F389897

General Info

Members Datasets Scaffolds Average Seq Length
290 197 580 94

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_049478|Ga0439438_049478_404_727
Length 107
Sequence MKIIWTPAAAQDRADIWDYLHAVNPIAALEMDNRFIDAISRISQFPESGPVGIITGTRESIPHQNYRLVYQPEPDAIWILTLVHTSRQWPKKGNSHTPRPFLIITSS

Samples

Sample ID Description Type Environment
1 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
63 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
64 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
65 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
72 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
73 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
74 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
75 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
76 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
77 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
78 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
79 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
80 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
177 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
178 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 2511231006 Pseudomonas sp. GM17 Isolate Nodule
183 2511231022 Pseudomonas sp. GM79 Isolate Nodule
184 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
185 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
186 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
187 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
188 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
189 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
190 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
191 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
192 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
193 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
194 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
195 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
196 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
197 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 0
Isolates 5.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.1
Nodule 1.38
Rhizoplane 1.38
Rhizosphere 78.28
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439438_049478 3300041405 Bacteria 1073
2 MRS2a_Contig_10617 2124908027 Bacteria 1091
3 LJNas_1000475 3300000546 Bacteria 7031
4 LJNas_1001877 3300000546 Bacteria 2746
5 LJNas_1005155 3300000546 Unclassified 1432
6 Ga0055528_1048868 3300003790 Bacteria 870
7 Ga0065165_1054439 3300005262 Bacteria 1121
8 Ga0065714_10024020 3300005288 Bacteria 1117
9 Ga0065714_10123864 3300005288 Bacteria 1317
10 Ga0065712_10030054 3300005290 Bacteria 1230
11 Ga0065715_10643389 3300005293 Bacteria 672
12 Ga0070669_100457360 3300005353 Bacteria 1053
13 Ga0070714_100073623 3300005435 Bacteria 2960
14 Ga0075365_10104707 3300006038 Bacteria 1940
15 Ga0075363_100040880 3300006048 Bacteria 2444
16 Ga0075364_10015427 3300006051 Bacteria 4738
17 Ga0075364_10116187 3300006051 Bacteria 1788
18 Ga0075364_10650130 3300006051 Bacteria 720
19 Ga0075432_10039839 3300006058 Bacteria 1639
20 Ga0075362_10020313 3300006177 Bacteria 2774
21 Ga0075367_10733815 3300006178 Unclassified 628
22 Ga0075366_10008143 3300006195 Bacteria 5816
23 Ga0105251_10171017 3300009011 Bacteria 979
