bacteria 7962
112 Ga0207650_10062008 3300025925 Bacteria 2793
113 Ga0207659_10001025 3300025926 Bacteria 16614
114 Ga0207659_10006342 3300025926 Bacteria 7241
115 Ga0207687_10090802 3300025927 Bacteria 2227
116 Ga0207687_10285161 3300025927 Bacteria 1325
117 Ga0207644_10026854 3300025931 Bacteria 3974
118 Ga0207690_10000002 3300025932 Bacteria 807473
119 Ga0207690_10000033 3300025932 Bacteria 149705
120 Ga0207690_10355366 3300025932 Bacteria 1159
121 Ga0207706_10002424 3300025933 Bacteria 18204
122 Ga0207706_10036474 3300025933 Bacteria 4367
123 Ga0207706_10142193 3300025933 Bacteria 2111
124 Ga0207669_10042823 3300025937 Bacteria 2646
125 Ga0207679_10067078 3300025945 Bacteria 2691
126 Ga0207651_10010425 3300025960 Bacteria 5152
127 Ga0207712_10000049 3300025961 Bacteria 160026
128 Ga0207668_10000870 3300025972 Bacteria 18225
129 Ga0207640_10070132 3300025981 Bacteria 2356
130 Ga0207677_10000043 3300026023 Bacteria 110161
131 Ga0207678_10014976 3300026067 Bacteria 6823
132 Ga0207641_10007896 3300026088 Bacteria 8825
133 Ga0207641_10060208 3300026088 Bacteria 3236
134 Ga0207676_10049218 3300026095 Bacteria 3277
135 Ga0207676_10050890 3300026095 Bacteria 3232
136 Ga0209281_1000110 3300027111 Bacteria 215631
137 Ga0209371_1000035 3300027312 Bacteria 368979
138 Ga0209371_1001310 3300027312 Bacteria 17417
139 Ga0209813_10000034 3300027866 Bacteria 61259
140 Ga0268266_10000118 3300028379 Bacteria 163466
141 Ga0268265_10000113 3300028380 Bacteria 101546
142 Ga0268265_10013294 3300028380 Bacteria 5593
143 Ga0268265_10430270 3300028380 Bacteria 1228
144 Ga0268264_10009791 3300028381 Bacteria 7932
145 Ga0268264_10290645 3300028381 Bacteria 1535
146 Ga0268256_1000037 3300030500 Bacteria 367024
147 Ga0268256_1008922 3300030500 Bacteria 3384
148 Ga0307513_10016058 3300031456 Bacteria 9048
149 Ga0307513_10065093 3300031456 Bacteria 3836
150 Ga0307405_10008880 3300031731 Bacteria 5124
151 Ga0307405_10053886 3300031731 Bacteria 2508
152 Ga0307405_10150186 3300031731 Bacteria 1637
153 Ga0307413_10002762 3300031824 Bacteria 7224
154 Ga0307413_10166334 3300031824 Bacteria 1556
155 Ga0307410_10010005 3300031852 Bacteria 5351
156 Ga0307410_10202632 3300031852 Bacteria 1516
157 Ga0307406_10095785 3300031901 Bacteria 2009
158 Ga0307407_10113662 3300031903 Bacteria 1704
159 Ga0307412_10090620 3300031911 Bacteria 2138
160 Ga0307409_100005087 3300031995 Bacteria 7501
161 Ga0307409_100059207 3300031995 Bacteria 2980
162 Ga0307416_100101979 3300032002 Bacteria 2501
163 Ga0307416_100236778 3300032002 Bacteria 1765
164 Ga0307416_100321384 3300032002 Bacteria 1550
165 Ga0307414_10017063 3300032004 Bacteria 4433
166 Ga0307414_10095432 3300032004 Bacteria 2222
167 Ga0307411_10004993 3300032005 Bacteria 6451
168 Ga0307415_100039871 3300032126 Bacteria 3108
169 Ga0307415_100166268 3300032126 Bacteria 1715
170 Ga0436365_1785712 3300039437 Bacteria 1231
171 Ga0451833_0464765 3300041491 Bacteria 5110
172 Ga0451835_0209279 3300041492 Bacteria 1855
173 Ga0451837_0875839 3300041494 Bacteria 3046
174 Ga0451849_0260183 3300041505 Bacteria 3324