24 Ga0105244_10217685 3300009036 Bacteria 896
25 Ga0105250_10163951 3300009092 Bacteria 929
26 Ga0105250_10249910 3300009092 Bacteria 757
27 Ga0105243_10000440 3300009148 Bacteria 43327
28 Ga0105246_10126940 3300011119 Bacteria 1899
29 Ga0157373_10022765 3300013100 Bacteria 4544
30 Ga0157373_10023206 3300013100 Bacteria 4500
31 Ga0157373_10943485 3300013100 Bacteria 642
32 Ga0157371_10000866 3300013102 Bacteria 34355
33 Ga0157370_10015157 3300013104 Bacteria 7851
34 Ga0157370_10755240 3300013104 Bacteria 886
35 Ga0163162_10017740 3300013306 Bacteria 6965
36 Ga0163162_11097456 3300013306 Bacteria 901
37 Ga0157375_11171390 3300013308 Bacteria 901
38 Ga0182008_10229274 3300014497 Bacteria 952
39 Ga0182008_10297218 3300014497 Bacteria 844
40 Ga0182005_1017685 3300015265 Bacteria 1972
41 Ga0182005_1076607 3300015265 Bacteria 921
42 Ga0163161_10156987 3300017792 Bacteria 1733
43 Ga0163161_11526378 3300017792 Bacteria 587
44 Ga0213872_10097637 3300021361 Bacteria 1311
45 Ga0209673_1088881 3300025273 Bacteria 689
46 Ga0209130_1000467 3300025284 Bacteria 41801
47 Ga0209025_1005394 3300025294 Bacteria 10458
48 Ga0209564_1042875 3300025295 Bacteria 1194
49 Ga0209758_1130228 3300025297 Bacteria 666
50 Ga0207696_1042260 3300025711 Bacteria 1329
51 Ga0207655_1103249 3300025728 Bacteria 977
52 Ga0207713_1098060 3300025735 Bacteria 1017
53 Ga0207681_10580875 3300025923 Bacteria 924
54 Ga0207664_10064475 3300025929 Bacteria 2930
55 Ga0207709_10000058 3300025935 Bacteria 212963
56 Ga0207639_10745551 3300026041 Bacteria 910
57 Ga0209281_1030234 3300027111 Bacteria 973
58 Ga0209371_1081758 3300027312 Bacteria 557
59 Ga0209813_10179684 3300027866 Unclassified 773
60 Ga0207428_10231660 3300027907 Bacteria 1382
61 Ga0265338_10040681 3300028800 Bacteria 4361
62 Ga0268256_1071283 3300030500 Bacteria 669
63 Ga0307511_10013797 3300030521 Bacteria 7884
64 Ga0265327_10040103 3300031251 Bacteria 2536
65 Ga0307408_100017070 3300031548 Bacteria 4855
66 Ga0307405_10121121 3300031731 Bacteria 1790
67 Ga0307405_10271253 3300031731 Bacteria 1272
68 Ga0307410_11418358 3300031852 Bacteria 610
69 Ga0307406_10818872 3300031901 Bacteria 787
70 Ga0307412_10396949 3300031911 Bacteria 1121
71 Ga0307412_10485383 3300031911 Bacteria 1025
72 Ga0307416_100277734 3300032002 Bacteria 1649
73 Ga0307414_10232334 3300032004 Bacteria 1521
74 Ga0307411_10060689 3300032005 Bacteria 2513
75 Ga0307411_10148788 3300032005 Bacteria 1737
76 Ga0307415_100401194 3300032126 Bacteria 1171
77 Ga0373931_0015819 3300035691 Bacteria 3704
78 Ga0400490_34547 3300038726 Bacteria 1308
79 Ga0400485_19701 3300038735 Unclassified 2378
80 Ga0400488_20176 3300038741 Unclassified 2275
81 Ga0400486_25119 3300038742 Bacteria 5685
82 Ga0400483_025078 3300039062 Bacteria 1081
83 Ga0400487_44677 3300039110 Bacteria 1406
84 Ga0436361_1199162 3300039447 Bacteria 1249
85 Ga0439438_006432 3300041405 Bacteria 4139
86 Ga0439438_051174 3300041405 Bacteria 1049
87 Ga0439438_075339 3300041405 Bacteria 832
88 Ga0439447_000041 3300041407 Bacteria 44988
89 Ga0439447_050281 3300041407 Bacteria 996
90 Ga0439447_050541 3300041407 Bacteria 993
91 Ga0439466_0094570 3300041411 Bacteria 935
92 Ga0439431_0137037 3300041997 Bacteria 690
93 Ga0439432_079155 3300042006 Bacteria 996
94 Ga0439432_094711 3300042006 Bacteria 896
95 Ga0439432_253700 3300042006 Bacteria 504
96 Ga0439451_020107 3300042009 Bacteria 1345
97 Ga0439452_000096 3300042010 Bacteria 74598
98 Ga0439456_001054 3300042013 Bacteria 5492
99 Ga0439456_006158 3300042013 Bacteria 2443
100 Ga0439456_058063 3300042013 Bacteria 849
101 Ga0450911_000431 3300042115 Bacteria 13745
102 Ga0450890_000207 3300042127 Bacteria 9020
103 Ga0450900_006865 3300042136 Bacteria 1388
104 Ga0450902_026753 3300042137 Bacteria 965
105 Ga0450905_008280 3300042142 Bacteria 1422
106 Ga0450906_000158 3300042145 Bacteria 12661
107 Ga0450907_018497 3300042146 Bacteria 1166
108 Ga0450907_033747 3300042146 Bacteria 872
109 Ga0439446_0202798 3300042156 Bacteria 670
110 Ga0450908_063541 3300042184 Bacteria 650
111 Ga0439464_0098706 3300042439 Bacteria 886
112 Ga0450918_033950 3300042531 Bacteria 905
113 Ga0451577_0307039 3300042876 Bacteria 1438
114 Ga0439440_0001358 3300042993 Bacteria 4447
115 Ga0495617_034434 3300046452 Bacteria 1700
116 Ga0495617_116688 3300046452 Bacteria 861
117 Ga0495592_0057229 3300046454 Bacteria 2878
118 Ga0495603_0017469 3300046455 Bacteria 4339
119 Ga0495590_0079500 3300046457 Bacteria 1154
120 Ga0495590_0109302 3300046457 Bacteria 986
121 Ga0495590_0115610 3300046457 Bacteria 959
122 Ga0495591_001428 3300046458 Bacteria 14870
123 Ga0495638_0029630 3300046460 Bacteria 3530
124 Ga0495638_0035396 3300046460 Bacteria 3183
125 Ga0495638_0086586 3300046460 Bacteria 1893
126 Ga0495638_0117463 3300046460 Bacteria 1574
127 Ga0495638_0288807 3300046460 Unclassified 888
128 Ga0495650_0005049 3300046471 Bacteria 8738
129 Ga0495605_0001343 3300046474 Bacteria 16289
130 Ga0495605_0039268 3300046474 Bacteria 2372
131 Ga0495639_0017714 3300046475 Bacteria 3095
132 Ga0495584_0001143 3300046491 Bacteria 16405
133 Ga0495584_0527872 3300046491 Bacteria 601
134 Ga0495585_0020910 3300046492 Bacteria 3759
135 Ga0495594_0070160 3300046499 Bacteria 1947
136 Ga0495594_0253931 3300046499 Bacteria 1001
137 Ga0495607_0000023 3300046501 Bacteria 159908
138 Ga0495607_0014488 3300046501 Bacteria 5126
139 Ga0495607_0027856 3300046501 Bacteria 3488
140 Ga0495607_0076857 3300046501 Bacteria 1845
141 Ga0495583_0005204 3300046506 Bacteria 8939
142 Ga0495583_0017697 3300046506 Bacteria 3777
143 Ga0495583_0199846 3300046506 Bacteria 812
144 Ga0495610_0002519 3300046512 Bacteria 15289
145 Ga0495610_0175156 3300046512 Bacteria 896
146 Ga0495616_0006212 3300046513 Bacteria 7261
147 Ga0495620_0108488 3300046515 Bacteria 1101
148 Ga0495620_0175610 3300046515 Bacteria 829
149 Ga0495631_0034472 3300046518 Bacteria 2269
150 Ga0495631_0509861 3300046518 Bacteria 512
151 Ga0495632_0000345 3300046519 Bacteria 44166
152 Ga0495632_0136831 3300046519 Bacteria 1138
153 Ga0495632_0336244 3300046519 Bacteria 665
154 Ga0495637_0000843 3300046520 Bacteria 20245
155 Ga0495637_0001803 3300046520 Bacteria 12258
156 Ga0495637_0050851 3300046520 Bacteria 1737
157 Ga0495637_0110291 3300046520 Bacteria 1067
158 Ga0495643_0062515 3300046522 Bacteria 1970
159 Ga0495643_0147533 3300046522 Bacteria 1167
160 Ga0495643_0319749 3300046522 Bacteria 702
161 Ga0495644_0308703 3300046523 Bacteria 619
162 Ga0495648_0036633 3300046524 Bacteria 3161
163 Ga0495663_0352768 3300046525 Bacteria 536
164 Ga0495642_0000071 3300046528 Bacteria 60529
165 Ga0495654_0062999 3300046530 Bacteria 1776
166 Ga0495654_0179851 3300046530 Bacteria 916
167 Ga0495609_0000337 3300046538 Bacteria 41498
168 Ga0495609_0009171 3300046538 Bacteria 4797