175 Ga0451843_0275338 3300041509 Bacteria 3267
176 Ga0451855_0167445 3300041511 Bacteria 6875
177 Ga0451853_0224927 3300041512 Bacteria 3433
178 Ga0439445_0003025 3300042004 Bacteria 3764
179 Ga0439448_0036062 3300042005 Bacteria 1585
180 Ga0439454_007687 3300042011 Bacteria 1357
181 Ga0439455_0000153 3300042012 Bacteria 7607
182 Ga0439458_0001828 3300042157 Bacteria 5295
183 Ga0439458_0011668 3300042157 Bacteria 1966
184 Ga0439464_0088565 3300042439 Bacteria 931
185 Ga0495617_007630 3300046452 Bacteria 3747
186 Ga0495627_000459 3300046453 Bacteria 35376
187 Ga0495627_000503 3300046453 Bacteria 32725
188 Ga0495584_0013745 3300046491 Bacteria 4129
189 Ga0495585_0097846 3300046492 Bacteria 1573
190 Ga0495607_0006848 3300046501 Bacteria 7953
191 Ga0495583_0004105 3300046506 Bacteria 10681
192 Ga0495610_0000043 3300046512 Bacteria 158045
193 Ga0495632_0000048 3300046519 Bacteria 137883
194 Ga0495632_0061819 3300046519 Bacteria 1817
195 Ga0495637_0001256 3300046520 Bacteria 15302
196 Ga0495637_0002774 3300046520 Bacteria 9507
197 Ga0495643_0000030 3300046522 Bacteria 260229
198 Ga0495648_0009768 3300046524 Bacteria 7391
199 Ga0495663_0000003 3300046525 Bacteria 362694
200 Ga0495663_0001552 3300046525 Bacteria 7201
201 Ga0495663_0027438 3300046525 Bacteria 1671
202 Ga0495633_0000211 3300046558 Bacteria 73547
203 Ga0495633_0000215 3300046558 Bacteria 72445
204 Ga0495633_0017847 3300046558 Bacteria 3615
205 Ga0495633_0022300 3300046558 Bacteria 3154
206 Ga0495633_0102031 3300046558 Bacteria 1332
207 Ga0495633_0117710 3300046558 Bacteria 1231
208 Ga0495625_0057763 3300046660 Bacteria 2758
209 Ga0495659_0004913 3300046664 Bacteria 4207
210 Ga0495661_0094489 3300046665 Bacteria 1695
211 Ga0495670_0043662 3300046691 Bacteria 2237
212 Ga0495670_0129625 3300046691 Bacteria 1314
213 Ga0495671_0000043 3300046692 Bacteria 163036
214 Ga0495677_0014104 3300047445 Bacteria 2911
215 Ga0495681_0000025 3300047470 Bacteria 148216
216 Ga0495681_0005953 3300047470 Bacteria 8089
217 Ga0495686_0036570 3300047472 Bacteria 3151
218 Ga0496106_0002403 3300048909 Bacteria 13950
219 Ga0496111_0001989 3300048914 Bacteria 12152
220 Ga0496115_0121618 3300048918 Bacteria 2148
221 Ga0496121_0011350 3300048924 Bacteria 9904
222 Ga0496121_0028426 3300048924 Bacteria 5204
223 Ga0496121_0267388 3300048924 Bacteria 1177
224 Ga0496123_0006828 3300048926 Bacteria 10950
225 Ga0496124_0071625 3300048927 Bacteria 2872
226 Ga0496124_0127473 3300048927 Bacteria 2026
227 Ga0496126_0080255 3300048929 Bacteria 2887
228 nmdc:mga03n38_22034_c1 3300050490 Bacteria 2572
229 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
230 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
231 nmdc:mga08y16_128747_c1 3300050511 Bacteria 2633
232 nmdc:mga0n895_160861_c1 3300050512 Bacteria 2277
233 Ga0500562_012809 3300053108 Bacteria 2135
234 Ga0500608_000685 3300053122 Bacteria 12409
235 Ga0500618_000402 3300053125 Bacteria 29508
236 Ga0500658_0012956 3300053134 Bacteria 3080
237 Ga0500568_0001141 3300053139 Bacteria 17815
238 Ga0500622_0066586 3300053156 Bacteria 1829
239 Ga0500633_0000181 3300053160 Bacteria 8695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_160861_c1 nmdc:mga0n895_160861_c1_1391_2251 286
2 3300042439 Ga0439464_0088565 Ga0439464_0088565_35_904 289
3 iso_pu_bacteria 2599185210 2599606107 294
4 3300017792 Ga0163161_10064338 Ga0163161_100643383 297
5 3300048924 Ga0496121_0267388 Ga0496121_0267388_191_1108 297
6 3300031456 Ga0307513_10016058 Ga0307513_100160586 304
7 3300005617 Ga0068859_100400125 Ga0068859_1004001252 308
8 3300005843 Ga0068860_100230896 Ga0068860_1002308962 308
9 3300006931 Ga0097620_100400200 Ga0097620_1004002002 308
10 3300028380 Ga0268265_10430270 Ga0268265_104302702 308
11 3300028381 Ga0268264_10290645 Ga0268264_102906452 308
12 3300041491 Ga0451833_0464765 Ga0451833_0464765_686_1651 308
13 3300041494 Ga0451837_0875839 Ga0451837_0875839_1782_2747 308
14 3300041505 Ga0451849_0260183 Ga0451849_0260183_535_1500 308
15 3300041509 Ga0451843_0275338 Ga0451843_0275338_411_1376 308
16 3300041511 Ga0451855_0167445 Ga0451855_0167445_1802_2767 308
17 3300041512 Ga0451853_0224927 Ga0451853_0224927_411_1376 308
18 iso_pu_bacteria 2842304105 2842311121 314
19 iso_pu_bacteria 2513237159 2514002269 317
20 iso_pu_bacteria 2517093000 2517099774 317
21 iso_pu_bacteria 2582581299 2585233559 317
22 iso_pu_bacteria 2582581866 2585393418 317
23 iso_pu_bacteria 2599185156 2599336272 317
24 iso_pu_bacteria 2599185236 2599718234 317
25 iso_pu_bacteria 2600254933 2600375069 317
26 iso_pu_bacteria 2643221723 2644672429 317
27 iso_pu_bacteria 2818991439 2819561247 317
28 iso_pu_bacteria 2818991439 2819562132 317
29 iso_pu_bacteria 2821123053 2821126436 317
30 iso_pu_bacteria 2838736955 2838737088 317
31 iso_pu_bacteria 2841840854 2841842543 317
32 iso_pu_bacteria 2842140634 2842142323 317
33 iso_pu_bacteria 2842521101 2842525034 317
34 iso_pu_bacteria 2842922631 2842927964 317
35 iso_pu_bacteria 2842922631 2842928141 317
36 iso_pu_bacteria 2854896431 2854900152 317
37 iso_pu_bacteria 2857516855 2857521381 317
38 iso_pu_bacteria 2857531043 2857532998 317
39 iso_pu_bacteria 2857531043 2857533325 317
40 iso_pu_bacteria 2923556063 2923560251 317
41 iso_pu_bacteria 2936367885 2936372999 317
42 iso_pu_bacteria 2936375103 2936381151 317
43 iso_pu_bacteria 2941499720 2941506672 317
44 iso_pu_bacteria 2954011201 2954011705 317
45 iso_pu_bacteria 2979100975 2979101851 317
46 iso_pu_bacteria 2979100975 2979103225 317
47 iso_pu_bacteria 2984509177 2984510217 317
48 iso_pu_bacteria 2984509177 2984514090 317
49 iso_pu_bacteria 2984518228 2984519079 317
50 iso_pu_bacteria 2984518228 2984523121 317
51 iso_pu_bacteria 2984537506 2984538562 317
52 iso_pu_bacteria 2984537506 2984542342 317
53 iso_pu_bacteria 2984601300 2984605272 317
54 iso_pu_bacteria 2984601300 2984606343 317
55 iso_pu_bacteria 3005409236 3005409853 317
56 iso_pu_bacteria 8005376324 8005378923 317
57 iso_pu_bacteria 8023680758 8023685670 317
58 iso_pu_bacteria 8054460903 8054465518 317
59 iso_pu_bacteria 8056875544 8056879923 317
60 iso_pu_bacteria 2512564014 2512642656 318
61 iso_pu_bacteria 2808606401 2809062517 318
62 iso_pu_bacteria 2808606404 2809078143 318