169 Ga0495609_0031785 3300046538 Bacteria 2398
170 Ga0495609_0102024 3300046538 Bacteria 1242
171 Ga0495597_0081515 3300046542 Bacteria 1383
172 Ga0495597_0227294 3300046542 Bacteria 739
173 Ga0495622_0040892 3300046557 Bacteria 2156
174 Ga0495622_0194825 3300046557 Bacteria 904
175 Ga0495656_0001827 3300046615 Bacteria 6996
176 Ga0495656_0451107 3300046615 Bacteria 677
177 Ga0495668_0221435 3300046616 Bacteria 1036
178 Ga0495634_0580075 3300046642 Bacteria 652
179 Ga0495611_0176784 3300046648 Bacteria 997
180 Ga0495611_0405664 3300046648 Bacteria 623
181 Ga0495625_0000198 3300046660 Bacteria 95530
182 Ga0495625_0045668 3300046660 Bacteria 3165
183 Ga0495625_0318155 3300046660 Bacteria 991
184 Ga0495625_0418042 3300046660 Bacteria 834
185 Ga0495625_0499894 3300046660 Bacteria 743
186 Ga0495659_0020254 3300046664 Bacteria 2232
187 Ga0495661_0267479 3300046665 Bacteria 866
188 Ga0495588_0095848 3300046674 Bacteria 1556
189 Ga0495588_0233427 3300046674 Bacteria 970
190 Ga0495588_0273740 3300046674 Bacteria 889
191 Ga0495669_0003039 3300046684 Bacteria 6897
192 Ga0495669_0117957 3300046684 Bacteria 1242
193 Ga0495613_0156547 3300046689 Bacteria 1623
194 Ga0495613_0281986 3300046689 Unclassified 1153
195 Ga0495624_0229337 3300046690 Bacteria 1125
196 Ga0495670_0003088 3300046691 Bacteria 8216
197 Ga0495670_0300662 3300046691 Unclassified 860
198 Ga0495671_0002890 3300046692 Bacteria 10728
199 Ga0495671_0008358 3300046692 Bacteria 5827
200 Ga0495671_0027747 3300046692 Bacteria 2920
201 Ga0495671_0101977 3300046692 Bacteria 1402
202 Ga0495649_0032199 3300046694 Bacteria 2889
203 Ga0495649_0215401 3300046694 Bacteria 994
204 Ga0495589_0003118 3300046794 Bacteria 9071
205 Ga0495660_0006562 3300046810 Bacteria 6873
206 Ga0495660_0203955 3300046810 Bacteria 942
207 Ga0495660_0215715 3300046810 Bacteria 908
208 Ga0495636_0234269 3300047318 Bacteria 845
209 Ga0495674_0044335 3300047319 Bacteria 3955
210 Ga0495672_0152225 3300047320 Bacteria 1198
211 Ga0495680_1099086 3300047322 Bacteria 502
212 Ga0495683_0013469 3300047323 Bacteria 4276
213 Ga0495683_0015626 3300047323 Bacteria 3945
214 Ga0495683_0165934 3300047323 Bacteria 1018
215 Ga0495687_196074 3300047443 Unclassified 645
216 Ga0495677_0002128 3300047445 Bacteria 7843
217 Ga0495679_012003 3300047446 Bacteria 3322
218 Ga0495679_038478 3300047446 Bacteria 1498
219 Ga0495679_126772 3300047446 Bacteria 694
220 Ga0495673_0000287 3300047469 Bacteria 67754
221 Ga0495673_0000826 3300047469 Bacteria 29041
222 Ga0495673_0001525 3300047469 Bacteria 18250
223 Ga0495673_0225138 3300047469 Bacteria 692
224 Ga0495681_0000910 3300047470 Bacteria 22843
225 Ga0495681_0084238 3300047470 Bacteria 1414
226 Ga0495681_0238982 3300047470 Bacteria 722
227 Ga0495686_0141268 3300047472 Bacteria 1421
228 Ga0495626_0033279 3300048091 Bacteria 2472
229 Ga0495626_0083901 3300048091 Bacteria 1410
230 Ga0496103_0012042 3300048906 Bacteria 5137
231 Ga0496110_0325478 3300048913 Bacteria 1400
232 Ga0496114_0593835 3300048917 Bacteria 977
233 Ga0496116_0193185 3300048919 Bacteria 1075
234 Ga0496117_0005170 3300048920 Bacteria 13922
235 Ga0496118_0183211 3300048921 Bacteria 1262
236 Ga0496121_0024815 3300048924 Bacteria 5718
237 Ga0496125_0334279 3300048928 Bacteria 912
238 Ga0495678_009095 3300049459 Bacteria 4954
239 Ga0495678_012021 3300049459 Bacteria 4120
240 Ga0495682_0059945 3300049460 Bacteria 1374
241 Ga0495682_0158024 3300049460 Bacteria 807
242 Ga0495682_0226503 3300049460 Unclassified 662
243 Ga0501033_0005378 3300049570 Bacteria 10148
244 Ga0501037_0322362 3300049573 Bacteria 1070
245 Ga0501038_0212351 3300049574 Bacteria 1547
246 Ga0501043_0050968 3300049579 Bacteria 3254
247 Ga0501043_1195459 3300049579 Unclassified 534
248 Ga0501047_1022561 3300049581 Bacteria 640
249 Ga0501235_012502 3300049669 Bacteria 1867
250 Ga0501262_037134 3300049759 Bacteria 718
251 Ga0501044_0082146 3300049823 Bacteria 3261
252 Ga0501044_0920543 3300049823 Bacteria 748
253 nmdc:mga03683_11983_c1 3300050489 Bacteria 3154
254 nmdc:mga03n38_6979_c1 3300050490 Bacteria 3968
255 nmdc:mga00v17_18659_c1 3300050491 Bacteria 3945
256 nmdc:mga00v17_25901_c1 3300050491 Bacteria 3412
257 nmdc:mga00v17_616812_c1 3300050491 Bacteria 699
258 nmdc:mga0yw44_91206_c1 3300050492 Bacteria 1926
259 nmdc:mga0k408_9167_c2 3300050493 Bacteria 4225
260 nmdc:mga06z11_106091_c1 3300050494 Bacteria 1549
261 nmdc:mga04h51_200580_c1 3300050495 Unclassified 784
262 nmdc:mga07m45_2694_c1 3300050496 Bacteria 8366
263 Ga0500610_0354030 3300053079 Bacteria 620
264 Ga0500578_0519294 3300053086 Unclassified 667
265 Ga0500646_0090100 3300053090 Bacteria 948
266 Ga0500583_0001231 3300053092 Bacteria 7326
267 Ga0500583_0240671 3300053092 Bacteria 894
268 Ga0500555_024774 3300053103 Bacteria 1717
269 Ga0500607_000025 3300053121 Bacteria 95473
270 Ga0500607_182050 3300053121 Bacteria 930
271 Ga0500652_221837 3300053131 Unclassified 760
272 Ga0500559_0007283 3300053136 Bacteria 4915
273 Ga0500590_207918 3300053148 Bacteria 820
274 Ga0500636_0117543 3300053177 Bacteria 1495
275 2511268728 2511231006 Bacteria 6794709
276 2511361254 2511231022 Bacteria 6719296
277 2585329825 2582581316 Bacteria 7774528
278 2585901290 2585427608 Bacteria 6544331
279 2600367756 2600254931 Bacteria 6734225
280 2624477931 2623620443 Bacteria 6427864
281 2743734777 2740892503 Bacteria 6855563
282 2839142796 2839138175 Bacteria 6549354
283 2919390035 2919385768 Bacteria 5897293
284 2923153764 2923153595 Bacteria 6870622
285 2935358659 2935353572 Unclassified 6955622
286 2945977269 2945972063 Bacteria 6086495
287 2979743817 2979742915 Bacteria 7301278
288 3005423410 3005416602 Bacteria 7064308
289 3007857347 3007855910 Bacteria 5637581
290 8030000535 8029995093 Bacteria 5990776
291 Ga0439438_049478
292 MRS2a_Contig_10617
293 LJNas_1000475
294 LJNas_1001877
295 LJNas_1005155
296 Ga0055528_1048868
297 Ga0065165_1054439
298 Ga0065714_10024020
299 Ga0065714_10123864
300 Ga0065712_10030054
301 Ga0065715_10643389
302 Ga0070669_100457360
303 Ga0070714_100073623
304 Ga0075365_10104707
305 Ga0075363_100040880
306 Ga0075364_10015427
307 Ga0075364_10116187
308 Ga0075364_10650130
309 Ga0075432_10039839
310 Ga0075362_10020313
311 Ga0075367_10733815
312 Ga0075366_10008143
313 Ga0105251_10171017
314 Ga0105244_10217685
315 Ga0105250_10163951
316 Ga0105250_10249910
317 Ga0105243_10000440
318 Ga0105246_10126940
319 Ga0157373_10022765
320 Ga0157373_10023206
321 Ga0157373_10943485
322 Ga0157371_10000866
323 Ga0157370_10015157
324 Ga0157370_10755240
325 Ga0163162_10017740
326 Ga0163162_11097456
327 Ga0157375_11171390
328 Ga0182008_10229274
329 Ga0182008_10297218
330 Ga0182005_1017685
331 Ga0182005_1076607
332 Ga0163161_10156987
333 Ga0163161_11526378