63 iso_pu_bacteria 2808606405 2809082906 318
64 iso_pu_bacteria 2880518877 2880522222 318
65 iso_pu_bacteria 2919709256 2919709806 318
66 iso_pu_bacteria 2946787523 2946788088 318
67 3300002987 JGI25159J45721_1000012 JGI25159J45721_1000012103 321
68 3300003187 JGI25151J46595_10026212 JGI25151J46595_100262122 321
69 3300003323 rootH1_10026045 rootH1_100260456 321
70 3300003354 JGI25160J50197_1000042 JGI25160J50197_100004251 321
71 3300003374 JGI25161J50226_1000210 JGI25161J50226_100021025 321
72 3300003771 Ga0055526_1000834 Ga0055526_10008347 321
73 3300003781 Ga0055536_1002660 Ga0055536_10026601 321
74 3300004625 Ga0055543_1000123 Ga0055543_100012351 321
75 3300005262 Ga0065165_1000174 Ga0065165_1000174103 321
76 3300005262 Ga0065165_1018856 Ga0065165_10188562 321
77 3300013104 Ga0157370_10052632 Ga0157370_100526322 321
78 3300013105 Ga0157369_10020532 Ga0157369_100205324 321
79 3300013105 Ga0157369_10035368 Ga0157369_100353684 321
80 3300025208 Ga0209436_100140 Ga0209436_10014035 321
81 3300025245 Ga0207425_1013753 Ga0207425_10137532 321
82 3300025284 Ga0209130_1000075 Ga0209130_100007554 321
83 3300025284 Ga0209130_1025642 Ga0209130_10256421 321
84 3300025292 Ga0209676_1003221 Ga0209676_10032214 321
85 3300025294 Ga0209025_1001974 Ga0209025_10019742 321
86 3300025295 Ga0209564_1000278 Ga0209564_100027848 321
87 3300025297 Ga0209758_1023202 Ga0209758_10232023 321
88 3300025298 Ga0209050_1003053 Ga0209050_10030538 321
89 3300025299 Ga0209256_1000411 Ga0209256_100041124 321
90 3300025302 Ga0207426_1000163 Ga0207426_100016354 321
91 3300025302 Ga0207426_1000745 Ga0207426_100074515 321
92 3300025303 Ga0209051_1050007 Ga0209051_10500071 321
93 3300025304 Ga0209257_1009385 Ga0209257_10093851 321
94 3300027111 Ga0209281_1000110 Ga0209281_1000110183 321
95 3300027312 Ga0209371_1000035 Ga0209371_1000035231 321
96 3300027312 Ga0209371_1001310 Ga0209371_100131010 321
97 3300030500 Ga0268256_1000037 Ga0268256_1000037230 321
98 3300030500 Ga0268256_1008922 Ga0268256_10089223 321
99 3300031731 Ga0307405_10008880 Ga0307405_100088802 321
100 3300031731 Ga0307405_10150186 Ga0307405_101501862 321
101 3300031824 Ga0307413_10166334 Ga0307413_101663342 321
102 3300031911 Ga0307412_10090620 Ga0307412_100906202 321
103 3300032002 Ga0307416_100236778 Ga0307416_1002367782 321
104 3300032126 Ga0307415_100166268 Ga0307415_1001662682 321
105 3300041492 Ga0451835_0209279 Ga0451835_0209279_811_1776 321
106 3300046492 Ga0495585_0097846 Ga0495585_0097846_548_1513 321
107 3300046506 Ga0495583_0004105 Ga0495583_0004105_3236_4219 321
108 3300046519 Ga0495632_0061819 Ga0495632_0061819_836_1801 321
109 3300046558 Ga0495633_0102031 Ga0495633_0102031_292_1257 321
110 3300048909 Ga0496106_0002403 Ga0496106_0002403_7779_8744 321
111 3300048914 Ga0496111_0001989 Ga0496111_0001989_2336_3301 321
112 3300048924 Ga0496121_0011350 Ga0496121_0011350_4289_5254 321
113 3300048924 Ga0496121_0028426 Ga0496121_0028426_423_1388 321
114 3300048926 Ga0496123_0006828 Ga0496123_0006828_9570_10535 321
115 3300048927 Ga0496124_0071625 Ga0496124_0071625_388_1368 321