334 Ga0213872_10097637
335 Ga0209673_1088881
336 Ga0209130_1000467
337 Ga0209025_1005394
338 Ga0209564_1042875
339 Ga0209758_1130228
340 Ga0207696_1042260
341 Ga0207655_1103249
342 Ga0207713_1098060
343 Ga0207681_10580875
344 Ga0207664_10064475
345 Ga0207709_10000058
346 Ga0207639_10745551
347 Ga0209281_1030234
348 Ga0209371_1081758
349 Ga0209813_10179684
350 Ga0207428_10231660
351 Ga0265338_10040681
352 Ga0268256_1071283
353 Ga0307511_10013797
354 Ga0265327_10040103
355 Ga0307408_100017070
356 Ga0307405_10121121
357 Ga0307405_10271253
358 Ga0307410_11418358
359 Ga0307406_10818872
360 Ga0307412_10396949
361 Ga0307412_10485383
362 Ga0307416_100277734
363 Ga0307414_10232334
364 Ga0307411_10060689
365 Ga0307411_10148788
366 Ga0307415_100401194
367 Ga0373931_0015819
368 Ga0400490_34547
369 Ga0400485_19701
370 Ga0400488_20176
371 Ga0400486_25119
372 Ga0400483_025078
373 Ga0400487_44677
374 Ga0436361_1199162
375 Ga0439438_006432
376 Ga0439438_051174
377 Ga0439438_075339
378 Ga0439447_000041
379 Ga0439447_050281
380 Ga0439447_050541
381 Ga0439466_0094570
382 Ga0439431_0137037
383 Ga0439432_079155
384 Ga0439432_094711
385 Ga0439432_253700
386 Ga0439451_020107
387 Ga0439452_000096
388 Ga0439456_001054
389 Ga0439456_006158
390 Ga0439456_058063
391 Ga0450911_000431
392 Ga0450890_000207
393 Ga0450900_006865
394 Ga0450902_026753
395 Ga0450905_008280
396 Ga0450906_000158
397 Ga0450907_018497
398 Ga0450907_033747
399 Ga0439446_0202798
400 Ga0450908_063541
401 Ga0439464_0098706
402 Ga0450918_033950
403 Ga0451577_0307039
404 Ga0439440_0001358
405 Ga0495617_034434
406 Ga0495617_116688
407 Ga0495592_0057229
408 Ga0495603_0017469
409 Ga0495590_0079500
410 Ga0495590_0109302
411 Ga0495590_0115610
412 Ga0495591_001428
413 Ga0495638_0029630
414 Ga0495638_0035396
415 Ga0495638_0086586
416 Ga0495638_0117463
417 Ga0495638_0288807
418 Ga0495650_0005049
419 Ga0495605_0001343
420 Ga0495605_0039268
421 Ga0495639_0017714
422 Ga0495584_0001143
423 Ga0495584_0527872
424 Ga0495585_0020910
425 Ga0495594_0070160
426 Ga0495594_0253931
427 Ga0495607_0000023
428 Ga0495607_0014488
429 Ga0495607_0027856
430 Ga0495607_0076857
431 Ga0495583_0005204
432 Ga0495583_0017697
433 Ga0495583_0199846
434 Ga0495610_0002519
435 Ga0495610_0175156
436 Ga0495616_0006212
437 Ga0495620_0108488
438 Ga0495620_0175610
439 Ga0495631_0034472
440 Ga0495631_0509861
441 Ga0495632_0000345
442 Ga0495632_0136831
443 Ga0495632_0336244
444 Ga0495637_0000843
445 Ga0495637_0001803
446 Ga0495637_0050851
447 Ga0495637_0110291
448 Ga0495643_0062515
449 Ga0495643_0147533
450 Ga0495643_0319749
451 Ga0495644_0308703
452 Ga0495648_0036633
453 Ga0495663_0352768
454 Ga0495642_0000071
455 Ga0495654_0062999
456 Ga0495654_0179851
457 Ga0495609_0000337
458 Ga0495609_0009171
459 Ga0495609_0031785
460 Ga0495609_0102024
461 Ga0495597_0081515
462 Ga0495597_0227294
463 Ga0495622_0040892
464 Ga0495622_0194825
465 Ga0495656_0001827
466 Ga0495656_0451107
467 Ga0495668_0221435
468 Ga0495634_0580075
469 Ga0495611_0176784
470 Ga0495611_0405664
471 Ga0495625_0000198
472 Ga0495625_0045668
473 Ga0495625_0318155
474 Ga0495625_0418042
475 Ga0495625_0499894
476 Ga0495659_0020254
477 Ga0495661_0267479
478 Ga0495588_0095848
479 Ga0495588_0233427
480 Ga0495588_0273740
481 Ga0495669_0003039
482 Ga0495669_0117957
483 Ga0495613_0156547
484 Ga0495613_0281986
485 Ga0495624_0229337
486 Ga0495670_0003088