116 3300048927 Ga0496124_0127473 Ga0496124_0127473_674_1639 321
117 3300048929 Ga0496126_0080255 Ga0496126_0080255_300_1265 321
118 3300053125 Ga0500618_000402 Ga0500618_000402_15227_16192 321
119 3300053134 Ga0500658_0012956 Ga0500658_0012956_1550_2515 321
120 3300053139 Ga0500568_0001141 Ga0500568_0001141_4665_5630 321
121 3300053160 Ga0500633_0000181 Ga0500633_0000181_1740_2705 321
122 iso_pu_bacteria 2933570622 2933577498 321
123 2162886012 MBSR1b_contig_212945 MBSR1b_0296.00006600 322
124 2162886012 MBSR1b_contig_7766768 MBSR1b_0378.00006560 322
125 3300001989 JGI24739J22299_10029751 JGI24739J22299_100297513 322
126 3300002239 JGI24034J26672_10002332 JGI24034J26672_100023322 322
127 3300002244 JGI24742J22300_10004332 JGI24742J22300_100043322 322
128 3300005290 Ga0065712_10096323 Ga0065712_100963232 322
129 3300005293 Ga0065715_10098526 Ga0065715_100985262 322
130 3300005295 Ga0065707_10132074 Ga0065707_101320743 322
131 3300005295 Ga0065707_10155045 Ga0065707_101550451 322
132 3300005328 Ga0070676_10083455 Ga0070676_100834552 322
133 3300005331 Ga0070670_100019927 Ga0070670_1000199273 322
134 3300005331 Ga0070670_100026918 Ga0070670_1000269183 322
135 3300005333 Ga0070677_10001278 Ga0070677_100012782 322
136 3300005333 Ga0070677_10011230 Ga0070677_100112303 322
137 3300005333 Ga0070677_10149240 Ga0070677_101492401 322
138 3300005338 Ga0068868_100000006 Ga0068868_10000000617 322
139 3300005339 Ga0070660_100000448 Ga0070660_10000044817 322
140 3300005347 Ga0070668_100036110 Ga0070668_1000361102 322
141 3300005347 Ga0070668_100151724 Ga0070668_1001517242 322
142 3300005347 Ga0070668_100197877 Ga0070668_1001978771 322
143 3300005353 Ga0070669_100016851 Ga0070669_1000168515 322
144 3300005354 Ga0070675_100007206 Ga0070675_1000072064 322
145 3300005354 Ga0070675_100009549 Ga0070675_1000095494 322
146 3300005354 Ga0070675_100030882 Ga0070675_1000308822 322
147 3300005355 Ga0070671_100037218 Ga0070671_1000372182 322
148 3300005355 Ga0070671_100039683 Ga0070671_1000396831 322
149 3300005355 Ga0070671_100155318 Ga0070671_1001553182 322
150 3300005356 Ga0070674_100036180 Ga0070674_1000361802 322
151 3300005364 Ga0070673_100020951 Ga0070673_1000209512 322
152 3300005366 Ga0070659_100000005 Ga0070659_100000005118 322
153 3300005438 Ga0070701_10072544 Ga0070701_100725441 322
154 3300005456 Ga0070678_100027699 Ga0070678_1000276995 322
155 3300005457 Ga0070662_100005727 Ga0070662_1000057277 322
156 3300005539 Ga0068853_100083069 Ga0068853_1000830692 322
157 3300005539 Ga0068853_100227757 Ga0068853_1002277572 322
158 3300005543 Ga0070672_100436059 Ga0070672_1004360592 322
159 3300005544 Ga0070686_100001878 Ga0070686_10000187811 322
160 3300005544 Ga0070686_100067416 Ga0070686_1000674161 322
161 3300005548 Ga0070665_100000038 Ga0070665_100000038163 322
162 3300005564 Ga0070664_100101284 Ga0070664_1001012842 322
163 3300005578 Ga0068854_100065327 Ga0068854_1000653272 322
164 3300005617 Ga0068859_100004778 Ga0068859_1000047782 322
165 3300005618 Ga0068864_100011441 Ga0068864_1000114412 322
166 3300005618 Ga0068864_100062643 Ga0068864_1000626432 322
167 3300005718 Ga0068866_10100736 Ga0068866_101007362 322
168 3300005719 Ga0068861_100108314 Ga0068861_1001083142 322
169 3300005840 Ga0068870_10137175 Ga0068870_101371752 322
170 3300005841 Ga0068863_100008473 Ga0068863_1000084736 322
171 3300005841 Ga0068863_100045965 Ga0068863_1000459653 322
172 3300005843 Ga0068860_100013059 Ga0068860_1000130594 322
173 3300005843 Ga0068860_100069207 Ga0068860_1000692072 322
174 3300005844 Ga0068862_100000074 Ga0068862_10000007460 322
175 3300005844 Ga0068862_100020793 Ga0068862_1000207935 322
176 3300006178 Ga0075367_10000044 Ga0075367_100000444 322
177 3300006844 Ga0075428_100149850 Ga0075428_1001498502 322
178 3300006931 Ga0097620_100004778 Ga0097620_1000047782 322
179 3300009098 Ga0105245_10015502 Ga0105245_100155026 322
180 3300009101 Ga0105247_10016490 Ga0105247_100164904 322
181 3300009553 Ga0105249_10000167 Ga0105249_1000016768 322
182 3300009553 Ga0105249_10037701 Ga0105249_100377013 322
183 3300013100 Ga0157373_10050737 Ga0157373_100507371 322
184 3300013102 Ga0157371_10176204 Ga0157371_101762042 322
185 3300013307 Ga0157372_10075574 Ga0157372_100755743 322
186 3300013307 Ga0157372_10618789 Ga0157372_106187892 322
187 3300014326 Ga0157380_10026698 Ga0157380_100266985 322
188 3300014326 Ga0157380_10056460 Ga0157380_100564602 322
189 3300014326 Ga0157380_10331810 Ga0157380_103318102 322
190 3300017792 Ga0163161_10097874 Ga0163161_100978742 322
191 3300025229 Ga0209147_101666 Ga0209147_1016666 322
192 3300025315 Ga0207697_10000837 Ga0207697_1000083717 322
193 3300025893 Ga0207682_10003071 Ga0207682_100030717 322
194 3300025893 Ga0207682_10014238 Ga0207682_100142382 322
195 3300025893 Ga0207682_10139897 Ga0207682_101398971 322
196 3300025900 Ga0207710_10008191 Ga0207710_100081911 322
197 3300025907 Ga0207645_10036118 Ga0207645_100361182 322
198 3300025919 Ga0207657_10001193 Ga0207657_1000119317 322
199 3300025920 Ga0207649_10068763 Ga0207649_100687632 322
200 3300025923 Ga0207681_10001762 Ga0207681_1000176213 322
201 3300025925 Ga0207650_10006037 Ga0207650_100060372 322
202 3300025925 Ga0207650_10006510 Ga0207650_100065102 322
203 3300025925 Ga0207650_10062008 Ga0207650_100620083 322
204 3300025926 Ga0207659_10001025 Ga0207659_100010252 322
205 3300025926 Ga0207659_10006342 Ga0207659_100063424 322
206 3300025927 Ga0207687_10090802 Ga0207687_100908023 322
207 3300025927 Ga0207687_10285161 Ga0207687_102851612 322
208 3300025931 Ga0207644_10026854 Ga0207644_100268542 322
209 3300025932 Ga0207690_10000002 Ga0207690_10000002763 322
210 3300025932 Ga0207690_10000033 Ga0207690_10000033118 322
211 3300025932 Ga0207690_10355366 Ga0207690_103553661 322
212 3300025933 Ga0207706_10002424 Ga0207706_100024242 322
213 3300025933 Ga0207706_10036474 Ga0207706_100364742 322
214 3300025933 Ga0207706_10142193 Ga0207706_101421932 322
215 3300025937 Ga0207669_10042823 Ga0207669_100428232 322
216 3300025945 Ga0207679_10067078 Ga0207679_100670782 322
217 3300025960 Ga0207651_10010425 Ga0207651_100104252 322
218 3300025961 Ga0207712_10000049 Ga0207712_1000004960 322
219 3300025972 Ga0207668_10000870 Ga0207668_100008702 322