487 Ga0495670_0300662
488 Ga0495671_0002890
489 Ga0495671_0008358
490 Ga0495671_0027747
491 Ga0495671_0101977
492 Ga0495649_0032199
493 Ga0495649_0215401
494 Ga0495589_0003118
495 Ga0495660_0006562
496 Ga0495660_0203955
497 Ga0495660_0215715
498 Ga0495636_0234269
499 Ga0495674_0044335
500 Ga0495672_0152225
501 Ga0495680_1099086
502 Ga0495683_0013469
503 Ga0495683_0015626
504 Ga0495683_0165934
505 Ga0495687_196074
506 Ga0495677_0002128
507 Ga0495679_012003
508 Ga0495679_038478
509 Ga0495679_126772
510 Ga0495673_0000287
511 Ga0495673_0000826
512 Ga0495673_0001525
513 Ga0495673_0225138
514 Ga0495681_0000910
515 Ga0495681_0084238
516 Ga0495681_0238982
517 Ga0495686_0141268
518 Ga0495626_0033279
519 Ga0495626_0083901
520 Ga0496103_0012042
521 Ga0496110_0325478
522 Ga0496114_0593835
523 Ga0496116_0193185
524 Ga0496117_0005170
525 Ga0496118_0183211
526 Ga0496121_0024815
527 Ga0496125_0334279
528 Ga0495678_009095
529 Ga0495678_012021
530 Ga0495682_0059945
531 Ga0495682_0158024
532 Ga0495682_0226503
533 Ga0501033_0005378
534 Ga0501037_0322362
535 Ga0501038_0212351
536 Ga0501043_0050968
537 Ga0501043_1195459
538 Ga0501047_1022561
539 Ga0501235_012502
540 Ga0501262_037134
541 Ga0501044_0082146
542 Ga0501044_0920543
543 nmdc:mga03683_11983_c1
544 nmdc:mga03n38_6979_c1
545 nmdc:mga00v17_18659_c1
546 nmdc:mga00v17_25901_c1
547 nmdc:mga00v17_616812_c1
548 nmdc:mga0yw44_91206_c1
549 nmdc:mga0k408_9167_c2
550 nmdc:mga06z11_106091_c1
551 nmdc:mga04h51_200580_c1
552 nmdc:mga07m45_2694_c1
553 Ga0500610_0354030
554 Ga0500578_0519294
555 Ga0500646_0090100
556 Ga0500583_0001231
557 Ga0500583_0240671
558 Ga0500555_024774
559 Ga0500607_000025
560 Ga0500607_182050
561 Ga0500652_221837
562 Ga0500559_0007283
563 Ga0500590_207918
564 Ga0500636_0117543
565 2511268728
566 2511361254
567 2585329825
568 2585901290
569 2600367756
570 2624477931
571 2743734777
572 2839142796
573 2919390035
574 2923153764
575 2935358659
576 2945977269
577 2979743817
578 3005423410
579 3007857347
580 8030000535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

3

89

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9202 1 90
5cze-assembly1.cif.gz_J crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.8979 1 92
5ceg-assembly1.cif.gz_B x-ray structure of toxin/anti-toxin complex from mesorhizobium opportunistum 0.8958 1 89
8c24-assembly1.cif.gz_B parde1 toxin-antitoxin complex from mycobacterium tuberculosis (rv1960c-rv1959c) 0.8894 1 86
6x0a-assembly17.cif.gz_Q x-ray structure of a chimeric parde toxin-antitoxin complex from mesorhizobium opportunistum 0.8866 3 89
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.925 3 88 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.894 1 93 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8849 1 93 3.30.2310.20
af_P9WHG5_4_92_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8841 2 88 3.30.2310.20
3kxeB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8811 1 88 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A502GYR8-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9899 1 93
AF-J2P4S0-F1-model_v4 Plasmid stabilization system protein 0.9882 1 93
AF-A0A418XW20-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9854 1 86
AF-A0A0H5Q0J9-F1-model_v4 Addiction module toxin, RelE/StbE family 0.9828 1 89
AF-A0A2N8DZU3-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9779 1 90

Map