220 3300025981 Ga0207640_10070132 Ga0207640_100701322 322
221 3300026023 Ga0207677_10000043 Ga0207677_100000433 322
222 3300026067 Ga0207678_10014976 Ga0207678_100149767 322
223 3300026088 Ga0207641_10007896 Ga0207641_100078962 322
224 3300026088 Ga0207641_10060208 Ga0207641_100602083 322
225 3300026095 Ga0207676_10049218 Ga0207676_100492182 322
226 3300026095 Ga0207676_10050890 Ga0207676_100508903 322
227 3300027866 Ga0209813_10000034 Ga0209813_1000003427 322
228 3300028379 Ga0268266_10000118 Ga0268266_1000011882 322
229 3300028380 Ga0268265_10000113 Ga0268265_1000011375 322
230 3300028380 Ga0268265_10013294 Ga0268265_100132942 322
231 3300028381 Ga0268264_10009791 Ga0268264_100097913 322
232 3300031456 Ga0307513_10065093 Ga0307513_100650934 322
233 3300031731 Ga0307405_10053886 Ga0307405_100538862 322
234 3300031824 Ga0307413_10002762 Ga0307413_100027627 322
235 3300031852 Ga0307410_10010005 Ga0307410_100100054 322
236 3300031852 Ga0307410_10202632 Ga0307410_102026322 322
237 3300031901 Ga0307406_10095785 Ga0307406_100957852 322
238 3300031903 Ga0307407_10113662 Ga0307407_101136622 322
239 3300031995 Ga0307409_100005087 Ga0307409_1000050876 322
240 3300031995 Ga0307409_100059207 Ga0307409_1000592075 322
241 3300032002 Ga0307416_100101979 Ga0307416_1001019792 322
242 3300032002 Ga0307416_100321384 Ga0307416_1003213842 322
243 3300032004 Ga0307414_10017063 Ga0307414_100170636 322
244 3300032004 Ga0307414_10095432 Ga0307414_100954322 322
245 3300032005 Ga0307411_10004993 Ga0307411_100049937 322
246 3300032126 Ga0307415_100039871 Ga0307415_1000398711 322
247 3300039437 Ga0436365_1785712 Ga0436365_1785712_82_1128 322
248 3300042004 Ga0439445_0003025 Ga0439445_0003025_1219_2187 322
249 3300042005 Ga0439448_0036062 Ga0439448_0036062_157_1125 322
250 3300042011 Ga0439454_007687 Ga0439454_007687_296_1264 322
251 3300042012 Ga0439455_0000153 Ga0439455_0000153_6418_7386 322
252 3300042157 Ga0439458_0001828 Ga0439458_0001828_455_1423 322
253 3300042157 Ga0439458_0011668 Ga0439458_0011668_389_1357 322
254 3300046452 Ga0495617_007630 Ga0495617_007630_1914_2882 322
255 3300046453 Ga0495627_000459 Ga0495627_000459_9115_10083 322
256 3300046453 Ga0495627_000503 Ga0495627_000503_23214_24182 322
257 3300046491 Ga0495584_0013745 Ga0495584_0013745_545_1609 322
258 3300046501 Ga0495607_0006848 Ga0495607_0006848_3843_4811 322
259 3300046512 Ga0495610_0000043 Ga0495610_0000043_73485_74453 322
260 3300046519 Ga0495632_0000048 Ga0495632_0000048_57379_58443 322
261 3300046520 Ga0495637_0001256 Ga0495637_0001256_12129_13193 322
262 3300046520 Ga0495637_0002774 Ga0495637_0002774_390_1358 322
263 3300046522 Ga0495643_0000030 Ga0495643_0000030_66843_67907 322
264 3300046524 Ga0495648_0009768 Ga0495648_0009768_2058_3026 322
265 3300046525 Ga0495663_0000003 Ga0495663_0000003_239831_240895 322
266 3300046525 Ga0495663_0001552 Ga0495663_0001552_275_1243 322
267 3300046525 Ga0495663_0027438 Ga0495663_0027438_178_1146 322
268 3300046558 Ga0495633_0000211 Ga0495633_0000211_70116_71084 322
269 3300046558 Ga0495633_0000215 Ga0495633_0000215_38086_39150 322
270 3300046558 Ga0495633_0017847 Ga0495633_0017847_2520_3488 322
271 3300046558 Ga0495633_0022300 Ga0495633_0022300_975_1943 322
272 3300046558 Ga0495633_0117710 Ga0495633_0117710_137_1105 322
273 3300046660 Ga0495625_0057763 Ga0495625_0057763_294_1358 322
274 3300046664 Ga0495659_0004913 Ga0495659_0004913_43_1011 322
275 3300046665 Ga0495661_0094489 Ga0495661_0094489_638_1606 322
276 3300046691 Ga0495670_0043662 Ga0495670_0043662_254_1222 322
277 3300046691 Ga0495670_0129625 Ga0495670_0129625_171_1139 322
278 3300046692 Ga0495671_0000043 Ga0495671_0000043_66843_67907 322
279 3300047445 Ga0495677_0014104 Ga0495677_0014104_1508_2476 322
280 3300047470 Ga0495681_0000025 Ga0495681_0000025_73260_74228 322
281 3300047470 Ga0495681_0005953 Ga0495681_0005953_168_1232 322
282 3300047472 Ga0495686_0036570 Ga0495686_0036570_2142_3110 322
283 3300048918 Ga0496115_0121618 Ga0496115_0121618_740_1708 322
284 3300050490 nmdc:mga03n38_22034_c1 nmdc:mga03n38_22034_c1_800_1768 322
285 3300050494 nmdc:mga06z11_4_c1 nmdc:mga06z11_4_c1_25856_26824 322
286 3300050495 nmdc:mga04h51_7_c1 nmdc:mga04h51_7_c1_81169_82137 322
287 3300050511 nmdc:mga08y16_128747_c1 nmdc:mga08y16_128747_c1_937_1905 322
288 3300053108 Ga0500562_012809 Ga0500562_012809_36_1004 322
289 3300053122 Ga0500608_000685 Ga0500608_000685_2635_3603 322
290 3300053156 Ga0500622_0066586 Ga0500622_0066586_383_1351 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

29

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jcf-assembly1.cif.gz_A cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state 0.8764 3 322
5yny-assembly1.cif.gz_A structure of house dust mite allergen der f 21 in peg2kmme 0.8743 137 246
2bbj-assembly1.cif.gz_F crystal structure of the cora mg2+ transporter 0.869 3 318
3jcf-assembly1.cif.gz_A cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state 0.8688 3 322
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8685 6 318
ID Description Score Start End Superfamily
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9493 33 129 3.30.460.20
4ev6A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.948 135 262 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.941 136 243 1.20.58.340
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9409 137 243 1.20.58.340
4i0uB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9401 136 243 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A520JCN4-F1-model_v4 Magnesium transporter 0.9857 1 225 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A520JCN4-F1-model_v4 Magnesium transporter 0.9771 1 225 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A3S4DGT1-F1-model_v4 Magnesium transport protein CorA 0.9506 2 322 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-F8UGV9-F1-model_v4 Metal ion transport protein 0.9478 3 285 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A529YH66-F1-model_v4 Magnesium transporter 0.9476 3 192 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Feature Viewer

pLDDT pTM Quality
83.48 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map